ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30023416
Length (bp)3152
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30023416) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30023416) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30023416) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30023416) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023416

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023416SMESG000033773.1 SmedASXL_016895SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30023416SMESG000033773.1 dd_Smed_v4_5594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023416SMESG000033773.1 dd_Smed_v4_5594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023416SMESG000033773.1 dd_Smed_v4_5594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023416SMESG000033773.1 dd_Smed_v4_5594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023416SMESG000033773.1 dd_Smed_v6_5594_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023416SMESG000033773.1 dd_Smed_v4_5594_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 53.5286 bits (127), Expect = 1.653e-6
Identity = 76/303 (25.08%), Postives = 134/303 (44.22%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+  +           A K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H         Q++ ++    +  +L+K  N LS L
Sbjct:   38 EKALDYIKNGVDINICNQNGLNAL---HLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCGAR-SGHEQVVEML-LDRAAPILSKTKNGLSPL 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 53.9138 bits (128), Expect = 2.092e-6
Identity = 77/307 (25.08%), Postives = 134/307 (43.65%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+       C      A     K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H         Q++ ++    +  +L+K  N LS L
Sbjct:   38 EKALDYIKNGVDINI-------CNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCGAR-SGHEQVVEML-LDRAAPILSKTKNGLSPL 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 53.9138 bits (128), Expect = 2.218e-6
Identity = 77/307 (25.08%), Postives = 134/307 (43.65%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+       C      A     K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H         Q++ ++    +  +L+K  N LS L
Sbjct:   49 EKALDYIKNGVDINI-------CNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCGAR-SGHEQVVEML-LDRAAPILSKTKNGLSPL 332          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 51.9878 bits (123), Expect = 8.014e-6
Identity = 77/307 (25.08%), Postives = 135/307 (43.97%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+       C      A     K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H   +     Q++ ++    +  +L+K  N LS L
Sbjct:   55 EKALDYIKNGVDINI-------CNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCG-ARSGHEQVVEML-LDRAAPILSKTKNGLSPL 338          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: F34D10.6 (pep chromosome:WBcel235:III:3747560:3752425:-1 gene:WBGene00009375.1 transcript:F34D10.6b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F34D10.6)

HSP 1 Score: 64.6994 bits (156), Expect = 2.987e-10
Identity = 40/161 (24.84%), Postives = 82/161 (50.93%), Query Frame = 2
Query: 2207 LLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNS 2689
            LL+ +++ + + ++  N   +EEL++ GY  +  + G  RN    +        + +  L+ + +YQ +++ +H AV   N +        KKL+   D+R  + LH A+++  +++   +   +PQ +N  D   RTP+HYA +LKD   +  ++  S +
Sbjct:  219 LLQDLEEDIYDWIHTGNIGKLEELVLTGYADL--LLG--RNHEVDD-------ADSIGFLEVLPQYQAKIQSIHKAVETGNLRAVKLLTDRKKLSLCRDTRGLSPLHKAIVFERTDIAKYLIRNYPQSVNAMDQKKRTPLHYAAALKDGGYLYKVMRKSGA 368          

HSP 2 Score: 53.9138 bits (128), Expect = 6.394e-7
Identity = 38/169 (22.49%), Postives = 73/169 (43.20%), Query Frame = 2
Query: 2183 KEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNS 2689
            K+V H  V    ++  +   + +     +E+L++ G       CG +        ++   + E    L  +  Y  ++  +H ++   N     + +  KKLA   D      LH AV++ H+E+V  I   +  ++N PD   RT +HYA + +D    L I+  + +
Sbjct:  404 KQVLHNRVAPSYLESSIQQWLRDGQLAKLEQLVLSG-------CGDLLQ------SRTSTHTETQAFLDRLPDYMDKIDGIHKSIKEGNLDKVKELMKTKKLAIARDRFGCTPLHSAVVHEHTEIVRYIAGHYNSVLNAPDYNKRTAMHYAAAARDGGHYLKILGKAGA 559          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: F34D10.6 (pep chromosome:WBcel235:III:3747560:3752633:-1 gene:WBGene00009375.1 transcript:F34D10.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F34D10.6)

HSP 1 Score: 64.6994 bits (156), Expect = 2.987e-10
Identity = 40/161 (24.84%), Postives = 82/161 (50.93%), Query Frame = 2
Query: 2207 LLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNS 2689
            LL+ +++ + + ++  N   +EEL++ GY  +  + G  RN    +        + +  L+ + +YQ +++ +H AV   N +        KKL+   D+R  + LH A+++  +++   +   +PQ +N  D   RTP+HYA +LKD   +  ++  S +
Sbjct:  219 LLQDLEEDIYDWIHTGNIGKLEELVLTGYADL--LLG--RNHEVDD-------ADSIGFLEVLPQYQAKIQSIHKAVETGNLRAVKLLTDRKKLSLCRDTRGLSPLHKAIVFERTDIAKYLIRNYPQSVNAMDQKKRTPLHYAAALKDGGYLYKVMRKSGA 368          

HSP 2 Score: 53.9138 bits (128), Expect = 6.394e-7
Identity = 38/169 (22.49%), Postives = 73/169 (43.20%), Query Frame = 2
Query: 2183 KEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNS 2689
            K+V H  V    ++  +   + +     +E+L++ G       CG +        ++   + E    L  +  Y  ++  +H ++   N     + +  KKLA   D      LH AV++ H+E+V  I   +  ++N PD   RT +HYA + +D    L I+  + +
Sbjct:  404 KQVLHNRVAPSYLESSIQQWLRDGQLAKLEQLVLSG-------CGDLLQ------SRTSTHTETQAFLDRLPDYMDKIDGIHKSIKEGNLDKVKELMKTKKLAIARDRFGCTPLHSAVVHEHTEIVRYIAGHYNSVLNAPDYNKRTAMHYAAAARDGGHYLKILGKAGA 559          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: F34D10.6 (pep chromosome:WBcel235:III:3747560:3759412:-1 gene:WBGene00009375.1 transcript:F34D10.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F34D10.6)

HSP 1 Score: 64.3142 bits (155), Expect = 5.047e-10
Identity = 40/161 (24.84%), Postives = 82/161 (50.93%), Query Frame = 2
Query: 2207 LLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNS 2689
            LL+ +++ + + ++  N   +EEL++ GY  +  + G  RN    +   + +       L+ + +YQ +++ +H AV   N +        KKL+   D+R  + LH A+++  +++   +   +PQ +N  D   RTP+HYA +LKD   +  ++  S +
Sbjct:  751 LLQDLEEDIYDWIHTGNIGKLEELVLTGYADL--LLG--RNHEVDDADSIGF-------LEVLPQYQAKIQSIHKAVETGNLRAVKLLTDRKKLSLCRDTRGLSPLHKAIVFERTDIAKYLIRNYPQSVNAMDQKKRTPLHYAAALKDGGYLYKVMRKSGA 900          

