slc42a-1

Overview
Nameslc42a-1 (AKN21681.1)
Smed IDSMED30023411
Length (bp)3531
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc42a-1 (SMED30023411) t-SNE clustered cells

Violin plots show distribution of expression levels for slc42a-1 (SMED30023411) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc42a-1 (SMED30023411) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc42a-1 (SMED30023411) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023411

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023411SMESG000048378.1 SmedASXL_018014SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30023411SMESG000048378.1 SmedASXL_018013SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023411SMESG000048378.1 SmedASXL_018013SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30023411SMESG000048378.1 dd_Smed_v4_11756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023411SMESG000048378.1 dd_Smed_v4_11756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30023411SMESG000048384.1 dd_Smed_v6_1882_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30023411SMESG000048384.1 dd_Smed_v6_1882_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30023411SMESG000048384.1 dd_Smed_v4_1882_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc42a-1 vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 100.138 bits (248), Expect = 1.182e-22
Identity = 76/244 (31.15%), Postives = 124/244 (50.82%), Query Frame = 1
Query: 2476 SYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHER----IVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKS---PGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            + GTV+   +  T ++ A+K++  Q    +  E  IN+   L+  E     IV +  ++   +  ++ MEYL          ++    G +    ++ L+AL FLH   +IHRDIK +N+LL +DG++KL+DFG       +  +  K     GT  + APE++  + Y   VDIWSLG   I++  G+PPY N      + +I+T    E + PE +     + ++  LE D  KR SAK+LL
Sbjct:    2 ASGTVYTAMDVATGQEVAIKQMNLQQQPKK--ELIINEI--LVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQ---ITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 238          
BLAST of slc42a-1 vs. Ensembl Human
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 15 [Source:HGNC Symbol;Acc:HGNC:31689])

HSP 1 Score: 106.301 bits (264), Expect = 2.267e-22
Identity = 76/254 (29.92%), Postives = 120/254 (47.24%), Query Frame = 1
Query: 2455 RKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYI--FMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            R  +  G+YG V+   +     + A+K+IP+++ R ++ +   I      L H  IV++ G+    EN YI  FME      L  L + K+       +  + KQILE L +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ T +PP+H LG+           +I  ++PE +       I    E D +KR +  +LL
Sbjct:  655 RVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIA-LHKYLKHRNIVQYLGSV--SENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGVNPCTE--TFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSKPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPHKRATTAELL 903          
BLAST of slc42a-1 vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 103.219 bits (256), Expect = 3.039e-22
Identity = 82/265 (30.94%), Postives = 133/265 (50.19%), Query Frame = 1
Query: 2422 YTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHER----IVKHFGAFHKKENHYIFMEYL------DTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            YT F++        I  G+ GTV+   +  T ++ A+K++  Q    +  E  IN+   L+  E     IV +  ++   +  ++ MEYL      D + +    +   G +    ++ L+AL FLH   +IHRDIK +N+LL +DG++KL+DFG       +  +  K     GT  + APE++  + Y   VDIWSLG   I++  G+PPY N      + +I+T    E + PE +     + ++  LE D  KR SAK+LL
Sbjct:  172 YTRFEK--------IGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKK--ELIINEI--LVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQ---ITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELL 418          
BLAST of slc42a-1 vs. Ensembl Human
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6854])

HSP 1 Score: 104.375 bits (259), Expect = 3.299e-22
Identity = 82/255 (32.16%), Postives = 130/255 (50.98%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHY--IFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ AVK++      P+ +     +E  I   KNLL HERIV+++G     +     IFMEY+       Q K Y   +      + +QILE + +LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ E Y    DIWS+  T++++ T +PP+      A I  I+ T+    KLP ++  Y  + +  +  + +  R SA +LL
Sbjct:  360 KLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIA-TQPTNPKLPPHVSDYTRDFLKRIFVEAKL-RPSADELL 611          
BLAST of slc42a-1 vs. Ensembl Human
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6854])

HSP 1 Score: 104.375 bits (259), Expect = 3.299e-22
Identity = 82/255 (32.16%), Postives = 130/255 (50.98%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHY--IFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ AVK++      P+ +     +E  I   KNLL HERIV+++G     +     IFMEY+       Q K Y   +      + +QILE + +LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ E Y    DIWS+  T++++ T +PP+      A I  I+ T+    KLP ++  Y  + +  +  + +  R SA +LL
Sbjct:  360 KLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIA-TQPTNPKLPPHVSDYTRDFLKRIFVEAKL-RPSADELL 611          
BLAST of slc42a-1 vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 98.2117 bits (243), Expect = 1.146e-21
Identity = 81/265 (30.57%), Postives = 135/265 (50.94%), Query Frame = 1
Query: 2437 RKKIKNRKCIASGSYGTVFLY-NESGTDRKFAVKKIPKQNIRARYIEANINDFKNL--LCHERIVKHFGAFHKKENHYIFMEYLDT-------LQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLL---DIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEY--MPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            R+K   R  + +G++  VFL  ++S   + +AVK I K+ ++ +  E+  N+ K L  L H  IV+ F  + +K+  Y+ ME +         + K  Y ++   +L+   +Q+LEA+ F+H+  ++HRD+KPEN+L    D D  + +SDFGLS       ED       CGT  Y APE+L  + Y  +VD+WS+G     L  G PP+++  D  +   I    E E+  P +  +     + I H++  D   R + +  L
Sbjct:   19 REKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKE-ESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLI---RQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLSK-----TEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQI-IKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDAL 273          
BLAST of slc42a-1 vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 97.4413 bits (241), Expect = 1.853e-21
Identity = 68/247 (27.53%), Postives = 122/247 (49.39%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANIN---DFKNLLCHERIVKHFGAFHKKENHYIFMEY------LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHN-LGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRL 3168
            + +  G +G VF+  E  T R  A+K + K  +    +   +    + +  L H  I+  +G FH  +  ++ ++Y       + LQ +   K +      F +Q+  AL + H + +IHRDIKPEN+LLD   N       L+    SV  D  K    CGT  Y APE+++ + +  +VDIW++G  + ++  G  P+ N  GD     +I+  +E +  +P  +    ++LI+ +++K+  +RL
Sbjct:   48 RPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLN-----LKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGD----KLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERL 285          
BLAST of slc42a-1 vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 97.4413 bits (241), Expect = 1.853e-21
Identity = 68/247 (27.53%), Postives = 122/247 (49.39%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANIN---DFKNLLCHERIVKHFGAFHKKENHYIFMEY------LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHN-LGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRL 3168
            + +  G +G VF+  E  T R  A+K + K  +    +   +    + +  L H  I+  +G FH  +  ++ ++Y       + LQ +   K +      F +Q+  AL + H + +IHRDIKPEN+LLD   N       L+    SV  D  K    CGT  Y APE+++ + +  +VDIW++G  + ++  G  P+ N  GD     +I+  +E +  +P  +    ++LI+ +++K+  +RL
Sbjct:   48 RPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLN-----LKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGD----KLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERL 285          
BLAST of slc42a-1 vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 93.9745 bits (232), Expect = 9.808e-21
Identity = 76/253 (30.04%), Postives = 125/253 (49.41%), Query Frame = 1
Query: 2455 RKCIASGSYGTVFLYNESGTDRKFAVKKIP-KQNIRARYIEANINDFKNLLCHERIVKHFGAFH-KKENHYIFMEYL------DTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLG 3189
            +K I  G+ GTVF+ N +G+    AVK++  K   +   +   I   K    H  +V +  ++    ++ ++ M+YL      D + K +  +   G +    ++ L+AL FLH  SI+HRDIK +NVLL ++G +KL+D G    +    +   K     GT  + +PEILN + Y   VDIWSLG   +++  G+PPY        I +I+   + E K  + +    +N +D  L  D  +R    +LL 
Sbjct:    2 KKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEIKVMKQYR-HPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDE---GQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI----QPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLA 246          
BLAST of slc42a-1 vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 97.4413 bits (241), Expect = 1.399e-20
Identity = 77/254 (30.31%), Postives = 131/254 (51.57%), Query Frame = 1
Query: 2464 IASGSYGTVFLYNESGTDRKFAVKKI-----PKQNIRARYIEANINDFKNLL--CHERIVKHFGAFHKKENHYIFMEYL------DTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            I SG+ G+V+   E  T+ + A+K++     PK+       E  IN+   +    H  IV +  ++   +  ++ MEYL      D + + + +    G +    +++L+AL FLH R +IHRDIK +N+LL +DG++KL+DFG       ++ + +K     GT  + APE++  + Y   VD+WSLG   I++  G+PPY N      I +I+T  + ++   + M     + +D  LE     R SA +LL
Sbjct:  252 IGSGASGSVYTAIEISTEAEVAIKQMNLKDQPKK-------ELIINEILVMRENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMED---GIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQ---LSPEQRKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLL 492          
BLAST of slc42a-1 vs. Ensembl Fly
Match: aurA (gene:FBgn0000147 transcript:FBtr0082483)

HSP 1 Score: 97.0561 bits (240), Expect = 8.308e-21
Identity = 71/253 (28.06%), Postives = 123/253 (48.62%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANIN---DFKNLLCHERIVKHFGAFHKKENHYIFMEY------LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLG-DGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            + +  G +G V+L  E  +    A+K + K+ I    +E  +    + ++ L H  I++ +  FH     Y+ +EY       + LQ +  ++        + + +  AL +LHER IIHRDIKPEN+LL   G        ++    SV E        CGT  Y  PE++  + +T +VD+WSLG    +L  G  P+++   D     ++    +++YKLPE++ K  S+LI  +L  +   RL   +++
Sbjct:  158 RLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKG-----VLKIADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKIL----KVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVM 401          
BLAST of slc42a-1 vs. Ensembl Fly
Match: mbt (gene:FBgn0025743 transcript:FBtr0074285)

HSP 1 Score: 97.8265 bits (242), Expect = 1.883e-20
Identity = 77/260 (29.62%), Postives = 133/260 (51.15%), Query Frame = 1
Query: 2437 RKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEAN----INDFKNLLCHERIVKHFGAFHKKENHYIFMEYL------DTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            R+ + +   I  GS GTV +  +  T R+ AVKK+  +  + R +  N    + D+     H  IV+ + +F   +  ++ MEYL      D +   +  ++    +    KQ L+AL++LH + +IHRDIK +++LL  DG +KLSDFG       V++++ K     GT  + +PE+++   Y   VDIWSLG  +I++  G+PP+ N      +  I   +    K    +   + + +D ML +D  +R +A +LL
Sbjct:  365 RENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYH----HPNIVETYSSFLVNDELWVVMEYLEGGALTDIVTHSRMDEE---QIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQ---VSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELL 614          
BLAST of slc42a-1 vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0083819)

HSP 1 Score: 98.5969 bits (244), Expect = 2.293e-20
Identity = 73/259 (28.19%), Postives = 125/259 (48.26%), Query Frame = 1
Query: 2449 KNRKCI-ASGSYGTVFLYNESGTDRKFAVKKIPK---QNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQ--KKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAEL--YTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +NRK +   G+YGTV+   +  T  + A+K++P+   Q+++  + E  ++   + L H  IV++ G+  +     IFME      L  L + K+   K +   +  ++KQILE L +LHE+ I+HRDIK +NVL++    +       +    +    + +     GT  Y APE+++  +  Y  + DIWS G T +++ TG+PP+  LG            +    +PE +     N I          R SA +LL
Sbjct:  418 QNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLH---SQLRHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTET--FTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLL 671          
BLAST of slc42a-1 vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0300256)

