Glutamate-rich 3

Overview
NameGlutamate-rich 3
Smed IDSMED30023409
Length (bp)4109
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate-rich 3 (SMED30023409) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate-rich 3 (SMED30023409) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate-rich 3 (SMED30023409) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate-rich 3 (SMED30023409) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023409

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v6_8627_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
head regionSMED30023409SMESG000029848.1 SMESG000029846.1 SmedASXL_008913SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30023409SMESG000029848.1 SMESG000029846.1 dd_Smed_v4_8627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023409SMESG000029848.1 SMESG000029846.1 Contig48978uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023409SMESG000029848.1 SMESG000029846.1 Contig48978newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate-rich 3 vs. Ensembl Human
Match: ERICH3 (glutamate rich 3 [Source:HGNC Symbol;Acc:HGNC:25346])

HSP 1 Score: 115.161 bits (287), Expect = 1.049e-25
Identity = 52/134 (38.81%), Postives = 81/134 (60.45%), Query Frame = 2
Query: 1028 LITKTGRS-NQSKVQSMTKLSILF-----HAPTQNRDF--DIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDL 1405
            L+TK  R  +++ + S   +++++     H  + N DF  +I V QQ  GG  L +Y+  L     F  +S RH GFPFSLTF++N ++ +R+S+CCEYKH+ G R+GG  G+F    VE ++PCY+C+    L
Sbjct:   73 LLTKDSRRIHKTSLHSNAAITMIYLGKNVHLSSDNPDFRDEIKVYQQHCGGENLCVYKGKLLEKETFQFISKRHHGFPFSLTFFLNGMQVNRLSSCCEYKHRKGSRLGGKRGYFGFVCVERSSPCYKCIIAMGL 206          
BLAST of Glutamate-rich 3 vs. Ensembl Human
Match: ERICH3 (glutamate rich 3 [Source:HGNC Symbol;Acc:HGNC:25346])

HSP 1 Score: 114.775 bits (286), Expect = 7.858e-25
Identity = 52/134 (38.81%), Postives = 81/134 (60.45%), Query Frame = 2
Query: 1028 LITKTGRS-NQSKVQSMTKLSILF-----HAPTQNRDF--DIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDL 1405
            L+TK  R  +++ + S   +++++     H  + N DF  +I V QQ  GG  L +Y+  L     F  +S RH GFPFSLTF++N ++ +R+S+CCEYKH+ G R+GG  G+F    VE ++PCY+C+    L
Sbjct:  270 LLTKDSRRIHKTSLHSNAAITMIYLGKNVHLSSDNPDFRDEIKVYQQHCGGENLCVYKGKLLEKETFQFISKRHHGFPFSLTFFLNGMQVNRLSSCCEYKHRKGSRLGGKRGYFGFVCVERSSPCYKCIIAMGL 403          

HSP 2 Score: 94.7449 bits (234), Expect = 1.026e-18
Identity = 48/115 (41.74%), Postives = 82/115 (71.30%), Query Frame = 2
Query:   80 GTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSP 424
            G L  YNSL D+HL  YF+N R+R HL+++GLIT++G ++ +  Y++ M +R+H++ +R+ +AQAI HK L+MER  Q++I+KK+E +A+ E ++R + + +R   E+ +   SP
Sbjct:    8 GLLAAYNSLMDKHLAGYFNNTRIRRHLLRSGLITRSGRILSEKEYKLNMMKRDHQKYIRECLAQAIFHKVLDMERYHQLEIKKKLETLARKERIQRFKGEHTRRSVENNMPILSP 122          
BLAST of Glutamate-rich 3 vs. Ensembl Zebrafish
Match: erich3 (glutamate-rich 3 [Source:ZFIN;Acc:ZDB-GENE-070209-295])

HSP 1 Score: 120.553 bits (301), Expect = 2.542e-27
Identity = 54/142 (38.03%), Postives = 83/142 (58.45%), Query Frame = 2
Query: 1031 ITKTGRSNQSKVQSMTKLSILFHAPTQNRDFDIM-------VEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKK 1435
            +T+     ++  QS   +S+++     +   D+M       V QQ  GG  L +Y+  LT   +F  VS RH+GFPFSLTF++N ++  R+S+CCE+KH+ G R+GG +GHF    VEGA+PCY+C+    L  +    QK+
Sbjct:  265 VTEPSSLQRTSAQSKVLVSMMYFGKGVHLSHDLMDLRDEVKVFQQHCGGENLCVYKGNLTEGEVFQFVSRRHQGFPFSLTFFLNGLQVDRLSSCCEFKHRKGSRLGGRHGHFGFCGVEGASPCYKCIIAMGLDKKPTPPQKR 406          

