40S ribosomal protein S25

Overview
Name40S ribosomal protein S25
Smed IDSMED30023413
Length (bp)528
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 40S ribosomal protein S25 (SMED30023413) t-SNE clustered cells

Violin plots show distribution of expression levels for 40S ribosomal protein S25 (SMED30023413) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 40S ribosomal protein S25 (SMED30023413) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 40S ribosomal protein S25 (SMED30023413) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023413

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023413SMESG000059049.1 SmedASXL_003709SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30023413SMESG000059049.1 dd_Smed_v4_134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023413SMESG000059049.1 dd_Smed_v4_134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023413SMESG000059049.1 dd_Smed_v4_134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023413SMESG000059049.1 dd_Smed_v4_134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023413SMESG000059049.1 SMESG000031022.1 OX_Smed_1.0.16478ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30023413SMESG000059049.1 dd_Smed_v6_134_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30023413SMESG000059049.1 dd_Smed_v6_134_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 40S ribosomal protein S25 vs. Ensembl Human
Match: RPS25 (ribosomal protein S25 [Source:HGNC Symbol;Acc:HGNC:10413])

HSP 1 Score: 75.485 bits (184), Expect = 1.775e-17
Identity = 46/75 (61.33%), Postives = 57/75 (76.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKL KEVP+YK+ TP++VSERLKIR SLAR AL+ELL + +I     H  Q I++R+ K
Sbjct:   40 VRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTK 114          
BLAST of 40S ribosomal protein S25 vs. Ensembl Human
Match: RPS25 (ribosomal protein S25 [Source:HGNC Symbol;Acc:HGNC:10413])

HSP 1 Score: 75.485 bits (184), Expect = 1.775e-17
Identity = 46/75 (61.33%), Postives = 57/75 (76.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKL KEVP+YK+ TP++VSERLKIR SLAR AL+ELL + +I     H  Q I++R+ K
Sbjct:   40 VRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTK 114          
BLAST of 40S ribosomal protein S25 vs. Ensembl Celegans
Match: rps-25 (40S ribosomal protein S25 [Source:UniProtKB/Swiss-Prot;Acc:P52821])

HSP 1 Score: 80.1073 bits (196), Expect = 9.639e-20
Identity = 44/76 (57.89%), Postives = 57/76 (75.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNKE 478
            VRDKLNN  LFDQ TYDKLYKEV +YK+ TPS+VSERLK+R SLA+  LKEL  + ++     H+ Q +++R+ KE
Sbjct:   36 VRDKLNNMVLFDQATYDKLYKEVITYKLITPSVVSERLKVRASLAKAGLKELQAKGLVKCVVHHHGQVVYTRATKE 111          
BLAST of 40S ribosomal protein S25 vs. Ensembl Celegans
Match: rps-25 (40S ribosomal protein S25 [Source:UniProtKB/Swiss-Prot;Acc:P52821])

HSP 1 Score: 80.1073 bits (196), Expect = 9.639e-20
Identity = 44/76 (57.89%), Postives = 57/76 (75.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNKE 478
            VRDKLNN  LFDQ TYDKLYKEV +YK+ TPS+VSERLK+R SLA+  LKEL  + ++     H+ Q +++R+ KE
Sbjct:   36 VRDKLNNMVLFDQATYDKLYKEVITYKLITPSVVSERLKVRASLAKAGLKELQAKGLVKCVVHHHGQVVYTRATKE 111          
BLAST of 40S ribosomal protein S25 vs. Ensembl Fly
Match: RpS25 (gene:FBgn0086472 transcript:FBtr0082370)

HSP 1 Score: 83.9593 bits (206), Expect = 3.845e-21
Identity = 48/75 (64.00%), Postives = 60/75 (80.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TY+KLYKEVP+YK+ TPS+VSERLKIR SLA+RAL EL E+ +I Q   H+ Q I++R+ K
Sbjct:   39 VRDKLNNQVLFDKATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATK 113          
BLAST of 40S ribosomal protein S25 vs. Ensembl Fly
Match: RpS25 (gene:FBgn0086472 transcript:FBtr0082369)