HSP 1 Score: 98.5969 bits (244), Expect = 2.406e-20
Identity = 73/259 (28.19%), Postives = 125/259 (48.26%), Query Frame = 1
Query: 2449 KNRKCI-ASGSYGTVFLYNESGTDRKFAVKKIPK---QNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQ--KKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAEL--YTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +NRK +   G+YGTV+   +  T  + A+K++P+   Q+++  + E  ++   + L H  IV++ G+  +     IFME      L  L + K+   K +   +  ++KQILE L +LHE+ I+HRDIK +NVL++    +       +    +    + +     GT  Y APE+++  +  Y  + DIWS G T +++ TG+PP+  LG            +    +PE +     N I          R SA +LL
Sbjct:  585 QNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLH---SQLRHRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTET--FTGTLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLL 838          
BLAST of slc42a-1 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 97.0561 bits (240), Expect = 4.529e-20
Identity = 79/256 (30.86%), Postives = 129/256 (50.39%), Query Frame = 1
Query: 2437 RKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIP-KQNIRARYIEANINDFKNLL--CHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKS---PGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            RK  K  K I  G+ GTV+   ES T  + A+K++   Q  +   I   IN+   +    H  +V +  ++   E  ++ MEYL          ++    G +    +++L+AL FLH   +IHRDIK +N+LL +DG++KL+DFG       ++ +  K     GT  + APE++  + Y   VD+WSLG   I++  G+PPY N      + +I+T  + E K  + +     + +D  LE +  +R SA  LL
Sbjct:  428 RKYTKMEK-IGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELI---INEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQ---ISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLL 676          
BLAST of slc42a-1 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 109.768 bits (273), Expect = 3.868e-24
Identity = 82/255 (32.16%), Postives = 135/255 (52.94%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAF--HKKENHYIFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ A K++      P+ +     +E  I   KNL  HERIV+++G    H ++   IFMEY+       Q K Y   +      + +QILE +S+LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ E Y    D+WSLG T++++ T +PP+      A I  I+ T+    +LP ++ ++  + +  +  + +Y R SA++LL
Sbjct:  348 KLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIA-TQPTNPQLPSHISEHTRDFLRCIFVEAKY-RPSAEELL 599          
BLAST of slc42a-1 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 109.383 bits (272), Expect = 5.288e-24
Identity = 82/255 (32.16%), Postives = 135/255 (52.94%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAF--HKKENHYIFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ A K++      P+ +     +E  I   KNL  HERIV+++G    H ++   IFMEY+       Q K Y   +      + +QILE +S+LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ E Y    D+WSLG T++++ T +PP+      A I  I+ T+    +LP ++ ++  + +  +  + +Y R SA++LL
Sbjct:  366 KLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIA-TQPTNPQLPSHISEHTRDFLRCIFVEAKY-RPSAEELL 617          
BLAST of slc42a-1 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 109.383 bits (272), Expect = 6.579e-24
Identity = 82/255 (32.16%), Postives = 135/255 (52.94%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAF--HKKENHYIFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ A K++      P+ +     +E  I   KNL  HERIV+++G    H ++   IFMEY+       Q K Y   +      + +QILE +S+LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ E Y    D+WSLG T++++ T +PP+      A I  I+ T+    +LP ++ ++  + +  +  + +Y R SA++LL
Sbjct:  360 KLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVSALECEIQLLKNLH-HERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIA-TQPTNPQLPSHISEHTRDFLRCIFVEAKY-RPSAEELL 611          
BLAST of slc42a-1 vs. Ensembl Zebrafish
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:ZFIN;Acc:ZDB-GENE-091204-246])

HSP 1 Score: 108.997 bits (271), Expect = 1.961e-23
Identity = 73/253 (28.85%), Postives = 120/253 (47.43%), Query Frame = 1
Query: 2452 NRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +R  +  G+YG V+   +     + A+K+IP+++ R ++ +   I      L H  IV++ G+  +     IFME      L  L + K+       ++ + +QILE + +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ TG+PP+H LG+           +I  ++PE +     + I    E D  KR  A  LL
Sbjct:  467 DRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIA-LHKYLKHRNIVQYLGSVSEDGYIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGIRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTET--FTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGKPPFHELGEPQAAMFKVGMFKIHPEIPESLSSEAKSFILSSFEPDPNKRAMAGDLL 716          
BLAST of slc42a-1 vs. Ensembl Zebrafish
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:ZFIN;Acc:ZDB-GENE-091204-246])

HSP 1 Score: 108.997 bits (271), Expect = 2.005e-23
Identity = 73/253 (28.85%), Postives = 120/253 (47.43%), Query Frame = 1
Query: 2452 NRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +R  +  G+YG V+   +     + A+K+IP+++ R ++ +   I      L H  IV++ G+  +     IFME      L  L + K+       ++ + +QILE + +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ TG+PP+H LG+           +I  ++PE +     + I    E D  KR  A  LL
Sbjct:  654 DRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIA-LHKYLKHRNIVQYLGSVSEDGYIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGIRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTET--FTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGKPPFHELGEPQAAMFKVGMFKIHPEIPESLSSEAKSFILSSFEPDPNKRAMAGDLL 903          
BLAST of slc42a-1 vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 104.76 bits (260), Expect = 5.926e-23
Identity = 75/263 (28.52%), Postives = 126/263 (47.91%), Query Frame = 1
Query: 2422 YTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLL--CHERIVKHFGAFHKKENHYIFMEYL------DTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            YT F++        I  G+ GTV++  +  T ++ A+K++  Q    +  E  IN+   +    H  IV +  ++   E  ++ MEYL      D + +   Q+   G++    ++ L+AL FLH   +IHRDIK +N+LL +DG             + ++ +  K     GT  + APE++  + Y   VD+WSLG   I++  G+PPY N      + +I+T    + + PE       + +   LE D  KR SA+ LL
Sbjct:  165 YTRFEK--------IGQGASGTVYIAVDVATGQEVAIKQMNLQQQPKK--ELIINEILVMRENKHPNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQE---GEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDG---AVKLTDFGFCAQISPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLL 411          
BLAST of slc42a-1 vs. Ensembl Xenopus
Match: taf3 (TATA-box binding protein associated factor 3 [Source:Xenbase;Acc:XB-GENE-940280])

HSP 1 Score: 105.531 bits (262), Expect = 7.375e-23
Identity = 82/253 (32.41%), Postives = 126/253 (49.80%), Query Frame = 1
Query: 2437 RKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFA---KQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +KK    + I  G+ GTVF   +  T ++ A+K+I  Q    + +  N       L +  IV    +F   +  Y+ MEYL          ++  D    A   ++ L+AL FLH   +IHRDIK +NVLL +DG++KL+DFG       +  +  K     GT  + APE++  + Y   VDIWSLG   I++  G+PPY N      + +I+T    E + PE +     + ++  LE D  KR SA++LL
Sbjct:  240 KKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVSDELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQ---ITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQKPEKLSPIFRDFLNRSLEMDVEKRGSARELL 489          
BLAST of slc42a-1 vs. Ensembl Xenopus
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:549376])

HSP 1 Score: 106.686 bits (265), Expect = 1.691e-22
Identity = 73/252 (28.97%), Postives = 114/252 (45.24%), Query Frame = 1
Query: 2452 NRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +R  +  G+YG V+   +     + A+K+IP+++ R              L H  IV++ G+  +     IFME      L  L + K+       +  + KQILE L +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ TG+PP+H LG+           +I  ++PE +       I    E D  KR +   LL
Sbjct:  653 DRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPEKDSRYSQPLHEEIALHKYLKHRNIVQYLGSISEDGYIKIFMEQVPGGSLSVLLRSKWGPLKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTET--FTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGRPPFHELGEPQAAMFKVGMFKIHPEIPESLSAEARAFILLCFEPDPAKRATVTDLL 902          
BLAST of slc42a-1 vs. Ensembl Xenopus
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:549376])

HSP 1 Score: 106.301 bits (264), Expect = 2.003e-22
Identity = 74/253 (29.25%), Postives = 118/253 (46.64%), Query Frame = 1
Query: 2452 NRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +R  +  G+YG V+   +     + A+K+IP+++ R ++ +   I      L H  IV++ G+  +     IFME      L  L + K+       +  + KQILE L +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ TG+PP+H LG+           +I  ++PE +       I    E D  KR +   LL
Sbjct:  645 DRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPEKDSRYSQPLHEEIA-LHKYLKHRNIVQYLGSISEDGYIKIFMEQVPGGSLSVLLRSKWGPLKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTET--FTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGRPPFHELGEPQAAMFKVGMFKIHPEIPESLSAEARAFILLCFEPDPAKRATVTDLL 894          
BLAST of slc42a-1 vs. Ensembl Xenopus
Match: MAP3K15 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:549376])

HSP 1 Score: 106.301 bits (264), Expect = 2.058e-22
Identity = 74/253 (29.25%), Postives = 118/253 (46.64%), Query Frame = 1
Query: 2452 NRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +R  +  G+YG V+   +     + A+K+IP+++ R ++ +   I      L H  IV++ G+  +     IFME      L  L + K+       +  + KQILE L +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ TG+PP+H LG+           +I  ++PE +       I    E D  KR +   LL
Sbjct:  645 DRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPEKDSRYSQPLHEEIA-LHKYLKHRNIVQYLGSISEDGYIKIFMEQVPGGSLSVLLRSKWGPLKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTE--TFTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGRPPFHELGEPQAAMFKVGMFKIHPEIPESLSAEARAFILLCFEPDPAKRATVTDLL 894          
BLAST of slc42a-1 vs. Ensembl Mouse
Match: Map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:MGI Symbol;Acc:MGI:2448588])