HSP 2 Score: 53.5286 bits (127), Expect = 1.002e-6
Identity = 38/169 (22.49%), Postives = 73/169 (43.20%), Query Frame = 2
Query: 2183 KEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNS 2689
            K+V H  V    ++  +   + +     +E+L++ G       CG +        ++   + E    L  +  Y  ++  +H ++   N     + +  KKLA   D      LH AV++ H+E+V  I   +  ++N PD   RT +HYA + +D    L I+  + +
Sbjct:  936 KQVLHNRVAPSYLESSIQQWLRDGQLAKLEQLVLSG-------CGDLLQ------SRTSTHTETQAFLDRLPDYMDKIDGIHKSIKEGNLDKVKELMKTKKLAIARDRFGCTPLHSAVVHEHTEIVRYIAGHYNSVLNAPDYNKRTAMHYAAAARDGGHYLKILGKAGA 1091          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42284 (gene:FBgn0259179 transcript:FBtr0343179)

HSP 1 Score: 63.5438 bits (153), Expect = 4.375e-10
Identity = 59/230 (25.65%), Postives = 103/230 (44.78%), Query Frame = 2
Query: 1961 AFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRN---RNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVS 2641
            A  +D + A+ +   QH  +  RDE G ++LH A  R    G    + +++ E G ++  RD    T RD        + +     ID +V+      + +  E+L +QGYDHI DI      +S  ++ Q +    L + L N++  +    +LH  +   N +   +  +     W + ++N   R  LH+AVL    E+V  +    P+ +   D   RT +HYA+ 
Sbjct:  139 AEDEDAEGALAV---QH--MEERDEHGQSMLHFACARSHRRGA---LYTLIEESGIDITYRDELYRTARDVSLQANQPNNAA---EIDRYVMAQAVIGDVEPFEQLALQGYDHILDIEDE-NGQSITDVVQSRQNAALGEFLANLKALEESREELHQMIRENNMERVVELTNVANAKWLIRTKNYYGRTALHIAVLKESEEMVQHMVKICPEGLKITDNLERTVLHYAMG 356          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42284 (gene:FBgn0259179 transcript:FBtr0343178)

HSP 1 Score: 63.1586 bits (152), Expect = 1.184e-9
Identity = 59/230 (25.65%), Postives = 103/230 (44.78%), Query Frame = 2
Query: 1961 AFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRN---RNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVS 2641
            A  +D + A+ +   QH  +  RDE G ++LH A  R    G    + +++ E G ++  RD    T RD        + +     ID +V+      + +  E+L +QGYDHI DI      +S  ++ Q +    L + L N++  +    +LH  +   N +   +  +     W + ++N   R  LH+AVL    E+V  +    P+ +   D   RT +HYA+ 
Sbjct:  391 AEDEDAEGALAV---QH--MEERDEHGQSMLHFACARSHRRGA---LYTLIEESGIDITYRDELYRTARDVSLQANQPNNAA---EIDRYVMAQAVIGDVEPFEQLALQGYDHILDIEDE-NGQSITDVVQSRQNAALGEFLANLKALEESREELHQMIRENNMERVVELTNVANAKWLIRTKNYYGRTALHIAVLKESEEMVQHMVKICPEGLKITDNLERTVLHYAMG 608          

HSP 2 Score: 51.6026 bits (122), Expect = 3.600e-6
Identity = 28/97 (28.87%), Postives = 48/97 (49.48%), Query Frame = 2
Query: 2369 ELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWG---VDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKD 2650
            E+   L NV  Y  ++ ++H A          + L  +K A     +       LH+AVL+ H+++V  +  +FP+ +   D   RTP+HYA ++KD
Sbjct:  116 EIQAFLNNVPSYMEKIHRVHDAARDGGLLALQQALDRRKFAIAKNDISPNGSTPLHVAVLFGHTDIVRYLASRFPETMTITDNDGRTPLHYAATIKD 212          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 53.5286 bits (127), Expect = 2.444e-6
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  ++++K GV++N+       C      A     K+   E ++ +I + AD+    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+       VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H   +     Q++ ++       +L+K  N LS L
Sbjct:   38 EKALDYLKNGVDINI-------CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIA-----SLAGQTEVVRVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNR---GAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKI----DAKTRDGLTPLHCG-ARSGHEQVVGML-LDRGAPILSKTKNGLSPL 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 53.5286 bits (127), Expect = 2.783e-6
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  ++++K GV++N+       C      A     K+   E ++ +I + AD+    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+       VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H   +     Q++ ++       +L+K  N LS L
Sbjct:   38 EKALDYLKNGVDINI-------CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIA-----SLAGQTEVVRVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNR---GAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKI----DAKTRDGLTPLHCG-ARSGHEQVVGML-LDRGAPILSKTKNGLSPL 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 53.1434 bits (126), Expect = 2.875e-6
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  ++++K GV++N+       C      A     K+   E ++ +I + AD+    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+       VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H   +     Q++ ++       +L+K  N LS L
Sbjct:   29 EKALDYLKNGVDINI-------CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIA-----SLAGQTEVVRVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNR---GAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKI----DAKTRDGLTPLHCG-ARSGHEQVVGML-LDRGAPILSKTKNGLSPL 312          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 53.1434 bits (126), Expect = 2.890e-6
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  ++++K GV++N+       C      A     K+   E ++ +I + AD+    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+       VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H   +     Q++ ++       +L+K  N LS L
Sbjct:   40 EKALDYLKNGVDINI-------CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIA-----SLAGQTEVVRVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNR---GAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKI----DAKTRDGLTPLHCG-ARSGHEQVVGML-LDRGAPILSKTKNGLSPL 323          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 53.1434 bits (126), Expect = 3.295e-6
Identity = 77/307 (25.08%), Postives = 133/307 (43.32%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  ++++K GV++N+       C      A     K+   E ++ +I + AD+    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+       VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H   +     Q++ ++       +L+K  N LS L
Sbjct:   29 EKALDYLKNGVDINI-------CNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIA-----SLAGQTEVVRVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNR---GAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKI----DAKTRDGLTPLHCG-ARSGHEQVVGML-LDRGAPILSKTKNGLSPL 312          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 54.6842 bits (130), Expect = 7.413e-7
Identity = 78/307 (25.41%), Postives = 134/307 (43.65%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+       C      A     K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H         Q++ ++    S  +L+K  N LS L
Sbjct:   38 EKALDYIKNGVDVNI-------CNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCGAR-SGHEQVVEML-LDRSAPILSKTKNGLSPL 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 54.6842 bits (130), Expect = 7.623e-7
Identity = 78/307 (25.41%), Postives = 134/307 (43.65%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+       C      A     K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H         Q++ ++    S  +L+K  N LS L
Sbjct:   49 EKALDYIKNGVDVNI-------CNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCGAR-SGHEQVVEML-LDRSAPILSKTKNGLSPL 332          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 54.6842 bits (130), Expect = 7.782e-7
Identity = 78/307 (25.41%), Postives = 135/307 (43.97%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+       C      A     K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H   +     Q++ ++    S  +L+K  N LS L
Sbjct:   38 EKALDYIKNGVDVNI-------CNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCG-ARSGHEQVVEML-LDRSAPILSKTKNGLSPL 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 54.6842 bits (130), Expect = 7.854e-7
Identity = 78/307 (25.41%), Postives = 135/307 (43.97%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+       C      A     K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H   +     Q++ ++    S  +L+K  N LS L
Sbjct:   38 EKALDYIKNGVDVNI-------CNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCG-ARSGHEQVVEML-LDRSAPILSKTKNGLSPL 321          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 54.6842 bits (130), Expect = 8.905e-7
Identity = 78/307 (25.41%), Postives = 135/307 (43.97%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+       C      A     K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H   +     Q++ ++    S  +L+K  N LS L
Sbjct:   38 EKALDYIKNGVDVNI-------CNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCG-ARSGHEQVVEML-LDRSAPILSKTKNGLSPL 321          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 6.244e-6
Identity = 78/307 (25.41%), Postives = 134/307 (43.65%), Query Frame = 2
Query: 1874 EITMEFIKFGVNLNVHYEEEAPCAPIAFWAF----KDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHV-LNMVYEENYDAIEELIIQGYDHI------TDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQ----LHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRN---ILHLAVLYRHSELVGLICDQFPQLINQPDCFLR---TPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSAL 2731
            E  +++IK GV++N+       C      A     K+   E ++ ++ + A++    + G+T LH A     S+  + E++ VL+  GANV A+  N  TP  Y  ++E  H  V+  ++D+    ++  E+ +  +   + QG+D +       D  G VR  +    A+    K    LLQN      E +     LH A    N  + T  L+    A  VD   RN    LH+A    ++ +V L+ D+  ++    D   R   TP+H         Q++ ++    S  +L+K  N LS L
Sbjct:   38 EKALDYIKNGVDVNI-------CNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIA-----SLAGQAEVVKVLVTNGANVNAQSQNGFTPL-YMAAQE-NHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNR---AAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI----DAKTRDGLTPLHCGAR-SGHEQVVEML-LDRSAPILSKTKNGLSPL 321          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267EKC0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009269g2 PE=4 SV=1)

