set nuclear proto-oncogene

Overview
Nameset nuclear proto-oncogene (AKG62127.1)
Smed IDSMED30023430
Length (bp)1267
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of set nuclear proto-oncogene (SMED30023430) t-SNE clustered cells

Violin plots show distribution of expression levels for set nuclear proto-oncogene (SMED30023430) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of set nuclear proto-oncogene (SMED30023430) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for set nuclear proto-oncogene (SMED30023430) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023430

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 36

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023430SMESG000031906.1 SMESG000031905.1 SmedASXL_004290SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023430SMESG000031906.1 SMESG000031905.1 SmedASXL_004290SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000031906.1 SMESG000031905.1 SMESG000023958.1 Contig4820uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000031906.1 SMESG000031905.1 SMESG000023958.1 Contig4820newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000016955.1 Contig4820uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000016955.1 Contig4820newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v4_618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000031906.1 SMESG000031905.1 Contig37014uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000031906.1 SMESG000031905.1 Contig37014newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000031906.1 SMESG000031905.1 Contig3786uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000031906.1 SMESG000031905.1 Contig3786newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000051295.1 Contig3786uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023430SMESG000051295.1 Contig3786newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30023430SMESG000031906.1 SMESG000031905.1 dd_Smed_v6_618_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30023430SMESG000031906.1 SMESG000078802.1 SMESG000064992.1 SMESG000055754.1 SMESG000050624.1 SMESG000050575.1 SMESG000048049.1 SMESG000046063.1 SMESG000045598.1 SMESG000044357.1 SMESG000035103.1 SMESG000031905.1 SMESG000023958.1 SMESG000008567.1 SMESG000005405.1 Contig11uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30023430SMESG000031906.1 SMESG000078802.1 SMESG000064992.1 SMESG000055754.1 SMESG000050624.1 SMESG000050575.1 SMESG000048049.1 SMESG000046063.1 SMESG000045598.1 SMESG000044357.1 SMESG000035103.1 SMESG000031905.1 SMESG000023958.1 SMESG000008567.1 SMESG000005405.1 Contig11uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30023430SMESG000031906.1 SMESG000078802.1 SMESG000064992.1 SMESG000055754.1 SMESG000050624.1 SMESG000050575.1 SMESG000048049.1 SMESG000046063.1 SMESG000045598.1 SMESG000044357.1 SMESG000035103.1 SMESG000031905.1 SMESG000023958.1 SMESG000008567.1 SMESG000005405.1 Contig11newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30023430SMESG000031906.1 SMESG000078802.1 SMESG000064992.1 SMESG000055754.1 SMESG000050624.1 SMESG000050575.1 SMESG000048049.1 SMESG000046063.1 SMESG000045598.1 SMESG000044357.1 SMESG000035103.1 SMESG000031905.1 SMESG000023958.1 SMESG000008567.1 SMESG000005405.1 Contig11newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30023430SMESG000007787.1 Contig11uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30023430SMESG000007787.1 Contig11uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30023430SMESG000007787.1 Contig11newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30023430SMESG000007787.1 Contig11newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
neoblastSMED30023430SMESG000031906.1 SMED_01754_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023430SMESG000031906.1 SMED_01754_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023430SMESG000031906.1 SMESG000031905.1 SMED_01754_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023430SMESG000031906.1 SMESG000031905.1 SMED_01754_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of set nuclear proto-oncogene vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 199.134 bits (505), Expect = 2.255e-60
Identity = 106/221 (47.96%), Postives = 137/221 (61.99%), Query Frame = 1
Query:   88 ASAPKIQKTESNGKVD-----QDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            A A K+ K E N   D      ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    3 APAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 196.052 bits (497), Expect = 1.945e-59
Identity = 99/192 (51.56%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   20 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 209          
BLAST of set nuclear proto-oncogene vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 196.823 bits (499), Expect = 2.143e-59
Identity = 99/192 (51.56%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   45 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 234          
BLAST of set nuclear proto-oncogene vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 196.052 bits (497), Expect = 2.563e-59
Identity = 99/192 (51.56%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   21 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 210          
BLAST of set nuclear proto-oncogene vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 194.897 bits (494), Expect = 5.998e-59
Identity = 99/192 (51.56%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   23 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 212          
BLAST of set nuclear proto-oncogene vs. Ensembl Celegans
Match: spr-2 (Suppressor of presenilin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18240])

HSP 1 Score: 152.525 bits (384), Expect = 1.340e-42
Identity = 85/198 (42.93%), Postives = 117/198 (59.09%), Query Frame = 1
Query:  145 VLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKN--FVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            V   LIE +D +Q  +D ++E A+EE+L+VE+ FNQKR P++++R  L   I NFW  A  NH  L T I E  E+LL +L  L+V+EF+D++SGFKIIMTF  NEYFTN  ITKS H+      T    ++WK+ K   F     +S +              +F++W T        E+ EVIKDDL+ NPLQYY+
Sbjct:   27 VKEKLIE-LDAIQHQLDVMSENAAEEVLKVEQIFNQKRLPIYEKRKKLTTKIDNFWQTAFLNHHLLSTAIPEEQEDLLAALRDLEVQEFEDLRSGFKIIMTFDPNEYFTNEVITKSYHLQSESPSTEITEIEWKENKKPPFKPEDGDSAH--------------TFLEWLTYAALPDSDEIAEVIKDDLYVNPLQYYV 209          
BLAST of set nuclear proto-oncogene vs. Ensembl Celegans
Match: spr-2 (Suppressor of presenilin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18240])

HSP 1 Score: 150.984 bits (380), Expect = 5.074e-42
Identity = 84/198 (42.42%), Postives = 117/198 (59.09%), Query Frame = 1
Query:  145 VLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKN--FVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            V   LIE +D +Q  +D ++E A+EE+L+VE+ FNQKR P++++R  L   I NFW  A  NH  L T I E  E+LL +L  L+V+EF+D++SGFKIIMTF  NEYFTN  ITKS H+      T    ++WK+ K   F +  + +                +F++W T        E+ EVIKDDL+ NPLQYY+
Sbjct:   27 VKEKLIE-LDAIQHQLDVMSENAAEEVLKVEQIFNQKRLPIYEKRKKLTTKIDNFWQTAFLNHHLLSTAIPEEQEDLLAALRDLEVQEFEDLRSGFKIIMTFDPNEYFTNEVITKSYHLQSESPSTEITEIEWKENKKPPFPEDGDSAH---------------TFLEWLTYAALPDSDEIAEVIKDDLYVNPLQYYV 208          
BLAST of set nuclear proto-oncogene vs. Ensembl Celegans
Match: nap-1 (Nucleosome Assembly Protein [Source:UniProtKB/TrEMBL;Acc:Q19007])