HSP 1 Score: 109.768 bits (273), Expect = 1.324e-23
Identity = 79/254 (31.10%), Postives = 121/254 (47.64%), Query Frame = 1
Query: 2455 RKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYI--FMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            R  +  GSYG V+   +     + A+K+IP+++IR ++ +   I      L H  IV++ G+    EN YI  FME      L  L + K+       +  + KQILE L +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ T +PP+H LG+           +I  ++PE +       I    E D  KR++A  LL
Sbjct:  659 RVVLGKGSYGIVYAGRDLSNQVRIAIKEIPERDIRYSQPLHEEIA-LHKYLKHRNIVQYLGSV--SENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGINPCTE--TFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSRPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPQKRVTAADLL 907          
BLAST of slc42a-1 vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 101.293 bits (251), Expect = 1.866e-22
Identity = 72/255 (28.24%), Postives = 124/255 (48.63%), Query Frame = 1
Query: 2455 RKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRAR--YIEANINDFKNLLCHERIVKHFGAFHKKENH-YIFMEYLDT-------LQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIIT-VISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            R+ + SG++  V L  E G+    A+K IPK+ +R +   +E  I   + +  H  IV      H+  +H Y+ ME +         +++  Y +K    L+    Q+L A+S+LH   I+HRD+KPEN+L                L    A ++   G  CGT  Y APE+L  + Y  +VD+W+LG     L  G PP+++  D  + + ++  + E +    + + +   + I H+LE+D  KR + ++ L
Sbjct:   18 REKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRI-SHPNIVA-LEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLV---GQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNML--GTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQAL 265          
BLAST of slc42a-1 vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 101.293 bits (251), Expect = 1.866e-22
Identity = 72/255 (28.24%), Postives = 124/255 (48.63%), Query Frame = 1
Query: 2455 RKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRAR--YIEANINDFKNLLCHERIVKHFGAFHKKENH-YIFMEYLDT-------LQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIIT-VISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            R+ + SG++  V L  E G+    A+K IPK+ +R +   +E  I   + +  H  IV      H+  +H Y+ ME +         +++  Y +K    L+    Q+L A+S+LH   I+HRD+KPEN+L                L    A ++   G  CGT  Y APE+L  + Y  +VD+W+LG     L  G PP+++  D  + + ++  + E +    + + +   + I H+LE+D  KR + ++ L
Sbjct:   18 REKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRI-SHPNIVA-LEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLV---GQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNML--GTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQAL 265          
BLAST of slc42a-1 vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 101.293 bits (251), Expect = 1.866e-22
Identity = 72/255 (28.24%), Postives = 124/255 (48.63%), Query Frame = 1
Query: 2455 RKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRAR--YIEANINDFKNLLCHERIVKHFGAFHKKENH-YIFMEYLDT-------LQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIIT-VISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            R+ + SG++  V L  E G+    A+K IPK+ +R +   +E  I   + +  H  IV      H+  +H Y+ ME +         +++  Y +K    L+    Q+L A+S+LH   I+HRD+KPEN+L                L    A ++   G  CGT  Y APE+L  + Y  +VD+W+LG     L  G PP+++  D  + + ++  + E +    + + +   + I H+LE+D  KR + ++ L
Sbjct:   18 REKLGSGAFSEVMLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRI-SHPNIVA-LEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLV---GQVLGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNML--GTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQAL 265          
BLAST of slc42a-1 vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 104.375 bits (259), Expect = 2.285e-22
Identity = 82/255 (32.16%), Postives = 131/255 (51.37%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHY--IFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ AVK++      P+ +     +E  I   KNLL HERIV+++G     +     IFMEY+       Q K Y   +      + +QILE + +LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ E Y    DIWS+  T++++ T +PP+      A I  I+ T+    KLP ++  Y  + +  +  + +  R SA++LL
Sbjct:  360 KLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVNALECEIQLLKNLL-HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIA-TQPTNPKLPPHVSDYTRDFLKRIFVEAKL-RPSAEELL 611          
BLAST of slc42a-1 vs. UniProt/SwissProt
Match: sp|O59790|ARK1_SCHPO (Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ark1 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.340e-25
Identity = 75/253 (29.64%), Postives = 130/253 (51.38%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANIN---DFKNLLCHERIVKHFGAFHKKENHYIFMEYLDT------LQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNL-GDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G +G V+L  E  T    A+K + K  +    IE  +    + ++ L H+ I++ +G FH ++  Y+ +E+         L++ K   +      +F  Q+  ALS+LH++ +IHRDIKPEN+LL IDG        LS    SV     +    CGT  Y  PE++  + +T  VD+WSLG    +   G PP+ ++ G  A    I+   +++ K+P ++P    +LI  +L+ +  KR+S ++++
Sbjct:   93 KPLGKGKFGRVYLAKEKKTGFIVALKTLHKSELVQSKIEKQVRREIEIQSNLRHKNILRLYGHFHDEKRIYLILEFAGRGELYQHLRRAKRFSEEVASKYIF--QMANALSYLHKKHVIHRDIKPENILLGIDGE-----IKLSDFGWSVHAPSNRRTTLCGTLDYLPPEMVEGKEHTEKVDLWSLGVLTYEFLVGAPPFEDMSGHSATYKRIA---KVDLKIPSFVPPDARDLISRLLQHNPEKRMSLEQVM 335          
BLAST of slc42a-1 vs. UniProt/SwissProt
Match: sp|P28178|PK2_DICDI (Protein kinase 2 OS=Dictyostelium discoideum OX=44689 GN=pkgB PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 1.065e-23
Identity = 79/246 (32.11%), Postives = 131/246 (53.25%), Query Frame = 1
Query: 2461 CIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLL---CHERIVKHFGAFHKKENHYIFMEYLDT----LQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAK 3177
             I  GS+G V    + G D+ FA+K + K  I AR    +    K +L    H  IV    AF  K+  Y+ +++++        K+  + S   + ++A +I+ AL  LH++ I++RD+KPEN+LLD +G++ ++DFGLS  +    E        CGT  Y APE+LN   + C+VD WSLG  + ++ TG PP+++     + T+       E K+P Y+     +L++ +L ++  KRL  K
Sbjct:  158 VIGKGSFGKVMQVKKKGEDKIFAMKVLRKDAIIARKQVNHTKSEKTILQCISHPFIVNLHYAFQTKDKLYMVLDFVNGGELFFHLKREGRFSEPRVKIYAAEIVSALDHLHKQDIVYRDLKPENILLDSEGHICITDFGLSKKI----ETTDGTFTFCGTPEYLAPEVLNGHGHGCAVDWWSLGTLLYEMLTGLPPFYSQN---VSTMYQKILNGELKIPTYISPEAKSLLEGLLTREVDKRLGTK 396          
BLAST of slc42a-1 vs. UniProt/SwissProt
Match: sp|Q6C3J2|IPL1_YARLI (Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=IPL1 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.721e-23
Identity = 81/255 (31.76%), Postives = 130/255 (50.98%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANIN-------DFKNLLCHERIVKHFGAFHKKENHYIFMEYL------DTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKL 3183
            K +  G +G V+L  +  T    A+K + K+ +    +E N+        + ++ L H  +++ FG FH K+  Y+ +EY+        L+ +K   +S     ++  Q+ EAL +LH ++IIHRDIKPEN+LL  +  +K+SDFG S     V     +    CGT  Y  PEI+ +  Y  +VD+WSLG  M +   G PP+   G GA  T     + ++ ++P Y+    ++LI  ML  D  KR   K +
Sbjct:  103 KALGKGKFGKVYLVKDKKTGFVSALKCMEKKEL----VEGNVEKQFRREVEIQSNLRHTNVLRLFGHFHDKDRVYLILEYVVHGELYKLLRNQKRFTESTASSYIY--QMSEALLYLHGKNIIHRDIKPENILLHFNDTIKISDFGWS-----VHAPSNRRSTLCGTMDYLPPEIVQSRPYDKNVDVWSLGILMYEFLCGAPPFEEPG-GAQATYRRIVK-LDLRIPPYVSADAADLIKRMLTLDPAKRFKLKDM 344          
BLAST of slc42a-1 vs. UniProt/SwissProt
Match: sp|A2AQW0|M3K15_MOUSE (Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus OX=10090 GN=Map3k15 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 9.260e-23
Identity = 79/254 (31.10%), Postives = 121/254 (47.64%), Query Frame = 1
Query: 2455 RKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYI--FMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            R  +  GSYG V+   +     + A+K+IP+++IR ++ +   I      L H  IV++ G+    EN YI  FME      L  L + K+       +  + KQILE L +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ T +PP+H LG+           +I  ++PE +       I    E D  KR++A  LL
Sbjct:  659 RVVLGKGSYGIVYAGRDLSNQVRIAIKEIPERDIRYSQPLHEEIA-LHKYLKHRNIVQYLGSV--SENGYIKIFMEQVPGGSLSALLRSKWGPMKEPTIKFYTKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLAGINPCTE--TFTGTLQYMAPEIIDQGPRGYGAPADIWSLGCTIIEMATSRPPFHELGEPQAAMFKVGMFKIHPEIPEALSAEARAFILSCFEPDPQKRVTAADLL 907          
BLAST of slc42a-1 vs. UniProt/SwissProt
Match: sp|P27636|CDC15_YEAST (Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC15 PE=1 SV=3)