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 405/871 (46.50%), Postives = 570/871 (65.44%), Query Frame = 2
Query:  230 LEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKEL--VPFTSPXXXXXXXXXXXXTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSP-SGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNVHYEEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEK 2833
            +E +ELY+LI   ++ ++  AL ++D +    +R++S    N+YLH V+L+L  L     GD+R AV L+Y+LA+ G DVN+QN  GNT LH ACFRP+G+ L  HL+RLG DP + N    RV  +     ++L++GQ  A CS+W AV +ED  L+ + +  W R   +R+RKTLMD+A++TGNYE V+ L +Y +TNE V A  A   ++V + + ++         +DKPN+ T D S  +PKPL+  +K L  +     +  +L  A  I    Y E L     +F++  F  LV++++A  L DAWQ +   +V +  T P +G + LHF+V+ Y   +EL  +RLL+R++YK  L G++V+ RN  GETVLL A+    DR  LDHLI LGVD S R  +G  I  NTYATRG+L+  +   R+ LPGL  AVED D+ RV+ WL  LCRVN  K+GRSL + A+D     +   LE   +  EF  AS+A D+ RMK+ +AMG G  KV+A Y +Y+AG TDDW+ EF+ RP++ASVMEY +A+I    ++FG  L+V YEE APC P+AFWAF+DDI   +T  IA H D+ +RDELG T+LH A+ +  +   K  ++  LL RGANVAARD+   TPRDYC    V  GS L ++IDD VLN+ Y  + DAIE+LII GY+HI DI GT RNK+A ELA L+YYKEL++LL    +Y  E+  +HTAVI  + + + K+ +EK++  GVD R RN+LH+AVL  + ++V  IC+QFPQ+I + D  LRTP+HYAV ++DQR  LS+ISTSNSV++  K++NNLS L+YI++L+RPTP KLKTRGRR ++Y V +L+  E+
Sbjct:    1 MEDTELYRLICNPSRANYARALSLLDELELTEVRRRSTDQQNSYLHLVVLNLKALAGRCGGDVRPAVPLLYKLALRGCDVNAQNRVGNTALHTACFRPLGDRLVQHLIRLGIDPGITNEMNSRVIHDNAQHKAWLVRGQKGAKCSLWSAVAREDKELMIRYLTSWVRTECRRRRKTLMDLAFETGNYEIVELLKKYTSTNELVCAALACDVKRVKQMLALK---------SDKPNLRTKDTSQKVPKPLLAEVKTLSGIAEADKVYQLLKAAGAIGEEEYFEQLESSKNAFRSAKFVALVEEMSADSLEDAWQQLHNHRVDLDCTDPETGGTYLHFLVQHYLATEELQLKRLLIRLMYKTALEGVDVHARNNKGETVLLAAYSQPPDRILLDHLICLGVDASVRSNSGHVIMQNTYATRGDLVRQRRHTRRLLPGLHVAVEDGDLERVRHWLGCLCRVNVSKNGRSLAELARDIGDEAIQQHLEDSLHGCEFAAASIAGDLDRMKHHIAMGAGEKKVNACYRYYFAGFTDDWRAEFVPRPLIASVMEYGSAKIASFLLQFGARLDVQYEECAPCGPVAFWAFRDDIASDVTEAIAAHVDVRLRDELGRTILHAAVMKDDNPAAKCRVVEQLLSRGANVAARDMRGWTPRDYCTKGGVVGGSRLGQIIDDFVLNLSYVGDIDAIEQLIIDGYNHINDIRGTSRNKTAKELATLRYYKELLELLDEEPKYHEEIELIHTAVINDDRKGFVKFANEKRVPLGVDRRGRNLLHMAVLMENHDMVAAICEQFPQMIYKGDNLLRTPVHYAVCIRDQRATLSVISTSNSVDMSAKDANNLSVLEYIDQLDRPTPTKLKTRGRRTHDYRVGDLLETER 862          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8JC91 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 795.038 bits (2052), Expect = 0.000e+0
Identity = 405/871 (46.50%), Postives = 570/871 (65.44%), Query Frame = 2
Query:  230 LEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKEL--VPFTSPXXXXXXXXXXXXTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSP-SGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNVHYEEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEK 2833
            +E +ELY+LI   ++ ++  AL ++D +    +R++S    N+YLH V+L+L  L     GD+R AV L+Y+LA+ G DVN+QN  GNT LH ACFRP+G+ L  HL+RLG DP + N    RV  +     ++L++GQ  A CS+W AV +ED  L+ + +  W R   +R+RKTLMD+A++TGNYE V+ L +Y +TNE V A  A   ++V + + ++         +DKPN+ T D S  +PKPL+  +K L  +     +  +L  A  I    Y E L     +F++  F  LV++++A  L DAWQ +   +V +  T P +G + LHF+V+ Y   +EL  +RLL+R++YK  L G++V+ RN  GETVLL A+    DR  LDHLI LGVD S R  +G  I  NTYATRG+L+  +   R+ LPGL  AVED D+ RV+ WL  LCRVN  K+GRSL + A+D     +   LE   +  EF  AS+A D+ RMK+ +AMG G  KV+A Y +Y+AG TDDW+ EF+ RP++ASVMEY +A+I    ++FG  L+V YEE APC P+AFWAF+DDI   +T  IA H D+ +RDELG T+LH A+ +  +   K  ++  LL RGANVAARD+   TPRDYC    V  GS L ++IDD VLN+ Y  + DAIE+LII GY+HI DI GT RNK+A ELA L+YYKEL++LL    +Y  E+  +HTAVI  + + + K+ +EK++  GVD R RN+LH+AVL  + ++V  IC+QFPQ+I + D  LRTP+HYAV ++DQR  LS+ISTSNSV++  K++NNLS L+YI++L+RPTP KLKTRGRR ++Y V +L+  E+