HSP 1 Score: 83.9593 bits (206), Expect = 3.845e-21
Identity = 48/75 (64.00%), Postives = 60/75 (80.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TY+KLYKEVP+YK+ TPS+VSERLKIR SLA+RAL EL E+ +I Q   H+ Q I++R+ K
Sbjct:   39 VRDKLNNQVLFDKATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATK 113          
BLAST of 40S ribosomal protein S25 vs. Ensembl Zebrafish
Match: rps25 (ribosomal protein S25 [Source:NCBI gene;Acc:393788])

HSP 1 Score: 79.7221 bits (195), Expect = 2.413e-19
Identity = 47/75 (62.67%), Postives = 58/75 (77.33%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKLYKEVP+YK+ TP++VSERLKIR SLAR AL+ELL + +I     H  Q I++R+ K
Sbjct:   39 VRDKLNNLVLFDKATYDKLYKEVPNYKLITPAVVSERLKIRGSLARAALQELLGKGLIKLVSKHRAQVIYTRNTK 113          
BLAST of 40S ribosomal protein S25 vs. Ensembl Zebrafish
Match: rps25 (ribosomal protein S25 [Source:NCBI gene;Acc:393788])

HSP 1 Score: 79.7221 bits (195), Expect = 2.864e-19
Identity = 47/75 (62.67%), Postives = 58/75 (77.33%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKLYKEVP+YK+ TP++VSERLKIR SLAR AL+ELL + +I     H  Q I++R+ K
Sbjct:   47 VRDKLNNLVLFDKATYDKLYKEVPNYKLITPAVVSERLKIRGSLARAALQELLGKGLIKLVSKHRAQVIYTRNTK 121          
BLAST of 40S ribosomal protein S25 vs. Ensembl Xenopus
Match: gbx2.1 (gastrulation brain homeobox 2, gene 1 [Source:Xenbase;Acc:XB-GENE-855771])

HSP 1 Score: 75.0998 bits (183), Expect = 2.289e-17
Identity = 46/75 (61.33%), Postives = 57/75 (76.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKL KEVP+YK+ TP++VSERLKIR SLAR AL+ELL + +I     H  Q I++R+ K
Sbjct:   40 VRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLNKGLIKLVSKHRAQVIYTRNTK 114          
BLAST of 40S ribosomal protein S25 vs. Ensembl Xenopus
Match: ENSXETT00000023821.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV463941.1:64:733:1 gene:ENSXETG00000015842.1 transcript:ENSXETT00000023821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 4.018e-15
Identity = 32/43 (74.42%), Postives = 37/43 (86.05%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVS 379
            VRDKLNN  LFD+ TYDKL KEVP+YK+ TP++VSERLKIR S
Sbjct:    8 VRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGS 50          
BLAST of 40S ribosomal protein S25 vs. Ensembl Mouse
Match: Rps25 (ribosomal protein S25 [Source:MGI Symbol;Acc:MGI:1922867])

HSP 1 Score: 76.2554 bits (186), Expect = 2.773e-18
Identity = 46/75 (61.33%), Postives = 57/75 (76.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKL KEVP+YK+ TP++VSERLKIR SLAR AL+ELL + +I     H  Q I++R+ K
Sbjct:    8 VRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTK 82          
BLAST of 40S ribosomal protein S25 vs. Ensembl Mouse
Match: Rps25 (ribosomal protein S25 [Source:MGI Symbol;Acc:MGI:1922867])

HSP 1 Score: 75.485 bits (184), Expect = 1.218e-17
Identity = 46/75 (61.33%), Postives = 57/75 (76.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKL KEVP+YK+ TP++VSERLKIR SLAR AL+ELL + +I     H  Q I++R+ K
Sbjct:   40 VRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTK 114          
BLAST of 40S ribosomal protein S25 vs. Ensembl Mouse
Match: Rps25 (ribosomal protein S25 [Source:MGI Symbol;Acc:MGI:1922867])