HSP 1 Score: 56.9954 bits (136), Expect = 7.333e-9
Identity = 34/100 (34.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  292 KTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVG---ESE----------IKTTCDTVDWKDG 552
            K I +FW+ AL  H  +   I EHD  +L  LT +      D  +GFKI   F++N YF N  +TK+  +G   ++E          I+   DT++W+DG
Sbjct:  111 KGIKDFWLTALRTHDLVAEAIEEHDVPILSYLTDVTTAASKD-PAGFKIEFHFATNPYFKNQVLTKTYLLGFDPDAEAPLQFDGPHVIRAVGDTIEWEDG 209          
BLAST of set nuclear proto-oncogene vs. Ensembl Fly
Match: Set (gene:FBgn0014879 transcript:FBtr0083062)

HSP 1 Score: 164.466 bits (415), Expect = 1.730e-47
Identity = 88/226 (38.94%), Postives = 133/226 (58.85%), Query Frame = 1
Query:   76 RESMASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIK-------TTCDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            R  +  AP    T +    ++++  +  +E+ID  Q++ID LNE+ASEEIL+VE+K+N+ R+P +++R+ L+K IPNFW+ +  NHPQ+  ++ E +EE L +L  L+VEEF+DIKSG++I   F  N YF N  +TK  H+  +          +T   + WK+GKN +K L                   +F  WF+ +      E+ E+IKDDLWPNPLQYYL
Sbjct:    7 RAKLDGAPADGNTSAAAGNNEEE--SEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYK---TFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYL 227          
BLAST of set nuclear proto-oncogene vs. Ensembl Fly
Match: mil (gene:FBgn0267366 transcript:FBtr0085246)

HSP 1 Score: 52.373 bits (124), Expect = 2.649e-7
Identity = 37/154 (24.03%), Postives = 67/154 (43.51%), Query Frame = 1
Query:  199 LNEQASEEILEVEKKFNQKRQPLFQQRANLI--------------KTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHV-------------GESEIKTTCDTVDWKDGKNFVKSLNE 579
            L+     +I  +EKK+  K   +F +R  ++              +++PNFW+  L         I++ DE++L+ L+ +    +++    F I   F  N+YFTNT +TK+  +             G    K     +DWK  K+  K+ N+
Sbjct:   47 LDVALQRDIYNIEKKYEDKHNIIFDKRKKILDEFRKQNHGDVETNQSVPNFWLRVLKA--SYTEFISKRDEKILECLSDIRSRLYNEPVVKFDIEFHFDPNDYFTNTVLTKTYFLNCLPDPDDPLAYDGAEIYKCEGCVIDWKQTKDQTKTENQ 198          
BLAST of set nuclear proto-oncogene vs. Ensembl Zebrafish
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 200.29 bits (508), Expect = 4.399e-61
Identity = 107/221 (48.42%), Postives = 137/221 (61.99%), Query Frame = 1
Query:   88 ASAPKIQKTESNGKVD-----QDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            ASA K+ + E N   D      ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N   +K  H+ ES   ++  T + WK GK+  K   ++ N   AG K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    3 ASAAKVSRKEQNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTEIKWKAGKDLTKRTGQTPN--KAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Zebrafish
Match: seta (SET nuclear proto-oncogene a [Source:ZFIN;Acc:ZDB-GENE-030131-2221])

HSP 1 Score: 199.904 bits (507), Expect = 4.855e-61
Identity = 109/221 (49.32%), Postives = 139/221 (62.90%), Query Frame = 1
Query:   88 ASAPKIQKTESNGKVD-----QDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            ASA K+ K E N   D      ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K IH+ ES   T+  T + WK GK+       S  ++ AG K     P SF  WFT    +   ELGEVIKDD+WPNPLQYYL
Sbjct:    3 ASAAKVSKKELNSNHDGGDETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENMYFENKVLSKEIHLNESGDPTSKSTEIKWKPGKDLTS--RSSQTQSKAGKKRQHEEPESFFTWFTDHADSGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Zebrafish
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 199.519 bits (506), Expect = 1.071e-60
Identity = 107/221 (48.42%), Postives = 137/221 (61.99%), Query Frame = 1
Query:   88 ASAPKIQKTESNGKVD-----QDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            ASA K+ + E N   D      ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N   +K  H+ ES   ++  T + WK GK+  K   ++ N   AG K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    3 ASAAKVSRKEQNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTEIKWKAGKDLTKRTGQTPN--KAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Zebrafish
Match: tspy (testis specific protein Y-linked [Source:ZFIN;Acc:ZDB-GENE-030131-9158])

HSP 1 Score: 110.923 bits (276), Expect = 4.838e-26
Identity = 56/189 (29.63%), Postives = 97/189 (51.32%), Query Frame = 1
Query:  169 IDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTT-CDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            + +VQ  +D L ++ +     +E K +++R+P   QR+ + + +P FW+ AL NHP L   I E DE+ L  +T+L++E F + K G++I   F  N +F N  I K +H+G      +  + + W  G+N V S                    SF  WF+        ++ +++++DL+ NPL+YYL
Sbjct:  232 LAQVQMRLDALEKKGARLHQRLEMKLSRQRRPHLDQRSAITQAVPGFWVTALLNHPHLSAHIDETDEDALSYMTNLEIESFKNNKLGYRICFHFRRNPFFQNKMIVKELHLGMGGSPVSFSNPILWHRGQNLVGSGEPRRTSQGVYQ--------SFFHWFSDHSNPGRDDIAQILREDLYRNPLRYYL 412          
BLAST of set nuclear proto-oncogene vs. Ensembl Zebrafish
Match: nap1l1 (nucleosome assembly protein 1-like 1 [Source:ZFIN;Acc:ZDB-GENE-030516-2])

HSP 1 Score: 51.6026 bits (122), Expect = 8.982e-7
Identity = 44/201 (21.89%), Postives = 74/201 (36.82%), Query Frame = 1
Query:  142 QVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLI-----------------------------------------------KTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKS--GFKIIMTFSSNEYFTNTTITKSIHV-------------GESEIKTTCDTVDWKDGKN 558
            +V+   +  +  +Q     +  +  EE+ E+E+K+    QPLF +R+ ++                                               K IP FW+    N   L  ++ EHDE +L+ L  + V +F D      F +   F  N++FT T +TK+  +             G   +  T  T+DW  GKN
Sbjct:   60 KVVKRRVNALKNLQVKCAHIEAKFYEEVHELERKYAALYQPLFDKRSEIVRAAYEPTDEECEWKQDEEEELTVSKQEEMKEKAKVEEEKKDEEKEDPKGIPEFWLTVFKNVDLLSEMLQEHDEPILKHLQDIKV-KFSDAGQPMSFTLEFHFEPNDFFTQTILTKTYKMRSEPDESDPFSFDGPEIMGCTGCTIDWTKGKN 259          
BLAST of set nuclear proto-oncogene vs. Ensembl Xenopus
Match: bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1 [Source:Xenbase;Acc:XB-GENE-957116])