Sbjct:    1 MEDTELYRLICNPSRANYARALSLLDELELTEVRRRSTDQQNSYLHLVVLNLKALAGRCGGDVRPAVPLLYKLALRGCDVNAQNRVGNTALHTACFRPLGDRLVQHLIRLGIDPGITNEMNSRVIHDNAQHKAWLVRGQKGAKCSLWSAVAREDKELMIRYLTSWVRTECRRRRKTLMDLAFETGNYEIVELLKKYTSTNELVCAALACDVKRVKQMLALK---------SDKPNLRTKDTSQKVPKPLLAEVKTLSGIAEADKVYQLLKAAGAIGEEEYFEQLESSKNAFRSAKFVALVEEMSADSLEDAWQQLHNHRVDLDCTDPETGGTYLHFLVQHYLATEELQLKRLLIRLMYKTALEGVDVHARNNKGETVLLAAYSQPPDRILLDHLICLGVDASVRSNSGHVIMQNTYATRGDLVRQRRHTRRLLPGLHVAVEDGDLERVRHWLGCLCRVNVSKNGRSLAELARDIGDEAIQQHLEDSLHGCEFAAASIAGDLDRMKHHIAMGAGEKKVNACYRYYFAGFTDDWRAEFVPRPLIASVMEYGSAKIASFLLQFGARLDVQYEECAPCGPVAFWAFRDDIASDVTEAIAAHVDVRLRDELGRTILHAAVMKDDNPAAKCRVVEQLLSRGANVAARDMRGWTPRDYCTKGGVVGGSRLGQIIDDFVLNLSYVGDIDAIEQLIIDGYNHINDIRGTSRNKTAKELATLRYYKELLELLDEEPKYHEEIELIHTAVINDDRKGFVKFANEKRVPLGVDRRGRNLLHMAVLMENHDMVAAICEQFPQMIYKGDNLLRTPVHYAVCIRDQRATLSVISTSNSVDMSAKDANNLSVLEYIDQLDRPTPTKLKTRGRRTHDYRVGDLLETER 862          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8GGY6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 405/871 (46.50%), Postives = 570/871 (65.44%), Query Frame = 2
Query:  230 LEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKEL--VPFTSPXXXXXXXXXXXXTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSP-SGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNVHYEEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEK 2833
            +E +ELY+LI   ++ ++  AL ++D +    +R++S    N+YLH V+L+L  L     GD+R AV L+Y+LA+ G DVN+QN  GNT LH ACFRP+G+ L  HL+RLG DP + N    RV  +     ++L++GQ  A CS+W AV +ED  L+ + +  W R   +R+RKTLMD+A++TGNYE V+ L +Y +TNE V A  A   ++V + + ++         +DKPN+ T D S  +PKPL+  +K L  +     +  +L  A  I    Y E L     +F++  F  LV++++A  L DAWQ +   +V +  T P +G + LHF+V+ Y   +EL  +RLL+R++YK  L G++V+ RN  GETVLL A+    DR  LDHLI LGVD S R  +G  I  NTYATRG+L+  +   R+ LPGL  AVED D+ RV+ WL  LCRVN  K+GRSL + A+D     +   LE   +  EF  AS+A D+ RMK+ +AMG G  KV+A Y +Y+AG TDDW+ EF+ RP++ASVMEY +A+I    ++FG  L+V YEE APC P+AFWAF+DDI   +T  IA H D+ +RDELG T+LH A+ +  +   K  ++  LL RGANVAARD+   TPRDYC    V  GS L ++IDD VLN+ Y  + DAIE+LII GY+HI DI GT RNK+A ELA L+YYKEL++LL    +Y  E+  +HTAVI  + + + K+ +EK++  GVD R RN+LH+AVL  + ++V  IC+QFPQ+I + D  LRTP+HYAV ++DQR  LS+ISTSNSV++  K++NNLS L+YI++L+RPTP KLKTRGRR ++Y V +L+  E+
Sbjct:    1 MEDTELYRLICNPSRANYARALSLLDELELTEVRRRSTDQQNSYLHLVVLNLKALAGRCGGDVRPAVPLLYKLALRGCDVNAQNRVGNTALHTACFRPLGDRLVQHLIRLGIDPGITNEMNSRVIHDNAQHKAWLVRGQKGAKCSLWSAVAREDKELMIRYLTSWVRTECRRRRKTLMDLAFETGNYEIVELLKKYTSTNELVCAALACDVKRVKQMLALK---------SDKPNLRTKDTSQKVPKPLLAEVKTLSGIAEADKVYQLLKAAGAIGEEEYFEQLESSKNAFRSAKFVALVEEMSADSLEDAWQQLHNHRVDLDCTDPETGGTYLHFLVQHYLATEELQLKRLLIRLMYKTALEGVDVHARNNKGETVLLAAYSQPPDRILLDHLICLGVDASVRSNSGHVIMQNTYATRGDLVRQRRHTRRLLPGLHVAVEDGDLERVRHWLGCLCRVNVSKNGRSLAELARDIGDEAIQQHLEDSLHGCEFAAASIAGDLDRMKHHIAMGAGEKKVNACYRYYFAGFTDDWRAEFVPRPLIASVMEYGSAKIASFLLQFGARLDVQYEECAPCGPVAFWAFRDDIASDVTEAIAAHVDVRLRDELGRTILHAAVMKDDNPAAKCRVVEQLLSRGANVAARDMRGWTPRDYCTKGGVVGGSRLGQIIDDFVLNLSYVGDIDAIEQLIIDGYNHINDIRGTSRNKTAKELATLRYYKELLELLDEEPKYHEEIELIHTAVINDDRKGFVKFANEKRVPLGVDRRGRNLLHMAVLMENHDMVAAICEQFPQMIYKGDNLLRTPVHYAVCIRDQRATLSVISTSNSVDMSAKDANNLSVLEYIDQLDRPTPTKLKTRGRRTHDYRVGDLLETER 862          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267EZP1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009269g1 PE=4 SV=1)