HSP 1 Score: 107.842 bits (268), Expect = 2.479e-22
Identity = 87/253 (34.39%), Postives = 125/253 (49.41%), Query Frame = 1
Query: 2455 RKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRA-RYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMV 3195
            ++ I  GSYG V+      TD+  A+K++  +N      I A I+  KNL  H  IVK+ G   K    YI +EY     L  L  +     S  +   +  Q L  L +LH   +IHRDIK  N+LL  D  +KL+DFG+S +++S A  +       GT  + APEIL     +   DIWSLGAT++++ T  PPYHNL D  I   +       Y  P    + + + +     K+ YKR +A +LL  V
Sbjct:   28 KQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNL-NHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTL------AGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEND---TYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270          
BLAST of slc42a-1 vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 1812.74 bits (4694), Expect = 0.000e+0
Identity = 945/945 (100.00%), Postives = 945/945 (100.00%), Query Frame = 1
Query:  373 MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVXXXXXXXXXXXXXXXXFRLAADKQXXXXXXXXXXXXEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNXXXXXXXXXXXATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMVDSHL 3207
            MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNIKEEIQKQIKIATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMVDSHL
Sbjct:    1 MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNIKEEIQKQIKIATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMVDSHL 945          
BLAST of slc42a-1 vs. TrEMBL
Match: I7M1N1 (Serine/Threonine kinase domain protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00483500 PE=4 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 1.000e-28
Identity = 111/414 (26.81%), Postives = 191/414 (46.14%), Query Frame = 1
Query: 1993 SPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENN-CDMVTLDKLKRSPLQIAETGDFENMIK-LIKECQIIREIAAEMQL-------KCGKLCNHKFCYTSFQRKKIKNRKC-------IASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFK-------NLLCHERIVKHFGAFHKKENHYIFME---YLDTLQKKKYQKK-SPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKD 3153
            +P+ Y   +G+  +    I++  N+DS + + +  L  A + N  D+  LLIESGA IN  D  L  P+H      + +   ++++    D+   +   + P Q +   D     +  +++ ++ R I A MQ+             N++   ++   + I N          I  G++  VFL  E  T ++FA+K + KQ I    IE N+  +         L+ H  IVK   AF  K+  +  +E     D LQ  K++KK S      +A ++L AL +LH   II+RD+K +N+L+  DG+  +      L    V E  Q     CG+  Y  PEIL  + +  S+D++ LG  + ++ TGQPP++   +  I   I      + K P ++ +   +L+  +L KD
Sbjct:  247 TPLHYFAYFGNTPLCNLLIQKDINLDSVNIQGQTPLILACLENKQDVAALLIESGANINAQDQYLNTPLHYCFLNGDKDLLDIILKKPYLDINLRNNNNKLPYQESSNEDLITYFRQQVQKKELQRNIKAHMQIIEYDEEDLHNLFSNNQSIVSNLHSQSILNHTSQYIVHGLIGKGAFAEVFLVEERKTGKQFALKMLHKQKI----IEQNMYKYAITERNILQLVDHPFIVKMHKAFQTKDKLFFLLENGKRGDILQHLKFEKKFSESKAQFYAAEVLLALEYLHNHDIIYRDLKAQNILIAEDGH--VRITDFGLSKEGVREYDQGARSFCGSVAYMPPEILRNQGHGKSIDLYLLGIFIFEMLTGQPPFYGKDENTIYNNIQMN---QLKFPNFISRTAKSLLIKLLSKD 651          
BLAST of slc42a-1 vs. TrEMBL
Match: A0A0V0QM09 (Protein kinase-like domain OS=Pseudocohnilembus persalinus OX=266149 GN=PPERSA_09273 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.474e-28
Identity = 133/483 (27.54%), Postives = 231/483 (47.83%), Query Frame = 1
Query: 1825 QLVYEFFIFDRLEYERYSEFEKFGQ-----LIKAIKDGSIEDVKKYYSR-RILEIKL---GSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKF------CYTSFQR--------KKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLC---HERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKK 3180
            QLV E   F +   + +++F K  +     L+   + G+IE VKK  S+ ++  + +   G    +P+  A    H +++KY I+Q  NV+S     RRA+H A IS + DI ++LI++ A INV D  L  P+H A + N  +  +LL++        ++ ++ PL + +T +  N+   + + +         Q K  K  N  F          F+         K  K  K + SG++G V+L      ++ +A+K + K+ I    I+      K +L    H  I + + +F    + Y+ +EY     L+ L  KKY+K +     ++  +IL AL  LH   I++RD+KP+NV+LD  G+ KL+DFGL+           K     GT  Y APEI+    +   +D ++LG  + +L  G PP++ +    +   I   +    K+P+ M     ++I  +L ++  +RL AK+
Sbjct:  120 QLVEENTQFTQPSTQVWNQFWKNVRKINELLLDEAERGNIEGVKKCLSQDQVFPVDINYKGLDDWTPLHNAVFNQHLEVIKYLIQQGANVESATSFQRRAIHIAAISGSVDIGQILIDNKADINVQDLELETPLHFAVEKNQDKFVELLLKCGAKTDIKNQKQKYPLDVVKTHNMWNVFARLNKLE-------HKQEKYNKFMNPNFGTDENEALHDFETPGDGKVGPKDFKYYKKLGSGAFGEVYLVRYKLNNKVYAMKILKKERIIKDKIQRYTITEKEVLAQMNHPFITRLYYSFQDDLHLYLILEYCPGGDLNQLL-KKYRKLNENVAKIYIAEILLALEALHRDMIVYRDLKPDNVILDEKGHAKLTDFGLAKKNV-----TDKTHSFLGTPAYFAPEIVKKSGHNRVLDWYNLGVLLYELLVGMPPFYAMDRQQLYENI---KRAPLKIPKSMSPQAKDIILKLLNRNPNQRLGAKR 586          
BLAST of slc42a-1 vs. TrEMBL
Match: A0A210PFZ5 (Mitogen-activated protein kinase kinase kinase 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24565 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 8.778e-28
Identity = 87/251 (34.66%), Postives = 135/251 (53.78%), Query Frame = 1
Query: 2464 IASGSYGTVFLYNESGTDRKFAVKKIPKQNIRA------RYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKK----KYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            + SGS+G VF+  +  + R+ AVK++    + A      R +E  I   +N   HERIV +FG         IFMEY+     K    KY   + G    + +Q+LE L+FLH+  I+HRDIK  NVL D+ GN+KL+DFG S  L ++      +    GT  Y APE++N E Y    D+WSLG T++++ +G+PP+  L   A I  I+T    E++LP+   ++    +     ++  +R S++ LL
Sbjct:  136 LGSGSFGEVFVCYDKDSGRELAVKQVNLNQMNAETSKEVRALENEIQLLRNFQ-HERIVSYFGCHQDHSILSIFMEYMPGGSIKDELAKYGPLTEGVTRKYTRQMLEGLAFLHKNVIVHRDIKAANVLRDLQGNIKLADFGASKRLHTICSATGFKS-FVGTPHYMAPEVINGEGYGRKADVWSLGCTVVEMISGKPPWSELESMAAIYKIATAERPEFELPQRSSEFSREFLRLTFRRNPLERPSSEDLL 384          
BLAST of slc42a-1 vs. TrEMBL
Match: T1EDA5 (Protein kinase domain-containing protein OS=Helobdella robusta OX=6412 GN=20194557 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 9.519e-28
Identity = 87/260 (33.46%), Postives = 143/260 (55.00%), Query Frame = 1
Query: 2440 KKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIP--KQNIR--ARYIEA---NINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K  K  + + SGS+G VFL  +  T +++A+K++    +N +  +R + A    IN  K  + H  IV++FG         I MEY+       Q K+Y   +  + + + KQ+L  L +LH++SI+HRD+K  N+L D +GN+KLSDFG S  L +++  I +     GT  Y +PE+L+   Y    DIWSLG +++++ TG PP+H L + A I  I T+ E  Y LP+ + K   + +     +   +R ++ +LL
Sbjct:    2 KSWKRGRLLGSGSFGQVFLCCDMETGKEYAMKQVHIFSKNSQHCSRVLSALREEINILKEGVKHPHIVQYFGCQDDGVVFSILMEYMPGGSVKDQIKQYGPLTERNTISYTKQVLLGLEYLHKKSIVHRDVKGANILRDNEGNVKLSDFGASKRLQTISNSIMQTQ--TGTIYYMSPELLDGNGYGRKTDIWSLGCSVVEMLTGHPPWHQLENFAAIFKIVTSDEPGYSLPDSVSKQARDFVSECFTRSLERRPTSSQLL 259          
BLAST of slc42a-1 vs. Ensembl Cavefish
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:ZFIN;Acc:ZDB-GENE-091204-246])

HSP 1 Score: 108.227 bits (269), Expect = 3.164e-23
Identity = 73/253 (28.85%), Postives = 120/253 (47.43%), Query Frame = 1
Query: 2452 NRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +R  +  G+YG V+   +     + A+K+IP+++ R ++ +   I      L    IV++ G+  +     IFME      L  L + K+       ++ + +QILE L +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ TG+PP+H LG+           +I  ++PE +     + I    E D  KR +A  LL
Sbjct:  643 DRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIA-LHKYLKQRNIVQYLGSVSEDGYIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGLRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTE--TFTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGKPPFHELGEPQAAMFKVGMFKIHPEIPESLSTEAKSFILRCFEPDPNKRATAGDLL 892          
BLAST of slc42a-1 vs. Ensembl Cavefish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 104.76 bits (260), Expect = 6.456e-23
Identity = 81/253 (32.02%), Postives = 125/253 (49.41%), Query Frame = 1
Query: 2437 RKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFA---KQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +KK    + I  G+ GTV+   +  T ++ A+K+I  Q    + +  N       L +  IV    +F   E  ++ MEYL          ++  D    A   ++ L+AL FLH   +IHRDIK +NVLL +DG++KL+DFG       +  +  K     GT  + APE++  + Y   VDIWSLG   I++  G+PPY N      + +I+T    E + PE +     + +   LE D  KR S+K+LL
Sbjct:  211 KKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQ---ITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLSPIFRDFLARCLEMDVEKRGSSKELL 460          
BLAST of slc42a-1 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 104.375 bits (259), Expect = 1.770e-22
Identity = 81/255 (31.76%), Postives = 132/255 (51.76%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAF--HKKENHYIFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ A K++      P+ +     +E  I   KNL  HERIV+++G    H ++   IFMEY+       Q K Y   +      + +QILE +S+LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ + Y    D+WSLG T++++ T +PP+      A I  I+ T+     LP +  +   + I  +  + ++ R SA++LL
Sbjct:  360 KLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNL-HHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIA-TQPTNPILPSHTSEQTRDFIRRIFVEAKH-RPSAEELL 611          
BLAST of slc42a-1 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 104.375 bits (259), Expect = 1.770e-22
Identity = 81/255 (31.76%), Postives = 132/255 (51.76%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAF--HKKENHYIFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ A K++      P+ +     +E  I   KNL  HERIV+++G    H ++   IFMEY+       Q K Y   +      + +QILE +S+LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ + Y    D+WSLG T++++ T +PP+      A I  I+ T+     LP +  +   + I  +  + ++ R SA++LL
Sbjct:  360 KLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNL-HHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIA-TQPTNPILPSHTSEQTRDFIRRIFVEAKH-RPSAEELL 611          
BLAST of slc42a-1 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 104.375 bits (259), Expect = 1.770e-22
Identity = 81/255 (31.76%), Postives = 132/255 (51.76%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAF--HKKENHYIFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ A K++      P+ +     +E  I   KNL  HERIV+++G    H ++   IFMEY+       Q K Y   +      + +QILE +S+LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ + Y    D+WSLG T++++ T +PP+      A I  I+ T+     LP +  +   + I  +  + ++ R SA++LL
Sbjct:  360 KLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEVSTLECEIQLLKNL-HHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIA-TQPTNPILPSHTSEQTRDFIRRIFVEAKH-RPSAEELL 611          
BLAST of slc42a-1 vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 109.383 bits (272), Expect = 9.747e-25
Identity = 86/266 (32.33%), Postives = 139/266 (52.26%), Query Frame = 1
Query: 2425 TSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIP------KQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHY--IFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            T++QR K+     +  G++G V+L  ++ T R+ AVK++       + +     +E  I   KNL  HERIV++FG     +     IFMEY+       Q + Y   +      + +QILE +SFLH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE++N E Y    DIWS+G T++++ T +PP+      A I  I+ T+  + +LP +  ++  +L+  +  + +  R SA+ LL
Sbjct:  357 TNWQRGKL-----LGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNLQ-HERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIA-TQPTDPRLPLHASEHARDLLRRIFVEAKL-RPSAEDLL 614          
BLAST of slc42a-1 vs. Ensembl Sea Lamprey
Match: pdpk1b (3-phosphoinositide dependent protein kinase 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1820])

HSP 1 Score: 95.9005 bits (237), Expect = 1.067e-20
Identity = 75/249 (30.12%), Postives = 117/249 (46.99%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLC---HERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKK----SPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRC---CGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPE-YMPKYISNLIDHMLEKDQYKRLS 3171
            K +  GS+ TV L  E  T +++A+K + K++I        +N  K +L    H   VK F  F  +E  Y  + Y    +  KY +K           ++ QI+ +L  LH   IIHRD+KPEN+LL+ D +            + +  D  K  R     GT  Y +PE+L  +    S D+W+LG  + QL  G PP+    +  I   I    ++EY+ PE + PK   +L++ +L  D  +RL 
Sbjct:   28 KILGEGSFSTVVLAKEVATGKEYAIKILEKRHIIKEKKVPYVNREKEVLSRLNHPFFVKLFFTFQDEEKLYFGLSYAKNGEMLKYIRKHRSFDENCTRFYSAQIVSSLEHLHSLGIIHRDLKPENILLNEDMH----IQITDFGTAKILSDNSKHARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAPNEYLIFQKII---KLEYEFPEKFFPK-AKDLVEKLLVSDPMQRLG 268          
BLAST of slc42a-1 vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 93.2041 bits (230), Expect = 8.263e-20
Identity = 76/253 (30.04%), Postives = 121/253 (47.83%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNI-RARYIEANINDFKNLL--CHERIVKHF-GAFHKKENHYIFMEYLDT------LQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYIS----NLIDHMLEKDQYKRLSA 3174
            K +  GS+G V L       + FA+K + K+ +     +E  + + + LL  C    + H  G F  KE+ +  ME+L        +Q K       G    +A +++  L FLH  +II+RD+K +NVLLD +G++K++DFG+                 CGT  Y APEIL    Y  SVD WS+G  + ++  GQ P++   +  +   I          P Y P+++S    N++  + E+D  KRL A
Sbjct:  256 KVLGKGSFGKVMLAELKEQGKFFAIKALKKEVVLMGDDVECTMVEKRVLLMACEHPFLTHLCGTFQTKEHLFFVMEFLTGGDLMFHIQDKGKFDLPTGTNRFYAAEVICGLQFLHSHNIIYRDLKLDNVLLDREGHVKIADFGMCKEHVGAGNLATT---FCGTPDYIAPEILLGRAYGTSVDWWSMGVLIYEMLIGQSPFYGSDEDELFEAIKG------HTPHY-PRWLSDSSRNILSCLFERDHTKRLGA 498          
BLAST of slc42a-1 vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 88.9669 bits (219), Expect = 1.077e-19
Identity = 63/193 (32.64%), Postives = 104/193 (53.89%), Query Frame = 1
Query: 2608 HERIVKHFGAFHKKENHYIFMEYL---DTLQKKKYQKKSPGDLLLF-AKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSA 3174
            H  +   +  F  KE+    MEYL   D +   + + +   D   F A +I+  L FLH++ II+RD+K +N+LLD DG++K++DFG+      +  D+ + G  CGT  Y APEI+  + Y CSVD WS G  + ++  GQ P+    +  +   I T+  + Y  P ++ K   +++  +LE++  KRL  
Sbjct:   47 HPYLAHLYSTFQTKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKEN--IVGDV-RAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTS--VPY-YPRWITKDSRDILPLLLEREPMKRLGV 233          
BLAST of slc42a-1 vs. Ensembl Sea Lamprey
Match: snrka (SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040718-84])