HSP 1 Score: 199.134 bits (505), Expect = 1.627e-60
Identity = 106/221 (47.96%), Postives = 137/221 (61.99%), Query Frame = 1
Query:   88 ASAPKIQKTESNGKVD-----QDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            A A K+ K E N   D      ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    3 APAAKVSKKEVNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Xenopus
Match: bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1 [Source:Xenbase;Acc:XB-GENE-957116])

HSP 1 Score: 199.134 bits (505), Expect = 1.824e-60
Identity = 106/221 (47.96%), Postives = 137/221 (61.99%), Query Frame = 1
Query:   88 ASAPKIQKTESNGKVD-----QDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            A A K+ K E N   D      ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    3 APAAKVSKKEVNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Xenopus
Match: bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1 [Source:Xenbase;Acc:XB-GENE-957116])

HSP 1 Score: 195.282 bits (495), Expect = 7.209e-59
Identity = 99/192 (51.56%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   39 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 228          
BLAST of set nuclear proto-oncogene vs. Ensembl Xenopus
Match: os9 (osteosarcoma amplified 9, endoplasmic reticulum lectin [Source:Xenbase;Acc:XB-GENE-5952460])

HSP 1 Score: 122.865 bits (307), Expect = 4.578e-30
Identity = 61/194 (31.44%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  154 SLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGES-EIKTTCDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            S ++ ++ +Q ++  +NE+A    L++++++   R+P  Q+R ++I+ IP FW+ A  NHPQL  +I + DE+ L  + +L VE+F   K+  KI   F+ N YF N  I K    G S  + +    + W  G+N       S +              SF  WF+     +   +  +IK+DLWPNPL+YYL
Sbjct:  191 SSLQALESIQKELRAVNERADRAFLQLKRRYGHLRRPHIQKRNDIIRKIPGFWVTAFLNHPQLSAMIDDRDEDTLSYMNNLQVEDFTHTKASCKIKFYFNPNPYFKNEVIIKEFQYGSSGRLVSRSTPIRWWRGQNPAYRGKSSGSAP------------SFFSWFSDHSFPAADRIAAIIKEDLWPNPLEYYL 372          
BLAST of set nuclear proto-oncogene vs. Ensembl Xenopus
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:407956])

HSP 1 Score: 54.299 bits (129), Expect = 1.793e-7
Identity = 44/197 (22.34%), Postives = 76/197 (38.58%), Query Frame = 1
Query:  142 QVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLI-------------------------------------------KTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKS--GFKIIMTFSSNEYFTNTTITKSIHV-------------GESEIKTTCDTVDWKDGKN 558
            +V+   +  +  +Q    ++  +  EE+ E+E+K+    QPLF +R+++I                                           K IP FW+    N   L  ++ EHDE +L+ L  + V +F +      F +   F  N++FTN  +TK+  +             G   +  T   +DWK GKN
Sbjct:   78 KVVKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPLFDKRSDIINATYEPTEEECEWKVDEEEDISGDLKDKAKLEEEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKV-KFSEAGQPMSFTLEFHFEPNDFFTNEVLTKTYKMRSEPDESDPFSFDGPEIMGCTGCLIDWKKGKN 273          
BLAST of set nuclear proto-oncogene vs. Ensembl Mouse
Match: Set (SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:1860267])

HSP 1 Score: 207.608 bits (527), Expect = 1.172e-63
Identity = 108/227 (47.58%), Postives = 145/227 (63.88%), Query Frame = 1
Query:   58 LLPHKERESMASAPKIQ-KTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            +LP  ++   A+APK++ K+ S G    ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    9 ILPQPKKPRPAAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 233          
BLAST of set nuclear proto-oncogene vs. Ensembl Mouse
Match: Set (SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:1860267])

HSP 1 Score: 196.438 bits (498), Expect = 1.312e-59
Identity = 99/192 (51.56%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   32 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Mouse
Match: Set (SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:1860267])

HSP 1 Score: 169.859 bits (429), Expect = 3.865e-50
Identity = 90/200 (45.00%), Postives = 126/200 (63.00%), Query Frame = 1
Query:   58 LLPHKERESMASAPKIQ-KTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFT 651
            +LP  ++   A+APK++ K+ S G    ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT
Sbjct:    9 ILPQPKKPRPAAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFT 206          
BLAST of set nuclear proto-oncogene vs. Ensembl Mouse
Match: Set (SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:1860267])

HSP 1 Score: 145.591 bits (366), Expect = 1.115e-41
Identity = 71/143 (49.65%), Postives = 98/143 (68.53%), Query Frame = 1
Query:   58 LLPHKERESMASAPKIQ-KTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTI 483
            +LP  ++   A+APK++ K+ S G    ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  +
Sbjct:    9 ILPQPKKPRPAAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVL 151          
BLAST of set nuclear proto-oncogene vs. Ensembl Mouse
Match: Tspyl1 (testis-specific protein, Y-encoded-like 1 [Source:MGI Symbol;Acc:MGI:1298395])

HSP 1 Score: 122.094 bits (305), Expect = 1.721e-30
Identity = 66/193 (34.20%), Postives = 100/193 (51.81%), Query Frame = 1
Query:  169 IDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDG---KNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYLA 735
            ++ +Q ++D +N QA      +E+KF + R+   ++R  +I+ IP FW+ A  NHPQL  +I   D E+L+ +TSL+V+E    K+G K    F  N YF N  I K   V  S    +  T + W+ G   ++F++  N+ L               SF  WF+         + E+IK+DLWPNPLQYYL 
Sbjct:  174 LEAIQLELDTVNAQADRAFQHLEQKFGRMRRHYLERRNYIIQNIPGFWMTAFRNHPQLSAMIRGRDAEMLRYVTSLEVKELRHPKTGCKFKFFFRRNPYFRNKLIVKEYEVRSSGRVVSLSTPIIWRRGHEPQSFIRR-NQDLI-------------CSFFTWFSDHSLPESDRIAEIIKEDLWPNPLQYYLC 352          
BLAST of set nuclear proto-oncogene vs. UniProt/SwissProt
Match: sp|Q9EQU5|SET_MOUSE (Protein SET OS=Mus musculus OX=10090 GN=Set PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 8.201e-63
Identity = 108/227 (47.58%), Postives = 145/227 (63.88%), Query Frame = 1
Query:   58 LLPHKERESMASAPKIQ-KTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            +LP  ++   A+APK++ K+ S G    ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    9 ILPQPKKPRPAAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 233          
BLAST of set nuclear proto-oncogene vs. UniProt/SwissProt
Match: sp|Q63945|SET_RAT (Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 5.338e-62
Identity = 107/227 (47.14%), Postives = 144/227 (63.44%), Query Frame = 1
Query:   58 LLPHKERESMASAPKIQ-KTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            +LP  ++    +APK++ K+ S G    ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    9 ILPQPKKPRPVAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 233          
BLAST of set nuclear proto-oncogene vs. UniProt/SwissProt
Match: sp|Q01105|SET_HUMAN (Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3)