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 404/871 (46.38%), Postives = 570/871 (65.44%), Query Frame = 2
Query:  230 LEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKEL--VPFTSPXXXXXXXXXXXXTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSP-SGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNVHYEEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEK 2833
            +E +ELY+LI   ++ ++  AL ++D +    +R++S    N+YLH V+L+L  L     GD+R AV L+Y+LA+ G DVN+QN  GNT LH ACFRP+G+ L  HL+RLG DP + N    RV  +     ++L++GQ  A CS+W AV +ED  L+ + +  W R   +R+RKTLMD+A++TGNYE V+ L +Y +TNE V A  A   ++V + + ++         +DKPN+ T D S  +PKPL+  +K L  +     +  +L  A  I    Y E L     +F++  F  LV++++A  L DAWQ +   +V +  T P +G + L+F+V+ Y   +EL  +RLL+R++YK  L G++V+ RN  GETVLL A+    DR  LDHLI LGVD S R  +G  I  NTYATRG+L+  +   R+ LPGL  AVED D+ RV+ WL  LCRVN  K+GRSL + A+D     +   LE   +  EF  AS+A D+ RMK+ +AMG G  KV+A Y +Y+AG TDDW+ EF+ RP++ASVMEY +A+I    ++FG  L+V YEE APC P+AFWAF+DDI   +T  IA H D+ +RDELG T+LH A+ +  +   K  ++  LL RGANVAARD+   TPRDYC    V  GS L ++IDD VLN+ Y  + DAIE+LII GY+HI DI GT RNK+A ELA L+YYKEL++LL    +Y  E+  +HTAVI  + + + K+ +EK++  GVD R RN+LH+AVL  + ++V  IC+QFPQ+I + D  LRTP+HYAV ++DQR  LS+ISTSNSV++  K++NNLS L+YI++L+RPTP KLKTRGRR ++Y V +L+  E+
Sbjct:    1 MEDTELYRLICNPSRANYARALSLLDELELTEVRRRSTDQQNSYLHLVVLNLKALAGRCGGDVRPAVPLLYKLALRGCDVNAQNRVGNTALHTACFRPLGDRLVQHLIRLGIDPGITNEMNSRVIHDNAQHKAWLVRGQKGAKCSLWSAVAREDKELMIRYLTSWVRTECRRRRKTLMDLAFETGNYEIVELLKKYTSTNELVCAALACDVKRVKQMLALK---------SDKPNLRTKDTSQKVPKPLLAEVKTLSGIAEADKVYQLLKAAGAIGEEEYFEQLESSKNAFRSAKFVALVEEMSADSLEDAWQQLHNHRVDLDCTDPETGGTYLYFLVQHYLATEELQLKRLLIRLMYKTALEGVDVHARNNKGETVLLAAYSQPPDRILLDHLICLGVDASVRSNSGHVIMQNTYATRGDLVRQRRHTRRLLPGLHVAVEDGDLERVRHWLGCLCRVNVSKNGRSLAELARDIGDEAIQQHLEDSLHGCEFAAASIAGDLDRMKHHIAMGAGEKKVNACYRYYFAGFTDDWRAEFVPRPLIASVMEYGSAKIASFLLQFGARLDVQYEECAPCGPVAFWAFRDDIASDVTEAIAAHVDVRLRDELGRTILHAAVMKDDNPAAKCRVVEQLLSRGANVAARDMRGWTPRDYCTKGGVVGGSRLGQIIDDFVLNLSYVGDIDAIEQLIIDGYNHINDIRGTSRNKTAKELATLRYYKELLELLDEEPKYHEEIELIHTAVINDDRKGFVKFANEKRVPLGVDRRGRNLLHMAVLMENHDMVAAICEQFPQMIYKGDNLLRTPVHYAVCIRDQRATLSVISTSNSVDMSAKDANNLSVLEYIDQLDRPTPTKLKTRGRRTHDYRVGDLLETER 862          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8GI02 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 398/871 (45.69%), Postives = 562/871 (64.52%), Query Frame = 2
Query:  230 LEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKEL--VPFTSPXXXXXXXXXXXXTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSP-SGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNVHYEEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEK 2833
            +E +ELY+LI   ++ ++  AL ++D +    +R++S    N+YLH V+L+L  L     GD+R AV L+Y+LA+ G DVN+QN  GNT LH ACFRP+G+ L  HL+RLG DP + N    RV  +     ++L++GQ  A CS+W AV +ED  L+ + +  W R   +R+RKTLMD+A++TGNYE V+ L +Y +TNE V A  A   ++V + + ++         +DKPN+ T D S  +PKPL+  +K L  +     +  +L  A  I    Y E L     +F++  F  LV++++A  L DAWQ +   +V +  T P +G + LHF+V+ Y   +EL  +RLL+R++YK  L G++V+ RN  GETVLL A+    DR  LDHLI LGVD S R  +G  I  NTYATRG+L+  +   R+ LPGL  AVED D+ RV+ WL  LCRVN  K+GRSL + A+D     +   LE   +  EF  AS+A D+ RMK+ +AMG G  KV+A Y +Y+AG TDDW+ EF+ RP++ASVMEY +A+I    ++FG  L+V YEE APC P+AFWAF+DDI   +T  IA H D+ +RDELG T+LH A+ +  +   K  ++  LL RGANVAARD+   TPRDYC    V  GS L ++IDD VLN+ Y  + DAIE+LII GY+HI DI GT RNK+A ELA L+YYKEL++LL    +Y  E+  +HTAVI  + + + K+ +EK++  GVD R RN+LH+AVL  + ++          +I + D  LRTP+HYAV ++DQR  LS+ISTSNSV++  K++NNLS L+YI++L+RPTP KLKTRGRR ++Y V +L+  E+
Sbjct:    1 MEDTELYRLICNPSRANYARALSLLDELELTEVRRRSTDQQNSYLHLVVLNLKALAGRCGGDVRPAVPLLYKLALRGCDVNAQNRVGNTALHTACFRPLGDRLVQHLIRLGIDPGITNEMNSRVIHDNAQHKAWLVRGQKGAKCSLWSAVAREDKELMIRYLTSWVRTECRRRRKTLMDLAFETGNYEIVELLKKYTSTNELVCAALACDVKRVKQMLALK---------SDKPNLRTKDTSQKVPKPLLAEVKTLSGIAEADKVYQLLKAAGAIGEEEYFEQLESSKNAFRSAKFVALVEEMSADSLEDAWQQLHNHRVDLDCTDPETGGTYLHFLVQHYLATEELQLKRLLIRLMYKTALEGVDVHARNNKGETVLLAAYSQPPDRILLDHLICLGVDASVRSNSGHVIMQNTYATRGDLVRQRRHTRRLLPGLHVAVEDGDLERVRHWLGCLCRVNVSKNGRSLAELARDIGDEAIQQHLEDSLHGCEFAAASIAGDLDRMKHHIAMGAGEKKVNACYRYYFAGFTDDWRAEFVPRPLIASVMEYGSAKIASFLLQFGARLDVQYEECAPCGPVAFWAFRDDIASDVTEAIAAHVDVRLRDELGRTILHAAVMKDDNPAAKCRVVEQLLSRGANVAARDMRGWTPRDYCTKGGVVGGSRLGQIIDDFVLNLSYVGDIDAIEQLIIDGYNHINDIRGTSRNKTAKELATLRYYKELLELLDEEPKYHEEIELIHTAVINDDRKGFVKFANEKRVPLGVDRRGRNLLHMAVLMENHDM----------MIYKGDNLLRTPVHYAVCIRDQRATLSVISTSNSVDMSAKDANNLSVLEYIDQLDRPTPTKLKTRGRRTHDYRVGDLLETER 852          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000033773.1 (SMESG000033773.1)