HSP 1 Score: 75.485 bits (184), Expect = 1.218e-17
Identity = 46/75 (61.33%), Postives = 57/75 (76.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKL KEVP+YK+ TP++VSERLKIR SLAR AL+ELL + +I     H  Q I++R+ K
Sbjct:   40 VRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTK 114          
BLAST of 40S ribosomal protein S25 vs. UniProt/SwissProt
Match: sp|Q8ISN9|RS25_BRABE (40S ribosomal protein S25 OS=Branchiostoma belcheri OX=7741 GN=RPS25 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 7.997e-21
Identity = 50/76 (65.79%), Postives = 59/76 (77.63%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNKE 478
            VRDKLNN  LFD+ TYDKLYKEVPSYK+ TPS+VSERLKIR SLAR ALKEL  + MI     H+ Q I++R+ K+
Sbjct:   36 VRDKLNNLVLFDKATYDKLYKEVPSYKLITPSVVSERLKIRGSLARAALKELHSKGMIKLVSKHSAQVIYTRATKD 111          
BLAST of 40S ribosomal protein S25 vs. UniProt/SwissProt
Match: sp|P48588|RS25_DROME (40S ribosomal protein S25 OS=Drosophila melanogaster OX=7227 GN=RpS25 PE=1 SV=3)

HSP 1 Score: 83.9593 bits (206), Expect = 3.854e-20
Identity = 48/75 (64.00%), Postives = 60/75 (80.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TY+KLYKEVP+YK+ TPS+VSERLKIR SLA+RAL EL E+ +I Q   H+ Q I++R+ K
Sbjct:   39 VRDKLNNQVLFDKATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATK 113          
BLAST of 40S ribosomal protein S25 vs. UniProt/SwissProt
Match: sp|Q90YP9|RS25_ICTPU (40S ribosomal protein S25 OS=Ictalurus punctatus OX=7998 GN=rps25 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.186e-18
Identity = 48/75 (64.00%), Postives = 57/75 (76.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKLYKEVP+YK+ TP++VSERLKIR SLAR AL ELL + MI     H  Q I++R+ K
Sbjct:   39 VRDKLNNLVLFDKATYDKLYKEVPNYKLITPAVVSERLKIRGSLARAALLELLSKGMIKLVSKHRAQVIYTRNTK 113          
BLAST of 40S ribosomal protein S25 vs. UniProt/SwissProt
Match: sp|P52821|RS25_CAEEL (40S ribosomal protein S25 OS=Caenorhabditis elegans OX=6239 GN=rps-25 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.226e-18
Identity = 44/76 (57.89%), Postives = 57/76 (75.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNKE 478
            VRDKLNN  LFDQ TYDKLYKEV +YK+ TPS+VSERLK+R SLA+  LKEL  + ++     H+ Q +++R+ KE
Sbjct:   36 VRDKLNNMVLFDQATYDKLYKEVITYKLITPSVVSERLKVRASLAKAGLKELQAKGLVKCVVHHHGQVVYTRATKE 111          
BLAST of 40S ribosomal protein S25 vs. UniProt/SwissProt
Match: sp|Q962Q5|RS25_SPOFR (40S ribosomal protein S25 OS=Spodoptera frugiperda OX=7108 GN=RpS25 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.363e-18
Identity = 47/75 (62.67%), Postives = 59/75 (78.67%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TY+KLYKEVP YK+ TP++VSERLK+R SLARRAL EL E+ +I Q   H+ Q I++R+ K
Sbjct:   39 VRDKLNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQVIYTRATK 113          
BLAST of 40S ribosomal protein S25 vs. TrEMBL
Match: A0A267H5I5 (40S ribosomal protein S25 OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020333g2 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.241e-19
Identity = 49/75 (65.33%), Postives = 59/75 (78.67%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN CLFDQ TYDKLYKEVP+YK+ TPS+VSERLKIRVSLAR AL EL  + +I     H+ Q I++++ K
Sbjct:   50 VRDKLNNMCLFDQATYDKLYKEVPAYKLITPSVVSERLKIRVSLARAALLELERKGLIKPVSKHHAQFIYTKTTK 124          
BLAST of 40S ribosomal protein S25 vs. TrEMBL
Match: A0A267DC07 (40S ribosomal protein S25 OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003872g1 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.751e-19
Identity = 48/75 (64.00%), Postives = 59/75 (78.67%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN CLFDQ TYDKLYKEVP+YK+ TPS+VSERLKIRVSLAR +L EL  + +I     H+ Q I++++ K
Sbjct:   38 VRDKLNNMCLFDQATYDKLYKEVPAYKLITPSVVSERLKIRVSLARASLLELERKGLIKPVSKHHAQFIYTKTTK 112          
BLAST of 40S ribosomal protein S25 vs. TrEMBL
Match: A0A267ENS9 (40S ribosomal protein S25 (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000783g1 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.449e-19
Identity = 49/75 (65.33%), Postives = 59/75 (78.67%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN CLFDQ TYDKLYKEVP+YK+ TPS+VSERLKIRVSLAR AL EL  + +I     H+ Q I++++ K
Sbjct:   36 VRDKLNNMCLFDQATYDKLYKEVPAYKLITPSVVSERLKIRVSLARAALLELDRKGLIKPVSRHHSQFIYTKTTK 110          
BLAST of 40S ribosomal protein S25 vs. TrEMBL
Match: A0A267E3T5 (40S ribosomal protein S25 OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000783g3 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.991e-19
Identity = 49/75 (65.33%), Postives = 59/75 (78.67%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN CLFDQ TYDKLYKEVP+YK+ TPS+VSERLKIRVSLAR AL EL  + +I     H+ Q I++++ K
Sbjct:   39 VRDKLNNMCLFDQATYDKLYKEVPAYKLITPSVVSERLKIRVSLARAALLELDRKGLIKPVSRHHSQFIYTKTTK 113          
BLAST of 40S ribosomal protein S25 vs. TrEMBL
Match: Q4KTB7 (40S ribosomal protein S25 OS=Suberites domuncula OX=55567 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.846e-19
Identity = 45/75 (60.00%), Postives = 59/75 (78.67%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKLYKEVP+YK+ TPS+VSERLK+RVSLA +AL E+  + MI +   H+ Q +++R+ K
Sbjct:   40 VRDKLNNLALFDKATYDKLYKEVPNYKLITPSVVSERLKVRVSLANKALAEMAGKGMIREVFTHHAQRVYTRAPK 114          
BLAST of 40S ribosomal protein S25 vs. Ensembl Cavefish
Match: rps25 (ribosomal protein S25 [Source:NCBI gene;Acc:103037813])