HSP 1 Score: 196.823 bits (499), Expect = 1.029e-58
Identity = 99/192 (51.56%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   45 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 234          
BLAST of set nuclear proto-oncogene vs. UniProt/SwissProt
Match: sp|P0DME0|SETLP_HUMAN (Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.004e-53
Identity = 96/192 (50.00%), Postives = 124/192 (64.58%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQ SEEIL+VE+K+N+ RQP FQ+R+ LI  IPNF +    NHPQ+ +L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N   +K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        EL EVIKDD+WPNPLQYYL
Sbjct:   55 IEHIDEVQNEIDRLNEQDSEEILKVEQKYNKLRQPFFQKRSELIAKIPNFGVTTFVNHPQVSSLLGEEDEEALHYLTKVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTKIKWKSGKDVTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELEEVIKDDIWPNPLQYYL 244          
BLAST of set nuclear proto-oncogene vs. UniProt/SwissProt
Match: sp|P53997|SET_DROME (Protein SET OS=Drosophila melanogaster OX=7227 GN=Set PE=1 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 1.734e-46
Identity = 88/226 (38.94%), Postives = 133/226 (58.85%), Query Frame = 1
Query:   76 RESMASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIK-------TTCDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            R  +  AP    T +    ++++  +  +E+ID  Q++ID LNE+ASEEIL+VE+K+N+ R+P +++R+ L+K IPNFW+ +  NHPQ+  ++ E +EE L +L  L+VEEF+DIKSG++I   F  N YF N  +TK  H+  +          +T   + WK+GKN +K L                   +F  WF+ +      E+ E+IKDDLWPNPLQYYL
Sbjct:    7 RAKLDGAPADGNTSAAAGNNEEE--SEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYK---TFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYL 227          
BLAST of set nuclear proto-oncogene vs. TrEMBL
Match: A0A0F7GXS3 (Set nuclear proto-oncogene (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 4.975e-146
Identity = 221/221 (100.00%), Postives = 221/221 (100.00%), Query Frame = 1
Query:   67 HKERESMASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYY 729
            HKERESMASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKNFVKSLNESLNKAAAGSKGGSSSPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYY
Sbjct:    5 HKERESMASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKNFVKSLNESLNKAAAGSKGGSSSPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYY 225          
BLAST of set nuclear proto-oncogene vs. TrEMBL
Match: T1EM54 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20197654 PE=3 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 5.369e-65
Identity = 107/223 (47.98%), Postives = 144/223 (64.57%), Query Frame = 1
Query:   85 MASAPKIQKTESNGKVDQ-----DQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYLA 735
            MA+ PK+ K E   K D      D+     IEKIDEVQ++ID+LNEQAS+EIL+VE+K+N+ RQP FQ+R+ +I  IPNFW+ A  NHPQ+  L+ + DEE+   LT ++V+EFDDIKSG+KI   F  NE+F N TI+K  H+ E+   ++  T ++WK+GK+ VK                   P SF  WF+ +    + ELGEVIKDD+WPNPLQYYLA
Sbjct:    1 MAAQPKVAKVEGKNKKDASFETADKEQQEAIEKIDEVQNEIDRLNEQASDEILKVEQKYNKLRQPFFQKRSEMIAKIPNFWVTAFVNHPQVSALLNDEDEEVFHFLTKVEVQEFDDIKSGYKITFHFKENEFFKNQTISKEFHLNETGEPSSISTPINWKNGKDLVKKYAAKGGSGDRKRNHEDQQPESFFSWFSDNSDAGVDELGEVIKDDIWPNPLQYYLA 223          
BLAST of set nuclear proto-oncogene vs. TrEMBL
Match: Q3T9S3 (SET translocation OS=Mus musculus OX=10090 GN=Set PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 2.431e-60
Identity = 108/227 (47.58%), Postives = 145/227 (63.88%), Query Frame = 1
Query:   58 LLPHKERESMASAPKIQ-KTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            +LP  ++   A+APK++ K+ S G    ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    9 ILPQPKKPRPAAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 233          
BLAST of set nuclear proto-oncogene vs. TrEMBL
Match: A0A5F9CDW9 (Uncharacterized protein OS=Oryctolagus cuniculus OX=9986 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 3.541e-60
Identity = 108/227 (47.58%), Postives = 142/227 (62.56%), Query Frame = 1
Query:   58 LLPHKERESMASAPKIQKTE-SNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            LLPH ++   A  P+   T  S G +  ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   17 LLPHAKKPRAAPGPRPADTSASRGLLTGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 241          
BLAST of set nuclear proto-oncogene vs. TrEMBL
Match: G1ST68 (Uncharacterized protein OS=Oryctolagus cuniculus OX=9986 PE=3 SV=2)

HSP 1 Score: 206.838 bits (525), Expect = 4.523e-60
Identity = 108/227 (47.58%), Postives = 142/227 (62.56%), Query Frame = 1
Query:   58 LLPHKERESMASAPKIQKTE-SNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            LLPH ++   A  P+   T  S G +  ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   A  K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    9 LLPHAKKPRAAPGPRPADTSASRGLLTCEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 233          
BLAST of set nuclear proto-oncogene vs. Ensembl Cavefish
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 201.06 bits (510), Expect = 1.675e-61
Identity = 107/221 (48.42%), Postives = 138/221 (62.44%), Query Frame = 1
Query:   88 ASAPKIQKTESNGKVD-----QDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            ASA K+ + E N   D      ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K   ++ N   AG K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:    3 ASAAKVSRKEQNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRAGQTQN--KAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Cavefish
Match: seta (SET nuclear proto-oncogene a [Source:ZFIN;Acc:ZDB-GENE-030131-2221])