HSP 1 Score: 90.5077 bits (223), Expect = 9.069e-19
Identity = 68/254 (26.77%), Postives = 116/254 (45.67%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNI----RARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLL-----LFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTC-SVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLG 3189
            K +  G +  V L     T  K AVK I K  +     +   +  +   K L+ H  +V+ +     +   Y+ +E  D      Y  +  G L       +  Q++ A+S+ H   ++HRD+KPENV+       +          S++ +   K    CG+  Y+APEIL  + Y   +VDIWSLG  +  L  G PP+    D   +T+I    + +Y +P ++ +   +LI  ML++D  +R S +++ G
Sbjct:   20 KTLGRGHFAVVKLARHVFTGEKVAVKVIDKSKLDPMATSHLFQQEVRCMK-LVQHPNVVRLYEVIDTQTKLYLILELADGGDLYDYIMRHEGGLQEELAKTYFAQVVHAISYCHRLHVVHRDLKPENVVF---FEKQGLVKLTDFGFSNLFQPGTKLATSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILYMLVCGHPPFQEANDSETLTMI---MDCKYTVPAHISRECKDLIARMLQRDPRRRASLQEMEG 266          
BLAST of slc42a-1 vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 107.842 bits (268), Expect = 3.570e-24
Identity = 87/253 (34.39%), Postives = 125/253 (49.41%), Query Frame = 1
Query: 2455 RKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRA-RYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMV 3195
            ++ I  GSYG V+      TD+  A+K++  +N      I A I+  KNL  H  IVK+ G   K    YI +EY     L  L  +     S  +   +  Q L  L +LH   +IHRDIK  N+LL  D  +KL+DFG+S +++S A  +       GT  + APEIL     +   DIWSLGAT++++ T  PPYHNL D  I   +       Y  P    + + + +     K+ YKR +A +LL  V
Sbjct:   28 KQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNL-NHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTL------AGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEND---TYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270          
BLAST of slc42a-1 vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 97.8265 bits (242), Expect = 5.402e-22
Identity = 69/245 (28.16%), Postives = 124/245 (50.61%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLC---HERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKS---PGDLLLF-AKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLS 3171
            + + +GS+G V L   +   R +A+K + K  I       + ND + +L    H  I++ +G F   +  ++ M+Y++  +     +KS   P  +  F A ++  AL +LH + II+RD+KPEN+LLD +G++K++DFG +  +  V   +      CGT  Y APE+++ + Y  SVD WS G  + ++  G  P++N      +         E K P +      +L+  ++ +D  +RL 
Sbjct:   92 RTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTL------CGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYN---SNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLG 327          
BLAST of slc42a-1 vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 97.0561 bits (240), Expect = 7.839e-22
Identity = 66/249 (26.51%), Postives = 124/249 (49.80%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLC---HERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKS---PGDLL-LFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQK-EGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREI---EYKLPEYMPKYISNLIDHMLEKDQYKRLS 3171
            + + +GS+G V L       R +A+K + KQ +       + ND + +L    H  +++ +G F    N ++ M+Y++  +     +KS   P  +   +A +++ AL +LH  +II+RD+KPEN+LLD +G+       + +     A+++Q      CGT  Y APE++  + Y  SVD WSLG  + ++  G  P+++       T + T  +I   +   P Y    + +L+  ++  D  +R+ 
Sbjct:   74 RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGH-------IKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYD------TTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIG 309          
BLAST of slc42a-1 vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 95.9005 bits (237), Expect = 2.897e-21
Identity = 67/246 (27.24%), Postives = 131/246 (53.25%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQ-NIRARYIEANINDFK---NLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKS---PGDLLLF-AKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLS 3171
            + + +GS+G V L       R +A+K + K+  +R + +E + ND +   +++ H  I++ +G F   +  ++ M+Y++  +     +KS   P  +  F A ++  AL +LH + II+RD+KPEN+LLD +G++K++DFG +  +  V   +      CGT  Y APE+++ + Y  S+D WS G  + ++  G  P++   D   +         E + P +  + + +L+  ++ +D  +RL 
Sbjct:   91 RTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVE-HTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTL------CGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFY---DSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLG 326          
BLAST of slc42a-1 vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 95.5153 bits (236), Expect = 1.869e-20
Identity = 86/299 (28.76%), Postives = 137/299 (45.82%), Query Frame = 1
Query: 2461 CIASGSYGTVFLYNESGTDRKFAVKKI----------------------------------------PK--QNIRARYIEANINDFKNL--LCHERIVKHFGAFHKKENHYIFMEYLD----TLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL--GMVDSHL 3207
            CI SGS+G+V+L   + T    AVK++                                        PK  QNI  + ++A  ++   L  L HE IV ++GA  +  N  IF+EY+     +     Y       +  F +QIL  +++LH+++IIHRDIK  N+L+DI G +K++DFG+S  LS + +   K     G+  + +PE++     T   DIWS G  +I++ TG+ P+ +      I  I T    E  +P +      N +    E D   R SA +LL    +D+H+
Sbjct:  420 CIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPE--IPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWLDAHI 716          
BLAST of slc42a-1 vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 105.531 bits (262), Expect = 5.118e-25
Identity = 81/255 (31.76%), Postives = 138/255 (54.12%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRA------RYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYL--DTLQKKKYQKKSPGDLLL--FAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEG--RCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K + +G++G V++ ++  T R+ AVK+I    + +      + +E  I +F     +ERIV+++G      + YIFMEYL   ++ +   Q  +  + L   +++QILE + +LH   I+HRDIK  N+L D+ GN+KL+DFG S  L ++     K G     GT  + APE++N E Y    D+WS+G T++++ T +PP+ +    A +  I+ T+  E +LP  +       +   L  +   R SA +LL
Sbjct:    8 KLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEI-EFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIR---SKTGFRSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIA-TQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELL 257          
BLAST of slc42a-1 vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 102.449 bits (254), Expect = 6.234e-23
Identity = 80/252 (31.75%), Postives = 130/252 (51.59%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR----ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDT------LQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRC---CGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSA 3174
            K I  GS+G VFL      D+ +A+K + K  IR    A++I A  N     + H  +V    +F  K+  Y  ++Y++       LQ+++Y  +S      +A +I  A+ +LH   II+RD+KPEN+LLD  G++ L+DFGL        E I + G     CGT  Y APE+L  + Y  SVD W LGA + ++  G PP+++     +   I        +L   + +   ++++ +L+KD+ KRL +
Sbjct:   78 KVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRA--RFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGL------CKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHK---PLRLRTNISQSARHILEGLLQKDKTKRLGS 318          
BLAST of slc42a-1 vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 99.3673 bits (246), Expect = 1.268e-22
Identity = 78/260 (30.00%), Postives = 134/260 (51.54%), Query Frame = 1
Query: 2425 TSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLD--TLQK-KKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIE---YKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            ++ Q + + N   I  GS G V L  +  T R+ AVKK+  +  + R +  N         H  IV+ +G+    +  ++ ME+L+  TL     +   S   +    + +L+AL+FLH + +IHRDIK +++LL  +G +KLSDFG       V ED+ +     GT  + APE+++ + Y   VDIWSLG  ++++  G+PPY N      +  +   R++E    + P  +   + + +D+ L +D   R +A +LL
Sbjct:   22 STRQPENLGNFMKIGEGSTGIVCLATDKRTGRQVAVKKMDLKKQQRRELLFNEVVIMRDYPHPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQ---VTEDMPRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFN---EPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELL 275          
BLAST of slc42a-1 vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 101.679 bits (252), Expect = 2.640e-22
Identity = 82/268 (30.60%), Postives = 129/268 (48.13%), Query Frame = 1
Query: 2422 YTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKI-----PKQNIRARYIEANINDFKNLL--CHERIVKHFGAFHKKENHYIFMEYL------DTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            YT F++        I  G+ GTV+   E  T  + A+K++     PK+       E  IN+   +    H  IV +  ++   E  ++ MEYL      D + +    +   G +    ++ L+AL FLH   +IHRDIK +N+LL +DG +KL+DFG       +  +  K     GT  + APE++  + Y   VD+WSLG   I++  G+PPY N      + +I+T    E   PE +     + +   LE D  KR SA++LL
Sbjct:  226 YTKFEK--------IGQGASGTVYTAIEVATGHEVAIKQMNLSQQPKK-------ELIINEILVMRENKHPNIVNYVDSYLVGEELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDFGFCAT---ITPEQNKRSTMVGTPYWMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKDFLAQSLEMDVEKRSSARELL 472          
BLAST of slc42a-1 vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 97.4413 bits (241), Expect = 9.263e-22
Identity = 75/249 (30.12%), Postives = 130/249 (52.21%), Query Frame = 1
Query: 2464 IASGSYGTVF--LYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHER-IVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +  GSYG+VF  ++ ESG  +  A+K++P        I+  I+  +   C    +VK++G++ K  + +I MEY     +  L K + +  +  ++    K  L+ L +LH R  IHRDIK  N+LL+ +G+ KL+DFG++     + + + K     GT  + APE++    Y C  DIWSLG T +++  G+PPY ++     I +I T     ++ P    +   + +   L K+  +R +A +LL
Sbjct:   30 LGEGSYGSVFKAMHKESG--QVVAIKQVPVDTDLQEIIK-EISMMQQ--CDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQ---LTDTMAKRNTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELL 270          
BLAST of slc42a-1 vs. Ensembl Medaka
Match: pak2b (p21 (RAC1) activated kinase 2 [Source:NCBI gene;Acc:101167280])