HSP 1 Score: 1853.57 bits (4800), Expect = 0.000e+0
Identity = 925/939 (98.51%), Postives = 930/939 (99.04%), Query Frame = 2
Query:  137 MASVKISTMPXXXXXXXXXXXXXXXIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKELVPFTSPXXXXXXXXXXXXTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNV---HY--EEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIERPKTTA 2938
            MASVKISTMPNESNSLRKSRRKSKNIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDF+LIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKELVPFTSPIIDILLKADLIKTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFV+ASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGV+L     HY   EEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILS+LLERGANVAARDIN+LTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIER KTTA
Sbjct:    1 MASVKISTMPNESNSLRKSRRKSKNIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFQLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKELVPFTSPIIDILLKADLIKTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVVASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVSLCALMRHYIISEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSILLERGANVAARDINKLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIERSKTTA 939          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000033773.1 (SMESG000033773.1)

HSP 1 Score: 1836.23 bits (4755), Expect = 0.000e+0
Identity = 917/931 (98.50%), Postives = 922/931 (99.03%), Query Frame = 2
Query:  161 MPXXXXXXXXXXXXXXXIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKELVPFTSPXXXXXXXXXXXXTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNV---HY--EEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIERPKTTA 2938
            MPNESNSLRKSRRKSKNIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDF+LIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKELVPFTSPIIDILLKADLIKTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFV+ASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGV+L     HY   EEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILS+LLERGANVAARDIN+LTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIER KTTA
Sbjct:    1 MPNESNSLRKSRRKSKNIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFQLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKELVPFTSPIIDILLKADLIKTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVVASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVSLCALMRHYIISEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSILLERGANVAARDINKLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIERSKTTA 931          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000033773.1 (SMESG000033773.1)

HSP 1 Score: 1827.37 bits (4732), Expect = 0.000e+0
Identity = 916/939 (97.55%), Postives = 921/939 (98.08%), Query Frame = 2
Query:  137 MASVKISTMPXXXXXXXXXXXXXXXIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKELVPFTSPXXXXXXXXXXXXTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNV---HY--EEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIERPKTTA 2938
            MASVKISTMPNESNSLRKSRRKSKNIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDF+LIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFD         KPNISTADCSSHIPKPLVNALKELVPFTSPIIDILLKADLIKTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFV+ASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGV+L     HY   EEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILS+LLERGANVAARDIN+LTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIER KTTA
Sbjct:    1 MASVKISTMPNESNSLRKSRRKSKNIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFQLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFD---------KPNISTADCSSHIPKPLVNALKELVPFTSPIIDILLKADLIKTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVVASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVSLCALMRHYIISEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSILLERGANVAARDINKLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIERSKTTA 930          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000033773.1 (SMESG000033773.1)

HSP 1 Score: 1810.42 bits (4688), Expect = 0.000e+0
Identity = 908/931 (97.53%), Postives = 913/931 (98.07%), Query Frame = 2
Query:  161 MPXXXXXXXXXXXXXXXIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKELVPFTSPXXXXXXXXXXXXTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNV---HY--EEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIERPKTTA 2938
            MPNESNSLRKSRRKSKNIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDF+LIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFD         KPNISTADCSSHIPKPLVNALKELVPFTSPIIDILLKADLIKTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFV+ASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGV+L     HY   EEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILS+LLERGANVAARDIN+LTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIER KTTA
Sbjct:    1 MPNESNSLRKSRRKSKNIEILAELEKSELYKLINGATQDSWMSALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVLVYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENMAGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFQLIEKLMNCWFRVNTKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVKMRFD---------KPNISTADCSSHIPKPLVNALKELVPFTSPIIDILLKADLIKTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVPISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNRNGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGELMLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAKDNEFTDVADLLEKYHYLTEFVVASLAADVKRMKYCLAMGQGSSKVDAIYHHYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVSLCALMRHYIISEEAPCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIGKKKEILSILLERGANVAARDINKLTPRDYCESKEVEHGSVLLKMIDDHVLNMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSNSVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKESAESEMILLQSDSRIQSRSDTFVTDFIERSKTTA 922          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000078142.1 (SMESG000078142.1)