HSP 1 Score: 197.593 bits (501), Expect = 4.166e-60
Identity = 108/221 (48.87%), Postives = 140/221 (63.35%), Query Frame = 1
Query:   88 ASAPKIQKTESNGKVD-----QDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            ASA K+ K E N   D      ++     IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K IH+ ES   T   T + WK GK+     +++  ++ AG K     P SF  WFT    +   ELGEVIKDD+WPNPLQYYL
Sbjct:    3 ASAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENMYFENKVLSKEIHLNESGDPTPKSTEIKWKPGKDLTNRPSQT--QSKAGKKRQHEEPESFFTWFTDHSDSGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Cavefish
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 195.282 bits (495), Expect = 5.849e-59
Identity = 100/192 (52.08%), Postives = 127/192 (66.15%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  LT ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K   ++ N   AG K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   58 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRAGQTQN--KAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 247          
BLAST of set nuclear proto-oncogene vs. Ensembl Cavefish
Match: tspy (testis-specific Y-encoded-like protein 1 [Source:NCBI gene;Acc:103043256])

HSP 1 Score: 118.627 bits (296), Expect = 1.300e-28
Identity = 59/187 (31.55%), Postives = 98/187 (52.41%), Query Frame = 1
Query:  175 EVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTT-CDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            +VQ  +D L ++ +     +E K +++R+P   QR  + +TIP FW+ AL NHP L   I E+DE+ L  +T+L++E F + K G++I   F  N +F N  I K +H+G      +  + + W  G+N + +                    SF  WF+   +    E+ +++KDDL+ NPL+YYL
Sbjct:  297 QVQMRLDALEKKGARLHQRLELKLSRQRRPHLDQRGAITQTIPGFWVTALLNHPHLSAHIDENDEDALSYMTNLEIETFKNNKLGYRICFHFRRNPFFQNKVIVKELHLGMGGSPVSFSNPILWHRGQNLIGNGEPRRTAQGVYQ--------SFFHWFSDHSSPGRDEIAQILKDDLYRNPLRYYL 475          
BLAST of set nuclear proto-oncogene vs. Ensembl Cavefish
Match: tspy (testis-specific Y-encoded-like protein 1 [Source:NCBI gene;Acc:103043256])

HSP 1 Score: 117.857 bits (294), Expect = 2.850e-28
Identity = 59/187 (31.55%), Postives = 98/187 (52.41%), Query Frame = 1
Query:  175 EVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTT-CDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            +VQ  +D L ++ +     +E K +++R+P   QR  + +TIP FW+ AL NHP L   I E+DE+ L  +T+L++E F + K G++I   F  N +F N  I K +H+G      +  + + W  G+N + +                    SF  WF+   +    E+ +++KDDL+ NPL+YYL
Sbjct:  297 QVQMRLDALEKKGARLHQRLELKLSRQRRPHLDQRGAITQTIPGFWVTALLNHPHLSAHIDENDEDALSYMTNLEIETFKNNKLGYRICFHFRRNPFFQNKVIVKELHLGMGGSPVSFSNPILWHRGQNLIGNGEPRRTAQGVYQ--------SFFHWFSDHSSPGRDEIAQILKDDLYRNPLRYYL 475          
BLAST of set nuclear proto-oncogene vs. Ensembl Sea Lamprey
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 172.94 bits (437), Expect = 2.589e-52
Identity = 87/192 (45.31%), Postives = 118/192 (61.46%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            +E+ID  Q++ID LNEQASEEIL VE+K+N+ R+P  +QR+ LI+ IPNFW+ A  NHPQ+  LI E DEE    +T L+VEEF+DIKSG++I + F+ N YF N  +TK  H+G +    +  T + WK G    +    +  K             SF  WF      +  E+ EV+KDD+WPNPLQYYL
Sbjct:    6 LEEIDACQNEIDALNEQASEEILRVEQKYNRLRKPHLEQRSELIRKIPNFWLTAFLNHPQISPLIDETDEEAFHHMTKLEVEEFEDIKSGYRIKLHFAENPYFENDIVTKEFHLGSAGKPVSQSTPIRWKAGMELTRQHPPADTKGHKRGHS------SFFMWFGDHNDPTSDEVAEVLKDDMWPNPLQYYL 191          
BLAST of set nuclear proto-oncogene vs. Ensembl Sea Lamprey
Match: nap1l1 (nucleosome assembly protein 1-like 1 [Source:ZFIN;Acc:ZDB-GENE-030516-2])

HSP 1 Score: 52.7582 bits (125), Expect = 6.343e-8
Identity = 34/101 (33.66%), Postives = 49/101 (48.51%), Query Frame = 1
Query:  298 IPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDD--IKSGFKIIMTFSSNEYFTNTTITKSIHVGESE--------------IKTTCDTVDWKDG 552
            IP FW+    N   L  ++ EHDE +L+ L  + V +F +  I   F +   FS NEYFTN  +TK+ +V +SE              +  T   +DWK G
Sbjct:  132 IPEFWLTVFRNVDLLSDMVQEHDEPILRHLHDIKV-KFSEQGIPMSFTLDFCFSPNEYFTNAVLTKT-YVMKSEPDASDPFSFEGPEIVSCTGSQIDWKKG 230          
BLAST of set nuclear proto-oncogene vs. Ensembl Yeast
Match: NAP1 (Histone chaperone; involved in histone exchange by removing and replacing histone H2A-H2B dimers or histone variant dimers from assembled nucleosomes; involved in the transport of H2A and H2B histones to the nucleus; required for the regulation of microtubule dynamics during mitosis; interacts with mitotic cyclin Clb2p; controls bud morphogenesis; phosphorylated by CK2; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001756])

HSP 1 Score: 61.6178 bits (148), Expect = 6.860e-11
Identity = 45/178 (25.28%), Postives = 80/178 (44.94%), Query Frame = 1
Query:  178 VQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLI-------------------------------------------KTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTF--SSNEYFTNTTITKSIHVGESEIKTTCD---------TVDWKD 549
            +QS++ ++ ++   E+ E+E KF QK +P+++QR+ +I                                           K IP+FW+ AL N P +   IT+ D E+L+ L  + +E   D + GFK++  F  S+N +FTN  + K+ +  + E+  + D          + WKD
Sbjct:  102 LQSELFEVEKEFQVEMFELENKFLQKYKPIWEQRSRIISGQEQPKPEQIAKGQEIVESLNETELLVDEEEKAQNDSEEEQVKGIPSFWLTALENLPIVCDTITDRDAEVLEYLQDIGLEYLTDGRPGFKLLFRFDSSANPFFTNDILCKT-YFYQKELGYSGDFIYDHAEGCEISWKD 278          
BLAST of set nuclear proto-oncogene vs. Ensembl Nematostella
Match: EDO44259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW70])