HSP 1 Score: 103.605 bits (257), Expect = 8.313e-23
Identity = 80/253 (31.62%), Postives = 124/253 (49.01%), Query Frame = 1
Query: 2437 RKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFA---KQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +KK    + I  G+ GTVF   +  T ++ A+K+I  Q    + +  N       L +  IV    +F   +  ++ MEYL          ++  D    A   ++ L+AL FLH   +IHRDIK +NVLL +DG++KL+DFG       +  +  K     GT  + APE++  + Y   VDIWSLG   I++  G+PPY N      + +I+T    E + PE +     + ++  LE D  KR   K+LL
Sbjct:  145 KKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSFLMGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQ---ITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFRDFLNRCLEMDVEKRGGGKELL 394          
BLAST of slc42a-1 vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 105.531 bits (262), Expect = 8.817e-23
Identity = 87/259 (33.59%), Postives = 136/259 (52.51%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAFHK--KENHYIFMEYLDTLQKKKYQKKSPGDLL-----LFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEK---DQYKRLSAKKLL 3186
            K +  G++G V+L  ++ T R+ AVK++      P+ +     +E  I   KNL CHERIV+++G      +    IFME++     K  Q KS G L       + +QILE +S+LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ E Y    DIWS+G T++++ T +PP+      A I  I+T    +   PE +P ++S+     L +   +  +R SA +LL
Sbjct:  393 KLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVSALECEIQLLKNL-CHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKD-QLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIAT----QPTNPE-LPVHVSDHCREFLRRIFVETKQRPSADELL 644          
BLAST of slc42a-1 vs. Ensembl Medaka
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:NCBI gene;Acc:101156777])

HSP 1 Score: 106.686 bits (265), Expect = 9.566e-23
Identity = 73/260 (28.08%), Postives = 121/260 (46.54%), Query Frame = 1
Query: 2431 FQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIR-ARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY-----LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILN--AELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +   +  +R  +  G+YG V+   +     + A+K+IP+++ R ++ +   I      L H  IV++ G+  +     IFME      L  L + K+       ++ + +QILE L +LHE  I+HRDIK +NVL++    +       +    +      +     GT  Y APEI++     Y    DIWSLG T+I++ TG+PP+H LG+           +I  ++PE +     + I    E D  KR     LL
Sbjct:  613 YDTNETGDRVVLGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIA-LHKYLKHRNIVQYLGSISENGFIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGLRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTET--FTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGKPPFHELGEPQAAMFKVGMFKIHPEIPESLSLEAKSFILRCFEPDPNKRPITTDLL 869          
BLAST of slc42a-1 vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 103.219 bits (256), Expect = 1.747e-22
Identity = 80/253 (31.62%), Postives = 125/253 (49.41%), Query Frame = 1
Query: 2437 RKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFA---KQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            +KK    + I  G+ GTV+   +  T ++ A+K+I  Q    + +  N       L +  IV    +F   +  ++ MEYL          ++  D    A   +++L+AL FLH   +IHRDIK +NVLL +DG++KL+DFG       +  +  K     GT  + APE++  + Y   VDIWSLG   I++  G+PPY N      + +I+T    E + PE +     + +   LE D  KR S K+LL
Sbjct:  199 KKKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQ---ITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELL 448          
BLAST of slc42a-1 vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 104.375 bits (259), Expect = 1.881e-22
Identity = 83/255 (32.55%), Postives = 130/255 (50.98%), Query Frame = 1
Query: 2458 KCIASGSYGTVFLYNESGTDRKFAVKKI------PKQNIRARYIEANINDFKNLLCHERIVKHFGAF--HKKENHYIFMEYLDTL----QKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 3186
            K +  G++G V+L  +  T R+ A K++      P+ +     +E  I   KNL  HERIV+++G    H ++   IFMEY+       Q K Y   +      + +QILE +S+LH   I+HRDIK  N+L D  GN+KL DFG S  L ++           GT  + +PE+++ E Y    D+WSLG T++++ T +PP+      A I  I+ T+     LP +      + I H +  +   R SA++LL
Sbjct:  357 KLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVSALECEIQLLKNL-HHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIA-TQPTNPLLPSHTSDQARDFI-HCIFVEAKHRPSAEELL 608          
BLAST of slc42a-1 vs. Planmine SMEST
Match: SMESG000048378.1 (SMESG000048378.1)

HSP 1 Score: 1702.95 bits (4409), Expect = 0.000e+0
Identity = 909/990 (91.82%), Postives = 910/990 (91.92%), Query Frame = 1
Query:  472 MQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVXXXXXXXXXXXXXXXXFRLAADKQXXXXXXXXXXXXEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNXXXXXXXXXXXATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYA---------------------------------------QSMSDEEEDN---------------------------------------RRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMVDSHL 3207
            MQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNIKEEIQKQIKIATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYA                                        SM+DEEE N                                       RRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMVDSHL
Sbjct:    1 MQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNIKEEIQKQIKIATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYAYAMSDEEEYNRITSDRNYSKWPESACYADDYRDNIQLYAHSMTDEEEYNRRTSDLVHLVKAESKSYADDYRDNTQFYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMVDSHL 990          
BLAST of slc42a-1 vs. Planmine SMEST
Match: SMESG000048378.1 (SMESG000048378.1)

HSP 1 Score: 1699.49 bits (4400), Expect = 0.000e+0
Identity = 913/1013 (90.13%), Postives = 914/1013 (90.23%), Query Frame = 1
Query:  373 MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVXXXXXXXXXXXXXXXXFRLAADKQXXXXXXXXXXXXEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNXXXXXXXXXXXATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYA---------------------------------------QSMSDEEEDN---------------------------------------RRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQI-------------------IREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYI 3120
            MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNIKEEIQKQIKIATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYA                                        SM+DEEE N                                       RRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQI                   IREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYI
Sbjct:    1 MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNIKEEIQKQIKIATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYAYAMSDEEEYNRITSDRNYSKWPESACYADDYRDNIQLYAHSMTDEEEYNRRTSDLVHLVKAESKSYADDYRDNTQFYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIVSVRFNAMTIFNYNGKTQKIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYI 1013          
BLAST of slc42a-1 vs. Planmine SMEST
Match: SMESG000048378.1 (SMESG000048378.1)

HSP 1 Score: 1292.72 bits (3344), Expect = 0.000e+0
Identity = 694/939 (73.91%), Postives = 758/939 (80.72%), Query Frame = 1
Query:  370 RMRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIK-LRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILE-DKKSLSDYRIVNHSLIYI-----NIQPIDIFVKAKTGRKEKIPVXXXXXXXXXXXXXXXXFRLAADKQXXXXXXXXXXXXEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNXXXXXXXXXXXATNKGGLAN-------YYERILWDKL--------LVVMISDVLKICMMSQRDNTQFYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYI 3120
            ++RIF K  +       V+ + +I+++K +I + + +    Q L   + +L D+K++ DY IV+ S+I I I+ + IFVKA  G      V  +++I  LKL+IEK   +    Q+L I   IL  D++++ D RI    +I I      I  I I    + G +  I V  T+++ ++K +I+K  ++A +K  L                 RI    ++ ++      D +KI  M++  N +  +  +++E    +    +           A+        Y   + D+         LV ++    K      RDNTQFYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYI
Sbjct:   72 KLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNIKEEIQKQIKIATNKGGLANYY------------ERILWDKLLVVMIS----DVLKICMMSQRDNTQFYAYAMSDEEEYNRITSDRNYSKWPESACYADDYRDNIQLYAHSMTDEEEYNRRTSDLVHLVKAESKSYADDYRDNTQFYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAGGISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYI 994          

HSP 2 Score: 547.74 bits (1410), Expect = 1.671e-173
Identity = 329/363 (90.63%), Postives = 336/363 (92.56%), Query Frame = 1
Query:  373 MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVXXXXXXXXXXXXXXXXFRLAADKQXXXXXXXXXXXXEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNXXXXXXXXXXXATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHVKLFVRRNKQIFHI 1461
            MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNIKEEIQKQIKIATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYA +MSDEEE NR TSD N     ESA YADDYR  I +   +   E  + + RR   + H+
Sbjct:    1 MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFVKAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEETIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNIKEEIQKQIKIATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQFYAYAMSDEEEYNRITSDRNYSKWPESACYADDYRDNIQLYAHSMTDE--EEYNRRTSDLVHL 361          
BLAST of slc42a-1 vs. Planmine SMEST
Match: SMESG000048173.1 (SMESG000048173.1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 303/508 (59.65%), Postives = 382/508 (75.20%), Query Frame = 1
Query: 1693 DSRVFPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLD--TLQKK-KYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMVDSHL 3207
            + RVF +   E +I  +K +IQ     +   QKLIIHN Q K+ QL+Y++ + +R  +++YS  +KF  LI+AIK GSI +VK+Y+     EIK GSYSRSP+LYACK+GHR IV+YFI +KC +DS DCE R ALHYAVIS NNDIVKLLI+ GA IN PDSL M P+HLACK NNIEAA+LL+E+NCDM  LD+LKRSPL+IAETG FEN+I LIKE Q+IREIAAEMQLKC   C+H FCYTS   K     K I SGS+G V+L  +S + RKFAVKK  +++ +++YIEANIN+FK  L HERI+K+FGA++K+  H IFME++D  +L++K K + + P D++ + KQ+LEALSF+HERSIIHRDIKP+NVLLD+ GNLKL+DFG SLLL+SVA +IQK G  CGT CY APEI+N ELY+CSVDIWSLGAT+I+LCT + PY  L     +  I TTR I+YKLP  MP Y++NLID ML+ DQ  R SA  LL +V S L
Sbjct:  455 ERRVFRYRAGEFNIADIKLQIQLVRKLNKGDQKLIIHNKQRKEGQLLYQYSVLERSVFKKYSIMKKFCLLIEAIKKGSINNVKEYFKSYQSEIKHGSYSRSPLLYACKFGHRDIVEYFIDKKCKLDSSDCELRSALHYAVISKNNDIVKLLIDKGADINAPDSLQMAPLHLACKANNIEAARLLIESNCDMNGLDRLKRSPLKIAETGGFENVINLIKEYQMIREIAAEMQLKCMATCDHNFCYTSVLNKTFVMNKDIDSGSFGIVYLCTDSVSKRKFAVKKNIRKSEKSKYIEANINEFKEKLHHERILKYFGAYYKQFEHLIFMEFIDGGSLERKIKDKTQPPYDVISYTKQLLEALSFIHERSIIHRDIKPQNVLLDLTGNLKLADFGWSLLLTSVANEIQKTGTLCGTLCYMAPEIMNGELYSCSVDIWSLGATVIELCTRKQPYSTLPPFVAMNKIMTTRRIDYKLPPNMPPYMNNLIDKMLDPDQSHRASAAVLLDIVKSCL 962          

HSP 2 Score: 122.094 bits (305), Expect = 9.404e-28
Identity = 81/175 (46.29%), Postives = 113/175 (64.57%), Query Frame = 1
Query:  418 HVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIKLR----IFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQP-IDIFVKAKTGRKEKIPVXXXXXXXXXXXXXXXXFRLAADK 927
            +V    +I  +K KI +   L+   Q LY Q  +L DEKT+ DY I + SIINI+ +LR    IFVKAPN +IFAF  E  ++I+HLK +IEK +G+K++ QILS  +EIL+DKK+L  Y IV+ SLI I+I+P + I+V+   G  E I V K D I D+   I++  RL AD+
Sbjct:   24 NVNNEMQIKDLKMKIEQHTGLIADGQALYCQGEILEDEKTLSDYMITNHSIINIIARLRGGMRIFVKAPNENIFAFTAESDDKIYHLKSKIEKLLGIKMRNQILSHENEILQDKKTLEQYGIVDKSLINIDIEPGMQIYVRQMDGTTELITVGKADTIRDINFIIQQKIRLTADE 198          