HSP 1 Score: 79.7221 bits (195), Expect = 2.401e-19
Identity = 47/75 (62.67%), Postives = 57/75 (76.00%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKLYKEVP+YK+ TP++VSERLKIR SLAR AL ELL + +I     H  Q I++R+ K
Sbjct:   39 VRDKLNNLILFDKATYDKLYKEVPNYKLITPAVVSERLKIRGSLARAALHELLGKGLIKLVSKHRAQLIYTRNTK 113          
BLAST of 40S ribosomal protein S25 vs. Ensembl Cavefish
Match: rps25 (ribosomal protein S25 [Source:NCBI gene;Acc:103037813])

HSP 1 Score: 77.7962 bits (190), Expect = 1.532e-18
Identity = 46/72 (63.89%), Postives = 55/72 (76.39%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSR 466
            VRDKLNN  LFD+ TYDKLYKEVP+YK+ TP++VSERLKIR SLAR AL ELL + +I     H  Q I++R
Sbjct:   39 VRDKLNNLILFDKATYDKLYKEVPNYKLITPAVVSERLKIRGSLARAALHELLGKGLIKLVSKHRAQLIYTR 110          
BLAST of 40S ribosomal protein S25 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002646.1 (pep scaffold:Pmarinus_7.0:GL477054:677931:683216:1 gene:ENSPMAG00000002400.1 transcript:ENSPMAT00000002646.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.052e-16
Identity = 43/71 (60.56%), Postives = 54/71 (76.06%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFS 463
            VRDKLNN  LFD+ TYDKL KEVP+YK+ TP++VSERLK+R SLAR AL+ELL + +I     H  Q I++
Sbjct:   40 VRDKLNNLVLFDKATYDKLLKEVPNYKLITPAVVSERLKVRGSLARAALQELLAKGLIKLVAKHRSQLIYT 110          
BLAST of 40S ribosomal protein S25 vs. Ensembl Yeast
Match: RPS25A (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S25, no bacterial homolog; RPS25A has a paralog, RPS25B, that arose from the whole genome duplication [Source:SGD;Acc:S000003259])

HSP 1 Score: 46.595 bits (109), Expect = 8.332e-8
Identity = 28/72 (38.89%), Postives = 46/72 (63.89%), Query Frame = 2
Query:  257 DKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSN 472
            D+  +A + DQ  YD++ KEVP+Y+  + S++ +RLKI  SLAR AL+ L +  +I     H+ Q I++R+ 
Sbjct:   34 DRAQHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRAT 105          
BLAST of 40S ribosomal protein S25 vs. Ensembl Yeast
Match: RPS25B (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S25, no bacterial homolog; RPS25B has a paralog, RPS25A, that arose from the whole genome duplication [Source:SGD;Acc:S000004325])