HSP 1 Score: 184.882 bits (468), Expect = 6.210e-56
Identity = 100/213 (46.95%), Postives = 133/213 (62.44%), Query Frame = 1
Query:  103 IQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHV---GESEIKTTCDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            +   E N    QD     +I++ID+VQ+ ID LNE+ASEEIL VE+K+N KR+P F  R NLIK IPNFWI    NHPQ+  L+ E DEE+LQ +  ++VEEF+DIKSG+KI   F  N YFTN  I K   +   GE   ++T  T+ WK G +  +   E+     +  +     P SF  WFT D+ ++  ELGE+IKDD+WPNPLQYY+
Sbjct:   17 VDGAEGNMSAHQD-----IIDQIDQVQNQIDSLNEEASEEILRVEQKYNAKRRPHFTARTNLIKKIPNFWITVFLNHPQIQMLLNEDDEEVLQYMAYVEVEEFEDIKSGYKIKFGFEDNPYFTNQEICKEFILNDNGEQMSRST--TIKWKQGMDLTQRFKEN-----SKGRKRDHPPSSFFCWFT-DLMDNSDELGELIKDDIWPNPLQYYM 216          
BLAST of set nuclear proto-oncogene vs. Ensembl Nematostella
Match: EDO43162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZK7])

HSP 1 Score: 54.6842 bits (130), Expect = 3.566e-8
Identity = 35/118 (29.66%), Postives = 52/118 (44.07%), Query Frame = 1
Query:  292 KTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDV-----------EEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHV-------------GESEIKTTCDTVDWKDGKNFVKSL 573
            K IP FW+ A+ N   L  +I EHDE +L+ L  + V           +       GF +   F+ N +FTNT +TKS  +             G   + T+   +DWK GKN  + +
Sbjct:  173 KGIPEFWLTAMKNVELLSEMIQEHDEPILKHLHDVRVIFTGPESTNTTQYPQPTPMGFVLEFHFTPNPFFTNTVLTKSYKMKCEPDEDDPFSFEGPEIVSTSGCKIDWKKGKNITQKV 290          
BLAST of set nuclear proto-oncogene vs. Ensembl Medaka
Match: seta (protein SET [Source:NCBI gene;Acc:101158031])

HSP 1 Score: 194.897 bits (494), Expect = 2.926e-59
Identity = 99/192 (51.56%), Postives = 128/192 (66.67%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  L+ ++V EF+DIKSG++I   F  N YF N  ++K  H+ ES   ++  T + WK GK+  K  +++ N   AG K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   32 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLSRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQN--KAGRKRQHEEPESFFTWFTDHADAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of set nuclear proto-oncogene vs. Ensembl Medaka
Match: setb (protein SET [Source:NCBI gene;Acc:101171505])

HSP 1 Score: 191.815 bits (486), Expect = 4.372e-58
Identity = 99/192 (51.56%), Postives = 126/192 (65.62%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYL 732
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  L+ ++V EF+DIKSG++I   F  N YF N T++K  +V E     +  T + WK GK+  K   ++ N   AG K     P SF  WFT        ELGEVIKDD+WPNPLQYYL
Sbjct:   28 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEDDEEALHYLSKVEVTEFEDIKSGYRIDFCFDENPYFENKTLSKEFNVNEGGDPISKSTEIKWKTGKDLTKRSGQTSN--KAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 217          
BLAST of set nuclear proto-oncogene vs. Ensembl Medaka
Match: setb (protein SET [Source:NCBI gene;Acc:101171505])

HSP 1 Score: 189.889 bits (481), Expect = 4.461e-57
Identity = 99/193 (51.30%), Postives = 126/193 (65.28%), Query Frame = 1
Query:  160 IEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT-VDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYLA 735
            IE IDEVQ++ID+LNEQASEEIL+VE+K+N+ RQP FQ+R+ LI  IPNFW+    NHPQ+  L+ E DEE L  L+ ++V EF+DIKSG++I   F  N YF N T++K  +V E     +  T + WK GK+  K   ++ N   AG K     P SF  WFT        ELGEVIKDD+WPNPLQYYL 
Sbjct:   48 IEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEDDEEALHYLSKVEVTEFEDIKSGYRIDFCFDENPYFENKTLSKEFNVNEGGDPISKSTEIKWKTGKDLTKRSGQTSN--KAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLV 238          
BLAST of set nuclear proto-oncogene vs. Ensembl Medaka
Match: tspy (testis-specific Y-encoded-like protein 1 [Source:NCBI gene;Acc:101169699])

HSP 1 Score: 110.923 bits (276), Expect = 5.080e-26
Identity = 63/188 (33.51%), Postives = 101/188 (53.72%), Query Frame = 1
Query:  175 EVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTT-CDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMV-ELGEVIKDDLWPNPLQYYL 732
            +VQ  +D L +++      +E+K ++ R+P   QR+++ K+IP FW+ AL NHP L   I E DE+ L  +T L++E F + K G++I   F  N YF N  I K +H+G      +  + + W  G N        L   +   K       +F  WF SD +N  V ++ +++KDDL+ +PL+YYL
Sbjct:  272 QVQMRLDALEKKSGRLHQRLEQKISRLRRPQLDQRSSITKSIPGFWVTALLNHPHLSAHIDETDEDALSYMTDLEIESFKNNKMGYRIRFHFRRNPYFQNNIIMKELHIGMGGPPMSFSNPILWHRGHN--------LTAHSEPRKSSRGVYETFFSWF-SDHSNPGVDDVAQILKDDLYRDPLRYYL 450          
BLAST of set nuclear proto-oncogene vs. Ensembl Medaka
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:101170971])

HSP 1 Score: 55.0694 bits (131), Expect = 5.311e-8
Identity = 44/196 (22.45%), Postives = 74/196 (37.76%), Query Frame = 1
Query:  142 QVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLI-------------------------------------------KTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKS-GFKIIMTFSSNEYFTNTTITKSIHV-------------GESEIKTTCDTVDWKDGKN 558
            +V+   +  +  +Q     +  +  EE+ E+E+K+    QPLF +R++++                                           K IP FW+    N   L  ++ EHDE +L  L  + V+  D  +   F +   F  NE+FTNT + K+  +             G   +  T  T+DW  GKN
Sbjct:   31 KVVKRRVNALKNLQVKCAHIEAKFYEEVHELERKYAALYQPLFDKRSDIVRAAYEPTDEECEWKADEEEELTEEMKEKAKLEEEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMLQEHDEPILTHLQDIKVKFSDPGQPMSFTLEFYFEPNEFFTNTVLIKTYKMRSEPDESDPFSFDGPEIMSCTGCTIDWTKGKN 226          
BLAST of set nuclear proto-oncogene vs. Planmine SMEST
Match: SMESG000031906.1 (SMESG000031906.1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.936e-144
Identity = 215/215 (100.00%), Postives = 215/215 (100.00%), Query Frame = 1
Query:   85 MASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYY 729
            MASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKNFVKSLNESLNKAAAGSKGGSSSPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYY
Sbjct:    1 MASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKNFVKSLNESLNKAAAGSKGGSSSPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYY 215          
BLAST of set nuclear proto-oncogene vs. Planmine SMEST
Match: SMESG000027817.1 (SMESG000027817.1)