HSP 3 Score: 70.0922 bits (170), Expect = 1.039e-11
Identity = 45/110 (40.91%), Postives = 66/110 (60.00%), Query Frame = 1
Query:  373 MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIK-LRIFVKAPNGH-IFAFLVEPSNEIHHLKLRIEKAIGV 696
            M+IF K  D K V   V K+ KI+ IK+KI EK+ L   EQ L YQ  +L DE+ +  Y I D S+IN+ IK ++I+V   N +    F V+ +++I  LKL+I +  G+
Sbjct:  233 MQIFVKTMDGKTVAFEVLKSEKISDIKKKIQEKIGLAADEQKLIYQGGILEDERVVGHYGIADGSVINVAIKEIKIYVIGSNQNKPVLFSVDNTDKIGSLKLKILEKFGL 342          

HSP 4 Score: 68.5514 bits (166), Expect = 2.624e-11
Identity = 64/189 (33.86%), Postives = 104/189 (55.03%), Query Frame = 1
Query:  373 MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVLMDEKTIEDYEIVDKSIINIVIK--LRIFVKAPNGHIFAFLVEPSNEIHHLKLRIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLI-YINIQPIDIFVKAKTGRKEKIPVXXXXXXXXXXXXXXXXFRLAADKQ 930
            MRIF K  +E       +   KI ++K KI + + +    Q L ++N +L D+KT+E Y IVDKS+INI I+  ++I+V+  +G      V  ++ I  +   I++ I +      L      L+D++S+  Y I   S+I ++ I  + IFVK   G+     VLK++KI D+K KI++   LAAD+Q
Sbjct:   85 MRIFVKAPNENIFAFTAESDDKIYHLKSKIEKLLGIKMRNQILSHENEILQDKKTLEQYGIVDKSLINIDIEPGMQIYVRQMDGTTELITVGKADTIRDINFIIQQKIRLTADEFKLYYKGLRLKDERSVGHYGIAEKSVINFVAIGGMQIFVKTMDGKTVAFEVLKSEKISDIKKKIQEKIGLAADEQ 273          
BLAST of slc42a-1 vs. Planmine SMEST
Match: SMESG000048268.1 (SMESG000048268.1)

HSP 1 Score: 528.48 bits (1360), Expect = 5.086e-176
Identity = 280/498 (56.22%), Postives = 355/498 (71.29%), Query Frame = 1
Query: 1705 FPWDTDECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYL-DTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNXXXXXXXXXXXXXXVAEDIQKEGRCCGTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMV 3195
            F    DE +I  +KQ+IQQ +  D   +KL+IH+ Q +  QL Y + + +R  + +YS  +K   LIKA+K GS+ +VK+Y+     EIK GSYSRSP+LYACK+GHR IV+YFI +KC +DS+DCE R ALHYAVIS N  I++LLI+ GA IN PDSL M P+HLACK NNIEA +LLMENNC +  LD+L R PLQIAE   F++++ LIKE Q+IR++A  M+LKCG+ C HKFCY S  RKK +  K +  G+YG ++   ES T R FAVK+I K   +A+YIE NINDF +LL HERIVK+FGA  K E H+IFMEYL D    KK Q  S   ++L+ KQILEAL FL E +I+HRDIKP+N+LLD++GNLKLSDFG SLLLSS+ + + K G  CGT  Y APEILN E YT S+DIWSLG T+I+LCTG+PPY +LG G  +T + TTR+I YK PE  P YI +LID MLE DQ KR +   LL  +
Sbjct:   21 FQCKVDESNIANIKQKIQQEMQLDNGTKKLVIHSKQWRGGQLAYRYSVLERSVFMKYSNIKKLCLLIKAVKIGSLNNVKEYFKSYKSEIKHGSYSRSPLLYACKFGHRDIVEYFIDEKCKLDSYDCELRSALHYAVISKNKAIIELLIDKGADINAPDSLQMAPLHLACKANNIEAVRLLMENNCFVNALDRLFRLPLQIAEADGFKDVVNLIKEYQMIRKVANAMELKCGQDCIHKFCYKSLHRKKFQKGKIVDIGAYGEIYPCTESLTGRIFAVKRILKTPDQAKYIELNINDFLDLLSHERIVKYFGAILKNEKHFIFMEYLKDGSLAKKLQMLSSDKVILYTKQILEALEFLREGNIVHRDIKPQNILLDVNGNLKLSDFGWSLLLSSLTDVVPKTGTFCGTSFYIAPEILNYEPYTFSIDIWSLGVTVIELCTGKPPYQDLGPGRAMTEVLTTRKIVYKFPENWPTYIKDLIDLMLEPDQSKRATPVFLLNTI 518          
The following BLAST results are available for this feature:
BLAST of slc42a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK11.182e-2231.15p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
MAP3K152.267e-2229.92mitogen-activated protein kinase kinase kinase 15 ... [more]
PAK13.039e-2230.94p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
MAP3K23.299e-2232.16mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K23.299e-2232.16mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of slc42a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmk-11.146e-2130.57Calcium/calmodulin-dependent protein kinase type 1... [more]
air-11.853e-2127.53Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
air-11.853e-2127.53Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
max-29.808e-2130.04Serine/threonine-protein kinase max-2 [Source:Uni... [more]
pak-11.399e-2030.31Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
back to top
BLAST of slc42a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurA8.308e-2128.06gene:FBgn0000147 transcript:FBtr0082483[more]
mbt1.883e-2029.62gene:FBgn0025743 transcript:FBtr0074285[more]
Ask12.293e-2028.19gene:FBgn0014006 transcript:FBtr0083819[more]
Ask12.406e-2028.19gene:FBgn0014006 transcript:FBtr0300256[more]
Pak4.529e-2030.86gene:FBgn0267698 transcript:FBtr0334539[more]
back to top
BLAST of slc42a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k33.868e-2432.16mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k35.288e-2432.16mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k36.579e-2432.16mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k151.961e-2328.85mitogen-activated protein kinase kinase kinase 15 ... [more]
map3k152.005e-2328.85mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top
BLAST of slc42a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qsox25.926e-2328.52quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
taf37.375e-2332.41TATA-box binding protein associated factor 3 [Sour... [more]
MAP3K151.691e-2228.97mitogen-activated protein kinase kinase kinase 5 [... [more]
MAP3K152.003e-2229.25mitogen-activated protein kinase kinase kinase 5 [... [more]
MAP3K152.058e-2229.25mitogen-activated protein kinase kinase kinase 5 [... [more]
back to top
BLAST of slc42a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k151.324e-2331.10mitogen-activated protein kinase kinase kinase 15 ... [more]
Pnck1.866e-2228.24pregnancy upregulated non-ubiquitously expressed C... [more]
Pnck1.866e-2228.24pregnancy upregulated non-ubiquitously expressed C... [more]
Pnck1.866e-2228.24pregnancy upregulated non-ubiquitously expressed C... [more]
Map3k22.285e-2232.16mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of slc42a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O59790|ARK1_SCHPO1.340e-2529.64Serine/threonine-protein kinase ark1 OS=Schizosacc... [more]
sp|P28178|PK2_DICDI1.065e-2332.11Protein kinase 2 OS=Dictyostelium discoideum OX=44... [more]
sp|Q6C3J2|IPL1_YARLI3.721e-2331.76Spindle assembly checkpoint kinase OS=Yarrowia lip... [more]
sp|A2AQW0|M3K15_MOUSE9.260e-2331.10Mitogen-activated protein kinase kinase kinase 15 ... [more]
sp|P27636|CDC15_YEAST2.479e-2234.39Cell division control protein 15 OS=Saccharomyces ... [more]
back to top
BLAST of slc42a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG20.000e+0100.00Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
I7M1N11.000e-2826.81Serine/Threonine kinase domain protein OS=Tetrahym... [more]
A0A0V0QM092.474e-2827.54Protein kinase-like domain OS=Pseudocohnilembus pe... [more]
A0A210PFZ58.778e-2834.66Mitogen-activated protein kinase kinase kinase 2 O... [more]
T1EDA59.519e-2833.46Protein kinase domain-containing protein OS=Helobd... [more]
back to top
BLAST of slc42a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k153.164e-2328.85mitogen-activated protein kinase kinase kinase 15 ... [more]
pak2b6.456e-2332.02p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
map3k31.770e-2231.76mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.770e-2231.76mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.770e-2231.76mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of slc42a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k29.747e-2532.33mitogen-activated protein kinase kinase kinase 2 [... [more]
pdpk1b1.067e-2030.123-phosphoinositide dependent protein kinase 1b [So... [more]
PRKCD8.263e-2030.04protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD1.077e-1932.64protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
snrka9.069e-1926.77SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of slc42a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC153.570e-2434.39Protein kinase of the Mitotic Exit Network; locali... [more]
TPK35.402e-2228.16cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK27.839e-2226.51cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK12.897e-2127.24cAMP-dependent protein kinase catalytic subunit; p... [more]
STE111.869e-2028.76Signal transducing MEK kinase; involved in pheromo... [more]
back to top
BLAST of slc42a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414105.118e-2531.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378006.234e-2331.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458461.268e-2230.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336672.640e-2230.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428459.263e-2230.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc42a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2b8.313e-2331.62p21 (RAC1) activated kinase 2 [Source:NCBI gene;Ac... [more]
map3k28.817e-2333.59mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k159.566e-2328.08mitogen-activated protein kinase kinase kinase 15 ... [more]
ENSORLT00000015480.21.747e-2231.62serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
map3k31.881e-2232.55mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of slc42a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048378.10.000e+091.82SMESG000048378.1[more]
SMESG000048378.10.000e+090.13SMESG000048378.1[more]
SMESG000048378.11.671e-17373.91SMESG000048378.1[more]
SMESG000048173.19.404e-2859.65SMESG000048173.1[more]
SMESG000048268.15.086e-17656.22SMESG000048268.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30023411
GenBankAKN21681.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023411 ID=SMED30023411|Name=slc42a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3531bp
ATCGAATTCACATTTAAAAGGCAATTTCAATACTAAGATCTTAAGACAAG
TAATCAACTGTTGGTGACCTTCAATCACTCGTCAGGTAATCATATTAATC
TACAAACTAATTCTACATATGATTAGCTATAGAGTTTAATTCTGCATATC
AGAGGTTTCGCCTGGAGTGTCGCAAACTGATTCTAAATATTGACAAGGAA
ATGTCATAGTCAACTTACATGGATAGACACTGCTAAGGGTATCCTGTACA
CCAGTATGGTTAGCATTTCCGGTAATAGAAGCATCAATTCTGGAGTCATA
ATCACTGAAGATAACTAAAAGAATAAATACAAAAGCCTGGAGAAGTGAAG
CTGTAATGACAAAAGTGAAAGAATGAGAATATTTGCCAAAATTGGGGATG
AAAAATGTGTGACAATTCACGTGCAAAAGACTTATAAAATTAACTACATA
AAGGAAAAAATTCATGAAAAAATGCAGCTGGTTCCAATAGAGCAATATTT
ATATTATCAAAATACAGTTTTGATGGATGAGAAAACAATTGAGGATTATG
AAATTGTTGATAAATCTATTATTAACATTGTTATTAAATTGAGAATATTT
GTTAAAGCGCCAAATGGACATATATTTGCATTCCTTGTTGAACCTAGCAA
TGAAATTCATCATTTGAAATTAAGAATAGAAAAAGCAATTGGTGTAAAAG
TAAAAATCCAAATTTTGTCAATTGGACATGAAATACTGGAGGATAAAAAG
TCATTAAGTGACTACCGGATCGTGAACCATTCGTTAATCTATATCAATAT
TCAACCAATCGACATATTTGTTAAAGCAAAAACTGGTAGAAAAGAAAAAA
TTCCAGTACTAAAAACAGATAAAATTATTGATCTAAAATTAAAGATCGAA
AAGATATTCAGACTAGCTGCGGATAAACAGTTATTGATAATAAACGATTT
GATATTGTGGTTAGATGAGGAGACGATTGAAGATTCGAGAATAAACGAGG
GAGATGTAATCAAAATTATTACTGATTGGAAATTTATAGATGCAATCAAA
ATTTTGACAATGACGAGAGAAGGAAATCAGCGGATAATTAGCGTAAAAAT
AACGAATGAAATGAGCAATATAAAAGAGGAAATCCAGAAACAGATCAAAA
TAGCTACAAATAAGGGAGGATTAGCTAATTATTACGAGAGGATATTGTGG
GATAAATTGCTTGTTGTTATGATATCTGACGTGCTGAAGATCTGCATGAT
GTCACAGCGAGATAATACTCAGTTTTATGCCCAATCAATGAGTGATGAAG
AAGAAGACAATAGACGAACAAGTGACCTCAATGATTTAGTGGAGCTTGAG
TCTGCAGGCTATGCTGATGACTATCGGAAAATGATCACAATCAATGTTGC
CAATAGTGATGGGGAACATGTCAAACTGTTTGTCAGGAGAAATAAGCAAA
TATTCCATATCAAAATGCAGATTTACGAGAAATGTAATCTCCATCCATTC
AAACAAATCCTATATGTGGGCAGCAAGCTGCTGGAGGACGAGGAAACCAT
TGGTGAATACCTGTCAGCTGGTGGGATATCCGTTCTCTTGCTTTCCATTG
CATTGCATACCTTGTCCTGGATTGGATTGTCTGATATATTCGGATGGAGT
CCGCAACGGGAGAATTCTGTGAATGTTAATGTCAAATCGAGAGATTCTCG
CGTATTCCCATGGGATACTGATGAATGCGATATCACGTGTGTCAAACAGA
GGATTCAGCAAAGAATATTGTTTGATGGCCAACTTCAGAAATTAATTATC
CACAATTCCCAGTTGAAAGACGACCAATTGGTATATGAGTTCTTCATTTT
CGACAGATTAGAATATGAAAGATATTCAGAATTCGAAAAGTTTGGTCAGC
TTATCAAAGCTATAAAAGATGGATCCATTGAGGATGTGAAGAAATATTAT
AGCCGTCGGATTCTTGAAATTAAACTTGGATCATATTCCCGCTCGCCAAT
TCTTTATGCATGTAAATATGGTCACAGAAAAATCGTTAAATATTTCATAA
AACAGAAATGCAATGTGGATTCATTTGATTGCGAATTCCGTAGAGCTCTC
CATTATGCAGTTATCAGTAATAATAATGACATTGTTAAGTTATTGATAGA
GAGCGGTGCTGCTATCAACGTTCCAGATTCGCTGCTGATGATGCCTATTC
ATTTGGCTTGCAAAGTGAATAATATTGAGGCAGCTCAGCTGCTCATGGAG
AATAATTGCGATATGGTTACATTAGATAAGTTGAAGCGGTCCCCATTACA
GATTGCTGAAACTGGTGATTTTGAAAATATGATTAAGTTGATAAAGGAGT
GCCAAATAATCCGTGAAATAGCTGCCGAAATGCAATTGAAATGTGGGAAA
TTATGTAACCATAAATTCTGTTATACTTCATTCCAACGTAAAAAAATTAA
GAATCGCAAATGTATTGCAAGTGGAAGTTATGGCACAGTTTTTCTCTACA
ATGAATCAGGTACTGATAGAAAATTTGCCGTTAAAAAGATACCGAAACAA
AACATTAGAGCCAGATACATCGAAGCTAACATCAATGACTTCAAAAATCT
GTTGTGTCATGAAAGGATTGTTAAACATTTTGGTGCATTCCATAAAAAAG
AAAATCATTATATTTTCATGGAATACCTTGATACGCTTCAGAAAAAAAAA
TACCAAAAGAAATCTCCTGGTGATTTACTCTTATTCGCCAAGCAAATACT
GGAGGCGCTTTCGTTTCTACACGAACGTAGCATCATCCACCGGGATATTA
AACCGGAAAATGTTCTGCTTGATATCGATGGAAATCTTAAACTGTCTGAT
TTCGGCTTGAGTTTATTATTATCATCAGTGGCTGAAGATATTCAGAAAGA
AGGAAGATGTTGTGGAACATATTGTTATGCAGCTCCAGAAATATTGAATG
CTGAACTGTATACATGTTCCGTTGACATTTGGTCCCTTGGGGCCACCATG
ATTCAGTTATGCACAGGTCAACCACCTTATCACAATTTAGGGGATGGAGC
TATCATAACGGTGATTTCAACAACACGAGAAATAGAATATAAACTACCAG
AATATATGCCAAAGTATATAAGTAATCTAATTGACCATATGCTTGAAAAA
GACCAATACAAACGTCTGAGTGCCAAGAAGTTATTGGGAATGGTGGATTC
GCATTTGTGAAATGCAGATAATTTTGCTACCCTTCTCATTCATATATGGT
TACTTTATCTACTCTATAAATGTTACGATCAATTTAATAATTGTTGCAAT
CTTTTCAAAAGTTACCGCTTATGAAGTTTCCTAGTTTGTGCACATTTAAT
GCATTTTTTTAATACTCCAAATCGAATACATTCTGGTGGTAAATGTTTAA
TATTTATGGGCTTGAAGCCACATTAATTAAAATTAATTAATTAATTCTAT
CAAAATTGTCTGTGGTTTCTATGTAGTGTTAGCTGTTCTAACATTATTTG
CAGTTGCTTGAGCTCAAATATGTAATTTTTG
back to top