HSP 2 Score: 100.138 bits (248), Expect = 5.979e-21
Identity = 54/121 (44.63%), Postives = 83/121 (68.60%), Query Frame = 2
Query:   62 MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSP 424
            M   +   L  YNSLTD+HL  YF+N R+R HL K GLI+++G +VPD  Y+ K+ RR H+R VR+ +AQAI HK L+MER  Q +I++++EE A+ E + +++ DRS+  +++ +   SP
Sbjct:    1 MNHLNPSLLSAYNSLTDKHLSAYFNNARIRRHLQKVGLISRSGRIVPDKEYKHKLIRRAHQRHVRECLAQAIFHKVLDMERLHQNEIKRRLEEFARRERIHKLKADRSKRYEDEPVLMLSP 121          
BLAST of Glutamate-rich 3 vs. Ensembl Xenopus
Match: ENSXETT00000023936.1 (glutamate rich 3 [Source:NCBI gene;Acc:100127552])

HSP 1 Score: 124.02 bits (310), Expect = 4.214e-29
Identity = 52/108 (48.15%), Postives = 70/108 (64.81%), Query Frame = 2
Query: 1073 MTKLSILFHAPTQNRDF--DIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCL 1390
            M  L    H    + DF   I V QQ  GG  L +++  L     FN++S RH+GFPFSLTFYIN ++  R+S+CCEYKH+ G R+GG NG+F   ++EGA+PCYRC+
Sbjct:    1 MVYLGKNVHLSHDDNDFRDQIKVFQQHCGGENLCVFKGRLQEGETFNLISRRHRGFPFSLTFYINGMQVDRLSSCCEYKHRKGARLGGKNGYFGFVNIEGASPCYRCI 108          
BLAST of Glutamate-rich 3 vs. Ensembl Mouse
Match: Erich3 (glutamate rich 3 [Source:MGI Symbol;Acc:MGI:1919095])

HSP 1 Score: 108.612 bits (270), Expect = 7.956e-24
Identity = 48/116 (41.38%), Postives = 67/116 (57.76%), Query Frame = 2
Query: 1064 VQSMTKLSILFHAPTQNRDF--DIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDL 1405
            V +M       H    + DF  +I + QQ  GG  L +Y+  L     F  +S RH GFPFSLTF++N ++ +RIS+CCE+KH+   R+GG  G+F    VE A+PCYRC+    L
Sbjct:   92 VITMVYFGKNVHLSYDDIDFRDEIKIYQQHCGGENLCVYKGKLLEKDTFQFISKRHHGFPFSLTFFLNGIQVNRISSCCEFKHRRSTRLGGKRGYFGFVCVEKASPCYRCIIAMGL 207          
BLAST of Glutamate-rich 3 vs. Ensembl Mouse
Match: Erich3 (glutamate rich 3 [Source:MGI Symbol;Acc:MGI:1919095])

HSP 1 Score: 108.612 bits (270), Expect = 3.702e-23
Identity = 45/98 (45.92%), Postives = 62/98 (63.27%), Query Frame = 2
Query: 1118 DF--DIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDL 1405
            DF  +I + QQ  GG  L +Y+  L     F  +S RH GFPFSLTF++N ++ +RIS+CCE+KH+   R+GG  G+F    VE A+PCYRC+    L
Sbjct:  307 DFRDEIKIYQQHCGGENLCVYKGKLLEKDTFQFISKRHHGFPFSLTFFLNGIQVNRISSCCEFKHRRSTRLGGKRGYFGFVCVEKASPCYRCIIAMGL 404          

HSP 2 Score: 90.5077 bits (223), Expect = 1.343e-17
Identity = 45/115 (39.13%), Postives = 83/115 (72.17%), Query Frame = 2
Query:   80 GTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSP 424
            G L  YNSLTD+HL  YF+N R+R HL+++GLIT++G ++ +  Y+V   +++H++ +R+ +A+AI HK L+MER  Q++I++K++ +A+ E ++R++ + +R   ED +   +P
Sbjct:    8 GLLATYNSLTDKHLAGYFNNTRIRRHLLRSGLITRSGRILSEKEYKVNNMKQDHQKYIRECLARAIFHKVLDMERYHQLEIKRKLDTLARKERIQRLKGEHTRRFIEDNMPVLTP 122          
BLAST of Glutamate-rich 3 vs. UniProt/SwissProt
Match: sp|Q5RHP9|ERIC3_HUMAN (Glutamate-rich protein 3 OS=Homo sapiens OX=9606 GN=ERICH3 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.774e-24
Identity = 52/134 (38.81%), Postives = 81/134 (60.45%), Query Frame = 2
Query: 1028 LITKTGRS-NQSKVQSMTKLSILF-----HAPTQNRDF--DIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDL 1405
            L+TK  R  +++ + S   +++++     H  + N DF  +I V QQ  GG  L +Y+  L     F  +S RH GFPFSLTF++N ++ +R+S+CCEYKH+ G R+GG  G+F    VE ++PCY+C+    L
Sbjct:  270 LLTKDSRRIHKTSLHSNAAITMIYLGKNVHLSSDNPDFRDEIKVYQQHCGGENLCVYKGKLLEKETFQFISKRHHGFPFSLTFFLNGMQVNRLSSCCEYKHRKGSRLGGKRGYFGFVCVERSSPCYKCIIAMGL 403          