HSP 1 Score: 46.595 bits (109), Expect = 8.681e-8
Identity = 28/71 (39.44%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  257 DKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRS 469
            D+  +A + DQ  YD++ KEVP+Y+  + S++ +RLKI  SLAR AL+ L +  +I     H+ Q I++R+
Sbjct:   34 DRAQHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRA 104          
BLAST of 40S ribosomal protein S25 vs. Ensembl Nematostella
Match: EDO35640 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKY1])

HSP 1 Score: 83.9593 bits (206), Expect = 1.506e-21
Identity = 48/75 (64.00%), Postives = 59/75 (78.67%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKLYKEVPSY++ TPS+VSERLKIR SLARRAL EL  + +I +   H+ Q I++R+ K
Sbjct:   38 VRDKLNNLVLFDKATYDKLYKEVPSYRLITPSVVSERLKIRGSLARRALLELQSKGLIKEVSKHHSQLIYTRATK 112          
BLAST of 40S ribosomal protein S25 vs. Ensembl Medaka
Match: rps25 (ribosomal protein S25 [Source:NCBI gene;Acc:101157312])

HSP 1 Score: 80.8777 bits (198), Expect = 7.042e-20
Identity = 48/75 (64.00%), Postives = 58/75 (77.33%), Query Frame = 2
Query:  251 VRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNK 475
            VRDKLNN  LFD+ TYDKLYKEVP+YK+ TP++VSERLKIR SLAR AL+ELL + MI     H  Q I++R+ K
Sbjct:   38 VRDKLNNLVLFDKATYDKLYKEVPNYKLITPAVVSERLKIRGSLARNALQELLSKGMIKLVSKHRAQLIYTRNTK 112          
BLAST of 40S ribosomal protein S25 vs. Planmine SMEST
Match: SMESG000059049.1 (SMESG000059049.1)