HSP 1 Score: 50.447 bits (119), Expect = 6.696e-6
Identity = 48/196 (24.49%), Postives = 87/196 (44.39%), Query Frame = 2
Query: 2111 LLERGANVAARDINRLTPRDYCESKEVEHGSVLLKM-IDDHVLNMVYEENYDAIEELIIQGY----DHITDICGTVRNKSAIELAQLKYYKELVDLLQNVERYQYEVRQLHTAVIMKNTQIYTKY---LSEKKLAWGVDSRNRNILHLAVLYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSII 2674
            +++RG N A RD N  T  +   S     G + +K  +D  +LNM+ E N  A++ L   GY      I ++CG      + E+A   +Y  L D   N+             +   N+   T +   ++ + LA+  + +  ++++ A+   ++ L   I D FP  +   DCF R   HY  +  + +Q + I+
Sbjct:  423 IIKRGLNFALRDSNENTLLELALSM----GFIRIKDDLDSVILNMINEGNLQALKNLFSCGYFENFPDIYELCGPDLFDVSQEVAD--FYTSLSDEQTNL-----------VTIFSDNSSADTNWCNIITSEMLAYAYNKKGMSVINWAIASNNNNLFHYIVDYFPDSLKLKDCFNRNVYHYCYAFSN-KQFMEIV 600          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ANK31.653e-625.08ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK32.092e-625.08ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK32.218e-625.08ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK38.014e-625.08ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F34D10.62.987e-1024.84pep chromosome:WBcel235:III:3747560:3752425:-1 gen... [more]
F34D10.62.987e-1024.84pep chromosome:WBcel235:III:3747560:3752633:-1 gen... [more]
F34D10.65.047e-1024.84pep chromosome:WBcel235:III:3747560:3759412:-1 gen... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG422844.375e-1025.65gene:FBgn0259179 transcript:FBtr0343179[more]
CG422841.184e-925.65gene:FBgn0259179 transcript:FBtr0343178[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm42.444e-625.08tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.783e-625.08tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.875e-625.08tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.890e-625.08tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm43.295e-625.08tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank37.413e-725.41ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank37.623e-725.41ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank37.782e-725.41ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank37.854e-725.41ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank38.905e-725.41ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|G5E8K5|ANK3_MOUSE6.244e-625.41Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EKC00.000e+046.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JC910.000e+046.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GGY60.000e+046.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EZP10.000e+046.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GI020.000e+045.69Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033773.10.000e+098.51SMESG000033773.1[more]
SMESG000033773.10.000e+098.50SMESG000033773.1[more]
SMESG000033773.10.000e+097.55SMESG000033773.1[more]
SMESG000033773.10.000e+097.53SMESG000033773.1[more]
SMESG000078142.16.696e-624.49SMESG000078142.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023416 ID=SMED30023416|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3152bp
ACACGCACACATTACTTACTGGCACACACACACATCAGAGTATGTGTGTC
AACTGTATACTGAATATATCTACGAGTAGTCATGACTACATCTTATATAT
GATTCTTACGTGGATTTTTCAAATACAAATTTCTAAATGGCCTCTGTTAA
AATTTCTACGATGCCAAACGAATCAAATTCCCTTCGAAAGTCACGCCGTA
AATCCAAAAACATTGAAATTCTCGCAGAACTTGAAAAATCAGAATTGTAC
AAATTAATCAACGGAGCTACACAGGATTCCTGGATGTCGGCATTAGATGT
AATTGATTCAATGACTGGGGCAAATTTGAGACAAAAAAGTATTTTGACTG
GAAATACATATCTTCATGAAGTCATTCTTTCATTGTCTCGTCTGCATCGC
AATAACAATGGTGACATTCGAATTGCTGTCGTTCTTGTATATCGGCTTGC
TATCTCCGGAGTTGATGTCAATTCTCAAAACGAATTTGGCAATACTTGCT
TACATTTGGCTTGTTTTCGACCTATTGGTGAATGTCTGACGACACATTTA
CTCAGATTAGGAACTGACCCTTGCTTAGAAAACATGGCTGGCTATCGGGT
GTTTGTCAATTTAGACTCATTTTCTTCCTATCTGATAAAAGGCCAGCCTA
ATGCATATTGCAGTATTTGGCAAGCAGTTCAAAAAGAGGATTTTCGGTTG
ATTGAAAAATTAATGAATTGCTGGTTTCGGGTCAACACGAAACGTAAACG
AAAGACGTTGATGGACGTGGCGTATGATACTGGGAATTATGAAACCGTTA
AAAGGCTGATTCGTTATCAAAATACAAACGAATTTGTTACTGCCTGTTTT
GCAGGCCACCAAGAAAAAGTCTTGGAATTTGTAAAAATGCGCTTCGACGA
TGGAAACGTGGATGGACTGACAGATAAGCCGAATATTTCCACGGCAGATT
GCTCGTCCCATATTCCAAAACCCCTCGTAAACGCATTGAAAGAATTGGTT
CCATTTACAAGTCCAATAATTGATATATTATTGAAAGCCGATTTAATAAA
AACCACAAATTATGAAGAATTATTGAATGATCACACTGAATCTTTCAAGA
ATTGTACATTCTACCAGTTGGTCGATCAACTTAATGCACAATGTCTCCTT
GATGCATGGCAACTGATAGATGAAGAAAAGGTTCCAATTAGTGCTACCTC
ACCTTCAGGCGACAGTCTGCTGCATTTTGTTGTTCGCAAATATTGTCAAT
GTGACGAATTAGTCAGTCGGCGGTTACTCGTCAGAATCATATACAAATTA
GTTCTCGCTGGAATGAATGTGAATCACAGAAATAGGAACGGAGAAACGGT
TTTATTAACGGCATTTAAGATGCAGGCTGACAGGAGATTTCTCGATCATT
TGATAATTCTAGGAGTCGATACTTCGTACCGATGTCGCAACGGAACGTCC
ATATCTATTAACACCTATGCAACGAGGGGAGAGTTAATGCTGACGCAATA
TTGTCAAAGGAAGTTTTTACCAGGACTATGGCCAGCAGTTGAGGATAATG
ATGTAACCCGTGTAAAGTTTTGGTTGTCTTCACTCTGTAGAGTAAACAGT
CATAAATCTGGAAGGTCTTTATTGCAATATGCCAAGGATAATGAGTTTAC
AGACGTAGCGGATTTACTAGAGAAATACCATTATTTGACAGAATTCGTTT
TAGCCTCACTAGCTGCTGATGTCAAAAGAATGAAATATTGTTTAGCAATG
GGACAAGGAAGTAGTAAGGTTGACGCAATATATCATCATTATTATGCGGG
ACTTACTGACGATTGGAAAGTAGAATTTATTGCCCGGCCTATACTAGCAA
GTGTCATGGAATATTCAACGGCAGAAATTACAATGGAATTTATCAAATTC
GGTGTCAATCTTAATGTTCACTATGAGGAAGAAGCCCCTTGTGCTCCAAT
AGCTTTCTGGGCATTCAAAGATGATATCGATGAAGCTATTACTATTGTAA
TAGCACAACATGCCGACCTGAGCATGCGTGATGAACTTGGGTCAACTTTG
CTCCACAAAGCAATAACCAGAAAGGGAAGCATTGGCAAGAAGAAAGAAAT
TCTTTCTGTTTTGTTAGAACGAGGTGCTAATGTAGCCGCTAGAGATATAA
ATAGACTTACACCAAGAGATTACTGTGAAAGCAAGGAGGTTGAACATGGA
AGTGTATTATTGAAAATGATAGACGATCACGTGCTTAATATGGTTTACGA
AGAAAACTACGATGCTATCGAAGAGCTTATTATTCAAGGCTACGATCATA
TTACTGATATTTGTGGAACGGTACGCAATAAATCAGCCATTGAACTGGCA
CAATTGAAGTATTACAAAGAACTGGTTGATTTACTACAAAACGTCGAAAG
ATATCAGTACGAAGTCCGTCAGTTGCACACAGCTGTCATTATGAAGAACA
CTCAGATCTATACGAAATATCTGTCAGAAAAGAAATTAGCCTGGGGAGTC
GATAGTCGAAACAGAAATATTCTTCATTTGGCGGTGCTTTACCGTCATTC
GGAACTTGTGGGGCTAATCTGTGATCAGTTTCCACAACTCATCAATCAGC
CGGATTGCTTTCTGAGAACTCCGATTCATTATGCAGTCAGTTTAAAAGAT
CAACGGCAAATTCTCTCCATTATTTCAACAAGTAATTCCGTGAATTTGTT
GACCAAAGAATCCAATAACTTATCAGCTCTGGATTACATTGAAGAACTGG
AAAGACCAACTCCGATGAAACTGAAAACTCGAGGACGTCGGGTTTATAAT
TATGATGTCAGGAATCTCGTTGCGATAGAAAAAGAGAGCGCAGAATCAGA
AATGATATTGTTGCAATCGGATTCCCGTATCCAATCACGGAGCGACACGT
TTGTCACTGATTTCATTGAGCGGCCTAAAACTACAGCGTGATATCATGTG
ACCAAATCAGACATCAGTAAAACAACAACAAACATTTCTATCAACAATAA
CTTTACACTTATTTTTATTTTCCATTCGCCATTGCAACATTAACAAAACA
ACAATTAATTTGTTTATATTTCCCACCAGTATTTGTCAAAAATTATATTT
TCGAAATTTTTTTAATTGTTGTTGAATAAAATTTGTTTGATTTAAAAAAA
AA
back to top