HSP 1 Score: 192.971 bits (489), Expect = 6.548e-59
Identity = 104/218 (47.71%), Postives = 146/218 (66.97%), Query Frame = 1
Query:   85 MASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKNF-VKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYLA 735
            MASA KI K ++ G  D D  +  +IEKIDEVQ+ +D LNE+ASEEIL+VE+K+N+ RQP +++R+NLIK IP+FW  A  NHPQ   +IT+ DE++L+ L +L V+E +DIKSG+KII TF+SN YF NT +TK  +V E+   +    ++W  GK+   KS N+   ++A   +       SF  +F  +    + + GEVIKDDLW NP+QYYLA
Sbjct:    1 MASAEKISKVDAQG--DNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQD------SFFNFFDDNTTGYVDDFGEVIKDDLWNNPMQYYLA 210          
BLAST of set nuclear proto-oncogene vs. Planmine SMEST
Match: SMESG000027807.1 (SMESG000027807.1)

HSP 1 Score: 192.971 bits (489), Expect = 6.548e-59
Identity = 104/218 (47.71%), Postives = 146/218 (66.97%), Query Frame = 1
Query:   85 MASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKNF-VKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYYLA 735
            MASA KI K ++ G  D D  +  +IEKIDEVQ+ +D LNE+ASEEIL+VE+K+N+ RQP +++R+NLIK IP+FW  A  NHPQ   +IT+ DE++L+ L +L V+E +DIKSG+KII TF+SN YF NT +TK  +V E+   +    ++W  GK+   KS N+   ++A   +       SF  +F  +    + + GEVIKDDLW NP+QYYLA
Sbjct:    1 MASAEKISKVDAQG--DNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQD------SFFNFFDDNTTGYVDDFGEVIKDDLWNNPMQYYLA 210          
BLAST of set nuclear proto-oncogene vs. Planmine SMEST
Match: SMESG000026284.1 (SMESG000026284.1)