HSP 1 Score: 132.494 bits (332), Expect = 2.813e-40
Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 2
Query:  131 MPPKNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSXXXXXXXXXXXXDMILQTCGHNMQEIFSRSNKE 478
            MPPKNAKPGKGDKGKTPTKTKPTSSGSGGKQKKKKWSKGKVRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSLARRALKELLERDMILQTCGHNMQEIFSRSNKE
Sbjct:    1 MPPKNAKPGKGDKGKTPTKTKPTSSGSGGKQKKKKWSKGKVRDKLNNACLFDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSLARRALKELLERDMILQTCGHNMQEIFSRSNKE 116          
The following BLAST results are available for this feature:
BLAST of 40S ribosomal protein S25 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RPS251.775e-1761.33ribosomal protein S25 [Source:HGNC Symbol;Acc:HGNC... [more]
RPS251.775e-1761.33ribosomal protein S25 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps-259.639e-2057.8940S ribosomal protein S25 [Source:UniProtKB/Swiss... [more]
rps-259.639e-2057.8940S ribosomal protein S25 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RpS253.845e-2164.00gene:FBgn0086472 transcript:FBtr0082370[more]
RpS253.845e-2164.00gene:FBgn0086472 transcript:FBtr0082369[more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps252.413e-1962.67ribosomal protein S25 [Source:NCBI gene;Acc:393788... [more]
rps252.864e-1962.67ribosomal protein S25 [Source:NCBI gene;Acc:393788... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gbx2.12.289e-1761.33gastrulation brain homeobox 2, gene 1 [Source:Xenb... [more]
ENSXETT00000023821.14.018e-1574.42pep primary_assembly:Xenopus_tropicalis_v9.1:KV463... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rps252.773e-1861.33ribosomal protein S25 [Source:MGI Symbol;Acc:MGI:1... [more]
Rps251.218e-1761.33ribosomal protein S25 [Source:MGI Symbol;Acc:MGI:1... [more]
Rps251.218e-1761.33ribosomal protein S25 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8ISN9|RS25_BRABE7.997e-2165.7940S ribosomal protein S25 OS=Branchiostoma belcher... [more]
sp|P48588|RS25_DROME3.854e-2064.0040S ribosomal protein S25 OS=Drosophila melanogast... [more]
sp|Q90YP9|RS25_ICTPU1.186e-1864.0040S ribosomal protein S25 OS=Ictalurus punctatus O... [more]
sp|P52821|RS25_CAEEL1.226e-1857.8940S ribosomal protein S25 OS=Caenorhabditis elegan... [more]
sp|Q962Q5|RS25_SPOFR1.363e-1862.6740S ribosomal protein S25 OS=Spodoptera frugiperda... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H5I52.241e-1965.3340S ribosomal protein S25 OS=Macrostomum lignano O... [more]
A0A267DC072.751e-1964.0040S ribosomal protein S25 OS=Macrostomum lignano O... [more]
A0A267ENS93.449e-1965.3340S ribosomal protein S25 (Fragment) OS=Macrostomu... [more]
A0A267E3T53.991e-1965.3340S ribosomal protein S25 OS=Macrostomum lignano O... [more]
Q4KTB74.846e-1960.0040S ribosomal protein S25 OS=Suberites domuncula O... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps252.401e-1962.67ribosomal protein S25 [Source:NCBI gene;Acc:103037... [more]
rps251.532e-1863.89ribosomal protein S25 [Source:NCBI gene;Acc:103037... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002646.11.052e-1660.56pep scaffold:Pmarinus_7.0:GL477054:677931:683216:1... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPS25A8.332e-838.89Protein component of the small (40S) ribosomal sub... [more]
RPS25B8.681e-839.44Protein component of the small (40S) ribosomal sub... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO356401.506e-2164.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps257.042e-2064.00ribosomal protein S25 [Source:NCBI gene;Acc:101157... [more]
back to top
BLAST of 40S ribosomal protein S25 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000059049.12.813e-40100.00SMESG000059049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023413 ID=SMED30023413|Name=40S ribosomal protein S25|organism=Schmidtea mediterranea sexual|type=transcript|length=528bp
AGAGGAATTGGCTCAAAATGCATCACTTTTAAAAATAAATACAATAAATT
TTTTAAATTATAAAATGTCTAAATAAAATTTGTTTAAATTTAATCTTTTA
ATAGTGTATAAATTTTTCAAATTATTTATCATGCCACCAAAGAACGCAAA
GCCTGGAAAAGGAGACAAAGGTAAAACTCCAACAAAAACTAAACCAACTT
CTTCTGGATCTGGAGGAAAGCAAAAGAAGAAGAAGTGGTCAAAGGGAAAA
GTTAGAGATAAGCTTAACAATGCATGCCTTTTTGATCAAGTGACTTATGA
TAAACTTTACAAAGAAGTTCCTTCATACAAAGTTACTACTCCATCAATTG
TATCTGAAAGACTCAAGATTCGTGTGTCATTGGCAAGAAGAGCTCTGAAA
GAGCTTCTTGAGCGCGATATGATCCTACAGACATGTGGTCATAACATGCA
AGAAATCTTTAGCAGATCAAATAAAGAATAATTTCATATAATAAAAATTT
GGATTTATTTTTCAAAAAAAAGATCGGA
back to top

protein sequence of SMED30023413-orf-1

>SMED30023413-orf-1 ID=SMED30023413-orf-1|Name=SMED30023413-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MPPKNAKPGKGDKGKTPTKTKPTSSGSGGKQKKKKWSKGKVRDKLNNACL
FDQVTYDKLYKEVPSYKVTTPSIVSERLKIRVSLARRALKELLERDMILQ
TCGHNMQEIFSRSNKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004977Ribosomal_S25
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 75..95
NoneNo IPR availableGENE3DG3DSA:1.10.10.2780coord: 29..116
e-value: 3.4E-33
score: 115.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..40
NoneNo IPR availablePANTHERPTHR12850:SF5RIBOSOMAL PROTEIN S25coord: 2..115
NoneNo IPR availablePRODOMPD012268coord: 49..115
e-value: 1.0E-13
score: 179.0
IPR004977Ribosomal protein S25PFAMPF03297Ribosomal_S25coord: 15..112
e-value: 2.8E-37
score: 126.9
IPR004977Ribosomal protein S25PANTHERPTHR12850FAMILY NOT NAMEDcoord: 2..115