HSP 2 Score: 94.7449 bits (234), Expect = 4.927e-18
Identity = 48/115 (41.74%), Postives = 82/115 (71.30%), Query Frame = 2
Query:   80 GTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSP 424
            G L  YNSL D+HL  YF+N R+R HL+++GLIT++G ++ +  Y++ M +R+H++ +R+ +AQAI HK L+MER  Q++I+KK+E +A+ E ++R + + +R   E+ +   SP
Sbjct:    8 GLLAAYNSLMDKHLAGYFNNTRIRRHLLRSGLITRSGRILSEKEYKLNMMKRDHQKYIRECLAQAIFHKVLDMERYHQLEIKKKLETLARKERIQRFKGEHTRRSVENNMPILSP 122          
BLAST of Glutamate-rich 3 vs. TrEMBL
Match: A0A267H572 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002034g1 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.085e-34
Identity = 103/203 (50.74%), Postives = 133/203 (65.52%), Query Frame = 2
Query:   62 MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSPGNMDV---------PSKPGLDKKRSQSDIDEYK--LPATPDERSRMRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDR 637
            MA  + G L +YNSL D HL  YF+N     HLVK GLIT+TGEVVP+ VYR+KMAR+EH+R VRD++AQAIVHK+L++ER RQ+DIR+K+EEIAK+E VRR++ +R+R GDED +    PG             P++ G D +    D +     LP  PD   R RLRR  P  EI+SKHL  LDS+ L EY+ IL+   R
Sbjct:   26 MAKPETGPLAQYNSLKDEHLAGYFNNRAKWRHLVKAGLITRTGEVVPEPVYRLKMARKEHKRHVRDMLAQAIVHKSLDLERKRQVDIRRKLEEIAKMEHVRRIKNERNRRGDEDLMPLLDPGAATSSGIRRRKQRPNRIGGDAEEGDGDEEPEPSGLPPHPDTVQRRRLRRQFPRAEIDSKHLLTLDSVALQEYANILESMRR 228          

HSP 2 Score: 121.324 bits (303), Expect = 1.309e-23
Identity = 57/136 (41.91%), Postives = 79/136 (58.09%), Query Frame = 2
Query: 1055 QSKVQSMTKLSILFHAPTQNRDFD--------IMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKKG 1438
            Q+  QS+ K+++ ++ P      D        + V QQ SGGNTL ++   +     F  VS RH+G+PFSL+ YI+ V DSR+S CCEYKH+ G R+G   GHF   SV  A PCYRC  E+ L  E +G ++K 
Sbjct:  330 QASYQSLCKVTLHYYGPALKIPHDGPGHDGQEVTVMQQHSGGNTLRVFYGLVKPGEDFTFVSRRHRGYPFSLSLYIDGVMDSRVSACCEYKHRTGVRLGSKTGHFGFVSVSEAAPCYRCQVEEQL-KEGRGKKEKA 464          
BLAST of Glutamate-rich 3 vs. TrEMBL
Match: A0A267FT11 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011659g1 PE=4 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 2.808e-34
Identity = 107/220 (48.64%), Postives = 139/220 (63.18%), Query Frame = 2
Query:   11 MLLFEIFFNIKIYF*FLMAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSPGNMDV---------PSKPGLDKKRSQSDIDEYK--LPATPDERSRMRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDR 637
            +L F +F  I       MA  + G L +YNSL D HL  YF+N     HLVK GLIT+TGEVVP+ VYR+KMAR+EH+R VRD++AQAIVHK+L++ER RQ+DIR+K+EEIAK+E VRR++ +R+R GDED +    PG             P++ G D +    D +     LP  PD   R RLRR  P  EI+SKHL  LDS+ L EY+ IL+   R
Sbjct:   19 VLDFNLFDTID------MAKPETGPLAQYNSLKDEHLAGYFNNRAKWRHLVKAGLITRTGEVVPEPVYRLKMARKEHKRHVRDMLAQAIVHKSLDLERKRQVDIRRKLEEIAKMEHVRRIKNERNRRGDEDLMPLLDPGAATSSGIRRRKQRPNRIGGDAEEGDGDEEPEPSGLPPHPDTVQRRRLRRQFPRAEIDSKHLLTLDSVALQEYANILESMRR 232          