protein sequence of SMED30023411-orf-1

>SMED30023411-orf-1 ID=SMED30023411-orf-1|Name=SMED30023411-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=946bp
MRIFAKIGDEKCVTIHVQKTYKINYIKEKIHEKMQLVPIEQYLYYQNTVL
MDEKTIEDYEIVDKSIINIVIKLRIFVKAPNGHIFAFLVEPSNEIHHLKL
RIEKAIGVKVKIQILSIGHEILEDKKSLSDYRIVNHSLIYINIQPIDIFV
KAKTGRKEKIPVLKTDKIIDLKLKIEKIFRLAADKQLLIINDLILWLDEE
TIEDSRINEGDVIKIITDWKFIDAIKILTMTREGNQRIISVKITNEMSNI
KEEIQKQIKIATNKGGLANYYERILWDKLLVVMISDVLKICMMSQRDNTQ
FYAQSMSDEEEDNRRTSDLNDLVELESAGYADDYRKMITINVANSDGEHV
KLFVRRNKQIFHIKMQIYEKCNLHPFKQILYVGSKLLEDEETIGEYLSAG
GISVLLLSIALHTLSWIGLSDIFGWSPQRENSVNVNVKSRDSRVFPWDTD
ECDITCVKQRIQQRILFDGQLQKLIIHNSQLKDDQLVYEFFIFDRLEYER
YSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYG
HRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINV
PDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDF
ENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIAS
GSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIV
KHFGAFHKKENHYIFMEYLDTLQKKKYQKKSPGDLLLFAKQILEALSFLH
ERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCCGTY
CYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVIST
TREIEYKLPEYMPKYISNLIDHMLEKDQYKRLSAKKLLGMVDSHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR019956Ubiquitin_dom
IPR002110Ankyrin_rpt
IPR000626Ubiquitin-like_dom
IPR000719Prot_kinase_dom
IPR020683Ankyrin_rpt-contain_dom
IPR008271Ser/Thr_kinase_AS
IPR029071Ubiquitin-like_domsf
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019956Ubiquitin domainPRINTSPR00348UBIQUITINcoord: 11..31
score: 32.3
coord: 32..52
score: 28.05
coord: 53..74
score: 35.87
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 692..945
e-value: 3.6E-61
score: 219.2
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 696..938
e-value: 2.4E-53
score: 181.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 692..945
score: 40.485
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 604..633
e-value: 57.0
score: 12.6
coord: 571..600
e-value: 5.7E-4
score: 29.2
coord: 538..567
e-value: 0.0043
score: 26.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 571..603
score: 12.129
IPR000626Ubiquitin-like domainSMARTSM00213ubq_7coord: 1..72
e-value: 8.5E-7
score: 38.6
coord: 338..409
e-value: 7.4E-8
score: 42.1
coord: 73..144
e-value: 0.0013
score: 28.1
coord: 146..218
e-value: 0.33
score: 19.6
IPR000626Ubiquitin-like domainPFAMPF00240ubiquitincoord: 9..74
e-value: 6.7E-10
score: 38.6
coord: 340..405
e-value: 5.6E-7
score: 29.2
coord: 75..143
e-value: 3.3E-8
score: 33.2
coord: 148..215
e-value: 5.0E-7
score: 29.4
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 73..144
score: 13.729
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 1..74
score: 13.772
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 146..216
score: 9.7
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 338..407
score: 10.898
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 74..143
e-value: 1.2E-12
score: 49.5
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 670..941
e-value: 4.3E-65
score: 221.5
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 144..219
e-value: 5.5E-8
score: 34.5
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 327..407
e-value: 2.4E-8
score: 35.7
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..73
e-value: 2.5E-13
score: 51.4
NoneNo IPR availablePANTHERPTHR24351:SF191coord: 501..936
NoneNo IPR availablePANTHERPTHR24351RIBOSOMAL PROTEIN S6 KINASEcoord: 501..936
NoneNo IPR availableCDDcd17039Ubl_ubiquitin_likecoord: 3..70
e-value: 6.42078E-10
score: 54.1394
NoneNo IPR availableCDDcd17039Ubl_ubiquitin_likecoord: 148..216
e-value: 6.39626E-7
score: 45.665
NoneNo IPR availableCDDcd17039Ubl_ubiquitin_likecoord: 340..396
e-value: 1.57617E-4
score: 38.7314
NoneNo IPR availableCDDcd17039Ubl_ubiquitin_likecoord: 75..141
e-value: 1.75483E-8
score: 49.9022
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 533..602
e-value: 3.4E-12
score: 46.8
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 538..657
score: 27.345
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 506..665
e-value: 9.1E-31
score: 108.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 510..659
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 804..816
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 688..939
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 1..74
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 74..143
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 312..396
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 144..217