HSP 1 Score: 186.808 bits (473), Expect = 1.357e-56
Identity = 99/222 (44.59%), Postives = 144/222 (64.86%), Query Frame = 1
Query:   85 MASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGE-SEIKTTCDTVDWKDGKNFVKSLNESLNXXXXXXXXXXXXPI--SFMQWF--TSDIANSMVELGEVIKDDLWPNPLQYYLA 735
            MAS PKIQK E NG  D +  +  +IE+I+EVQ+++D LNEQASEEIL+VE+K+N+ RQP F +R+ L   IPNFW  A+ NHPQL  + +E D + L  LT ++V+E+++IKSG+KI+ TF+ NEYF N  + K+ +  E  E++T    ++W  GK+ VK             +    +P+  SF  WF    D+ N   E+GE+IKDD+W NP+QY+L+
Sbjct:    1 MASNPKIQKIEMNGSADFN--MTEVIEQIEEVQNEVDLLNEQASEEILKVEQKYNKLRQPYFDKRSELFSKIPNFWSQAILNHPQLAVMFSEDDIDALSYLTKVEVKEYENIKSGYKIVFTFADNEYFKNKVLEKAFNTNENGEMETKSTKIEWHQGKSLVKG--------DCKGRKRQVAPMIDSFFSWFEGCCDMMND--EIGELIKDDIWNNPMQYFLS 210          
BLAST of set nuclear proto-oncogene vs. Planmine SMEST
Match: SMESG000022916.1 (SMESG000022916.1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.653e-10
Identity = 46/180 (25.56%), Postives = 80/180 (44.44%), Query Frame = 1
Query:  289 IKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHV-------------GESEIKTTCDTVDWKDGKNF----VKSLNESLNXXXXXXXXXXXXPISFMQWFTSDIA----------------NSMVELGEVIKDDLWPNPLQYY 729
            IK IP+FW     N P L   + E+D  +L+SL  +     +DI  GF+I   F++NEYFTNT ++++ +V             G   + +    ++WK  KN     +K + +S  K    S   +    SF  +F   ++                +S  E+G+ +++ + P  + YY
Sbjct:  147 IKGIPDFWYIIFKNVPLLSERVEEYDWPILKSLIDVSSVMINDINPGFRINFYFAANEYFTNTVLSRTFYVNFELPSENPLLFEGPEIVMSKGCKIEWKPNKNVTVKNIKQMKKSRVKGEKRSITKTCRTNSFFNFFEDVVSKNEGKLSEDPETLNQIDSDFEIGQYLRERIIPRAILYY 326          
The following BLAST results are available for this feature:
BLAST of set nuclear proto-oncogene vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SET2.255e-6047.96SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
SET1.945e-5951.56SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
SET2.143e-5951.56SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
SET2.563e-5951.56SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
SET5.998e-5951.56SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
spr-21.340e-4242.93Suppressor of presenilin-2 [Source:UniProtKB/Swis... [more]
spr-25.074e-4242.42Suppressor of presenilin-2 [Source:UniProtKB/Swis... [more]
nap-17.333e-934.00Nucleosome Assembly Protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Set1.730e-4738.94gene:FBgn0014879 transcript:FBtr0083062[more]
mil2.649e-724.03gene:FBgn0267366 transcript:FBtr0085246[more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setb4.399e-6148.42SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
seta4.855e-6149.32SET nuclear proto-oncogene a [Source:ZFIN;Acc:ZDB-... [more]
setb1.071e-6048.42SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
tspy4.838e-2629.63testis specific protein Y-linked [Source:ZFIN;Acc:... [more]
nap1l18.982e-721.89nucleosome assembly protein 1-like 1 [Source:ZFIN;... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bach11.627e-6047.96BTB and CNC homology 1, basic leucine zipper trans... [more]
bach11.824e-6047.96BTB and CNC homology 1, basic leucine zipper trans... [more]
bach17.209e-5951.56BTB and CNC homology 1, basic leucine zipper trans... [more]
os94.578e-3031.44osteosarcoma amplified 9, endoplasmic reticulum le... [more]
nap1l11.793e-722.34nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Set1.172e-6347.58SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:18... [more]
Set1.312e-5951.56SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:18... [more]
Set3.865e-5045.00SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:18... [more]
Set1.115e-4149.65SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:18... [more]
Tspyl11.721e-3034.20testis-specific protein, Y-encoded-like 1 [Source:... [more]
back to top
BLAST of set nuclear proto-oncogene vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9EQU5|SET_MOUSE8.201e-6347.58Protein SET OS=Mus musculus OX=10090 GN=Set PE=1 S... [more]
sp|Q63945|SET_RAT5.338e-6247.14Protein SET OS=Rattus norvegicus OX=10116 GN=Set P... [more]
sp|Q01105|SET_HUMAN1.029e-5851.56Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV... [more]
sp|P0DME0|SETLP_HUMAN1.004e-5350.00Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP P... [more]
sp|P53997|SET_DROME1.734e-4638.94Protein SET OS=Drosophila melanogaster OX=7227 GN=... [more]
back to top
BLAST of set nuclear proto-oncogene vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GXS34.975e-146100.00Set nuclear proto-oncogene (Fragment) OS=Schmidtea... [more]
T1EM545.369e-6547.98Uncharacterized protein OS=Helobdella robusta OX=6... [more]
Q3T9S32.431e-6047.58SET translocation OS=Mus musculus OX=10090 GN=Set ... [more]
A0A5F9CDW93.541e-6047.58Uncharacterized protein OS=Oryctolagus cuniculus O... [more]
G1ST684.523e-6047.58Uncharacterized protein OS=Oryctolagus cuniculus O... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setb1.675e-6148.42SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
seta4.166e-6048.87SET nuclear proto-oncogene a [Source:ZFIN;Acc:ZDB-... [more]
setb5.849e-5952.08SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
tspy1.300e-2831.55testis-specific Y-encoded-like protein 1 [Source:N... [more]
tspy2.850e-2831.55testis-specific Y-encoded-like protein 1 [Source:N... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
setb2.589e-5245.31SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
nap1l16.343e-833.66nucleosome assembly protein 1-like 1 [Source:ZFIN;... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NAP16.860e-1125.28Histone chaperone; involved in histone exchange by... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO442596.210e-5646.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431623.566e-829.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
seta2.926e-5951.56protein SET [Source:NCBI gene;Acc:101158031][more]
setb4.372e-5851.56protein SET [Source:NCBI gene;Acc:101171505][more]
setb4.461e-5751.30protein SET [Source:NCBI gene;Acc:101171505][more]
tspy5.080e-2633.51testis-specific Y-encoded-like protein 1 [Source:N... [more]
nap1l15.311e-822.45nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
back to top
BLAST of set nuclear proto-oncogene vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031906.11.936e-144100.00SMESG000031906.1[more]
SMESG000027817.16.548e-5947.71SMESG000027817.1[more]
SMESG000027807.16.548e-5947.71SMESG000027807.1[more]
SMESG000026284.11.357e-5644.59SMESG000026284.1[more]
SMESG000022916.11.653e-1025.56SMESG000022916.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30023430
GenBankAKG62127.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023430 ID=SMED30023430|Name=set nuclear proto-oncogene|organism=Schmidtea mediterranea sexual|type=transcript|length=1267bp
TAGAATAATTTCGATTTGTCTGTATAAATTTGTTTTGTTGCTTCAAATAA
TAACTATTTATTACCGCATAAAGAAAGAGAAAGCATGGCGTCTGCACCTA
AAATACAGAAAACTGAAAGCAATGGAAAAGTTGACCAAGATCAAGTTTTA
AATTCTTTAATTGAAAAAATTGATGAAGTTCAAAGTGATATTGACAAACT
GAACGAGCAAGCTAGTGAAGAAATTTTAGAAGTAGAAAAGAAATTCAATC
AAAAACGTCAACCATTATTTCAACAAAGAGCCAATTTAATCAAAACCATA
CCAAATTTTTGGATTAATGCTTTAAGCAATCATCCTCAATTGATGACACT
AATCACCGAGCATGATGAAGAACTATTACAATCATTAACAAGTTTAGATG
TTGAAGAATTCGACGATATCAAATCAGGATTCAAAATAATAATGACGTTT
TCTTCTAATGAATACTTCACAAATACAACTATTACAAAGTCAATCCACGT
TGGTGAATCTGAAATTAAGACAACTTGCGATACAGTTGATTGGAAAGATG
GCAAAAATTTTGTCAAGTCATTAAATGAATCTTTAAACAAAGCTGCTGCT
GGAAGTAAAGGTGGATCTAGTTCACCTATAAGTTTCATGCAATGGTTTAC
ATCTGACATTGCCAATTCAATGGTAGAATTAGGAGAAGTCATTAAAGATG
ATTTGTGGCCAAATCCCCTACAATATTATTTAGCTGTTGAAGATGATGAC
GATGATGATGTTGCGGAAGATGAGGATCTAGAAGAGGAACCTGAGGACGG
TTGTGATGACGATGAGTAACTGTAAACATTACTGCATTTTCCATTGTGAA
TGAATGTTGATTTCAAAGAAATCTGTATATTAATGTTTTTGTACGTTGAC
TTTAGTGAGAAAGTTTTATTAGTTTAAAAATAAATATGTCTGCAAATACT
GTAAATTTTTTATTTCAATTTGGTGTTTTGATAATATCAAATTTGAGATA
ATTTTCAGTATTCTCATTCTGTCGATTTCATTGCTTGTGCATCATCGCTG
GGATACATCCTAAAATGTAAATGAATTAAGCAATGAAATATTTATATGAA
TTTTGTATATAGAGTTTTTTAATATCTATTTTAATTGTAAGTTTTAGAAA
TTAATGATTGTAGCTTCATTAATGTGAATGTTTTCATTTTAAGTATAATT
TATCAATGACTTTGTTTTCTTCGTGTAACTTAATTTATATAAATTTTTAA
ACAAAGCAAATTGTAAT
back to top

protein sequence of SMED30023430-orf-1

>SMED30023430-orf-1 ID=SMED30023430-orf-1|Name=SMED30023430-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
MASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEV
EKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQS
LTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDT
VDWKDGKNFVKSLNESLNKAAAGSKGGSSSPISFMQWFTSDIANSMVELG
EVIKDDLWPNPLQYYLAVEDDDDDDVAEDEDLEEEPEDGCDDDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037231NAP-like_sf
IPR002164NAP_family
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006334nucleosome assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 22..56
NoneNo IPR availableGENE3DG3DSA:3.30.1120.90coord: 70..220
e-value: 6.8E-46
score: 157.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 218..244
NoneNo IPR availablePANTHERPTHR11875:SF49PROTEIN SETcoord: 17..241
IPR002164Nucleosome assembly protein (NAP)PFAMPF00956NAPcoord: 70..216
e-value: 2.7E-25
score: 89.1
IPR002164Nucleosome assembly protein (NAP)PANTHERPTHR11875TESTIS-SPECIFIC Y-ENCODED PROTEINcoord: 17..241
IPR037231NAP-like superfamilySUPERFAMILYSSF143113NAP-likecoord: 21..216