protein sequence of SMED30023416-orf-1

>SMED30023416-orf-1 ID=SMED30023416-orf-1|Name=SMED30023416-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=935bp
MASVKISTMPNESNSLRKSRRKSKNIEILAELEKSELYKLINGATQDSWM
SALDVIDSMTGANLRQKSILTGNTYLHEVILSLSRLHRNNNGDIRIAVVL
VYRLAISGVDVNSQNEFGNTCLHLACFRPIGECLTTHLLRLGTDPCLENM
AGYRVFVNLDSFSSYLIKGQPNAYCSIWQAVQKEDFRLIEKLMNCWFRVN
TKRKRKTLMDVAYDTGNYETVKRLIRYQNTNEFVTACFAGHQEKVLEFVK
MRFDDGNVDGLTDKPNISTADCSSHIPKPLVNALKELVPFTSPIIDILLK
ADLIKTTNYEELLNDHTESFKNCTFYQLVDQLNAQCLLDAWQLIDEEKVP
ISATSPSGDSLLHFVVRKYCQCDELVSRRLLVRIIYKLVLAGMNVNHRNR
NGETVLLTAFKMQADRRFLDHLIILGVDTSYRCRNGTSISINTYATRGEL
MLTQYCQRKFLPGLWPAVEDNDVTRVKFWLSSLCRVNSHKSGRSLLQYAK
DNEFTDVADLLEKYHYLTEFVLASLAADVKRMKYCLAMGQGSSKVDAIYH
HYYAGLTDDWKVEFIARPILASVMEYSTAEITMEFIKFGVNLNVHYEEEA
PCAPIAFWAFKDDIDEAITIVIAQHADLSMRDELGSTLLHKAITRKGSIG
KKKEILSVLLERGANVAARDINRLTPRDYCESKEVEHGSVLLKMIDDHVL
NMVYEENYDAIEELIIQGYDHITDICGTVRNKSAIELAQLKYYKELVDLL
QNVERYQYEVRQLHTAVIMKNTQIYTKYLSEKKLAWGVDSRNRNILHLAV
LYRHSELVGLICDQFPQLINQPDCFLRTPIHYAVSLKDQRQILSIISTSN
SVNLLTKESNNLSALDYIEELERPTPMKLKTRGRRVYNYDVRNLVAIEKE
SAESEMILLQSDSRIQSRSDTFVTDFIERPKTTA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005764lysosome
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0009986cell surface
GO:0014704intercalated disc
GO:0014731spectrin-associated cytoskeleton
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0016328lateral plasma membrane
GO:0016529sarcoplasmic reticulum
GO:0030018Z disc
GO:0030054cell junction
GO:0030315T-tubule
GO:0030424axon
GO:0030425dendrite
GO:0031594neuromuscular junction
GO:0033268node of Ranvier
GO:0033270paranode region of axon
GO:0042383sarcolemma
GO:0042995cell projection
GO:0043034costamere
GO:0043194axon initial segment
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005200structural constituent of cytoskeleton
GO:0008092cytoskeletal protein binding
GO:0030507spectrin binding
GO:0030674protein binding, bridging
GO:0044325ion channel binding
GO:0045296cadherin binding
Vocabulary: biological process
TermDefinition
GO:0000281mitotic cytokinesis
GO:0007009plasma membrane organization
GO:0007010cytoskeleton organization
GO:0007165signal transduction
GO:0007409axonogenesis
GO:0007411axon guidance
GO:0007528neuromuscular junction development
GO:0010628positive regulation of gene expression
GO:0010650positive regulation of cell communication by electrical coupling
GO:0010765positive regulation of sodium ion transport
GO:0010960magnesium ion homeostasis
GO:0019228neuronal action potential
GO:0034112positive regulation of homotypic cell-cell adhesion
GO:0043001Golgi to plasma membrane protein transport
GO:0043266regulation of potassium ion transport
GO:0045184establishment of protein localization
GO:0045760positive regulation of action potential
GO:0045838positive regulation of membrane potential
GO:0050808synapse organization
GO:0071286cellular response to magnesium ion
GO:0071709membrane assembly
GO:0072659protein localization to plasma membrane
GO:0072660maintenance of protein location in plasma membrane
GO:0072661protein targeting to plasma membrane
GO:0090314positive regulation of protein targeting to membrane
GO:0099612protein localization to axon
GO:1900827positive regulation of membrane depolarization during cardiac muscle cell action potential
GO:1902260negative regulation of delayed rectifier potassium channel activity
GO:2000651positive regulation of sodium ion transmembrane transporter activity
GO:2001259positive regulation of cation channel activity