HSP 2 Score: 120.553 bits (301), Expect = 1.756e-23
Identity = 57/136 (41.91%), Postives = 79/136 (58.09%), Query Frame = 2
Query: 1055 QSKVQSMTKLSILFHAPTQNRDFD--------IMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKKG 1438
            Q+  QS+ K+++ ++ P      D        + V QQ SGGNTL ++   +     F  VS RH+G+PFSL+ YI+ V DSR+S CCEYKH+ G R+G   GHF   SV  A PCYRC  E+ L  E +G ++K 
Sbjct:  334 QASYQSLCKVTLHYYGPALKIPHDGPGHDGQEVTVMQQHSGGNTLRVFYGLVKPGEDFTFVSRRHRGYPFSLSLYIDGVMDSRVSACCEYKHRTGVRLGSKTGHFGFVSVSEAAPCYRCQVEEQL-KEGRGKKEKA 468          
BLAST of Glutamate-rich 3 vs. TrEMBL
Match: R7T5K7 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_170265 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 4.509e-30
Identity = 61/124 (49.19%), Postives = 82/124 (66.13%), Query Frame = 2
Query: 1052 NQSKVQSMTKLSILFHAPTQNRDFD-------IMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRC-LTEQ 1399
            +Q +VQ+M  + + F     N D++       IMVEQQ  GGNTLI++++ +   S F   S RH+G+PFSLTFY+N V D R+S CCE+KH+VG R+GG  GHF +  VEG  PCYRC L+EQ
Sbjct:  194 HQERVQTMCDVHMHFFGSNLNLDYEKFDPRDEIMVEQQHCGGNTLIVFKEKILPASDFCFTSRRHRGYPFSLTFYVNGVLDCRLSACCEFKHQVGSRLGGSKGHFGVLGVEGGVPCYRCQLSEQ 317          

HSP 2 Score: 117.472 bits (293), Expect = 1.080e-23
Identity = 64/105 (60.95%), Postives = 83/105 (79.05%), Query Frame = 2
Query:  110 DRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSP 424
            D HL  YFSN RMR HL K GL+T+ GE+V +  YR+ MAR+EH++ VRDL+AQAIVHK L+MER+RQ+ I++K+EEI+KIELVRRV+ +  R GDED + Y SP
Sbjct:    2 DPHLAGYFSNTRMRSHLSKVGLVTRRGEIVSENTYRMNMARKEHKKHVRDLMAQAIVHKTLDMERNRQVAIKQKLEEISKIELVRRVKAETGRRGDEDVLPYLSP 106          
BLAST of Glutamate-rich 3 vs. TrEMBL
Match: C3Z242 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_246950 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 7.054e-29
Identity = 55/120 (45.83%), Postives = 87/120 (72.50%), Query Frame = 2
Query: 1046 RSNQSKVQSMTKLSILF-----HAPTQNRDF--DIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYR 1384
            +++++++QSM ++++ +     H   +  D+  +IMVEQQ  GGNTL+++R+ L   + F+ +S RH+GFPFSLTFY+N ++D R+S CCEYKHK G+++G   GHF L ++EGA PCYR
Sbjct:  167 KAHRTQLQSMCEVTMRYVGKNIHLDVERFDYRDEIMVEQQHCGGNTLVVFRELLHEGTSFSFISRRHRGFPFSLTFYLNGLQDIRLSACCEYKHKKGRKLGSKLGHFELVNIEGAAPCYR 286          

HSP 2 Score: 123.25 bits (308), Expect = 5.503e-27
Identity = 68/113 (60.18%), Postives = 89/113 (78.76%), Query Frame = 2
Query:   86 LFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSP 424
            L  YNSL D HL  YF+N RMR HL K+GL+ + GE++ +  YR+ MARREH+R VR+L+AQAIVHK L+MER+RQ++I+KK+EEI+KIE V+R+R +R R GDED I Y SP
Sbjct:    7 LAAYNSLQDPHLTGYFNNTRMRKHLKKSGLVNRQGEIITEQTYRLNMARREHKRHVRELLAQAIVHKTLDMERARQVEIKKKLEEISKIERVQRIRTERGRHGDEDIIPYLSP 119          
BLAST of Glutamate-rich 3 vs. TrEMBL
Match: A0A2T7PG44 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07826 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.014e-28
Identity = 87/225 (38.67%), Postives = 132/225 (58.67%), Query Frame = 2
Query:   62 MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSPGNMDVPSKPGLDKKRSQSDIDEYKLPATPDERSRMRL------------------------RRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYL 664
            M+ FD G L  YNSLTD HL  +F+N R R HLVK+GL+++ G +V +A YR+ M+R+EH++ V+D++AQAIVHK L++ER+RQ +I+KK+EEIAKI+LV+RVR  R R GDE+ +   +       S P   K R +S   +Y+  + P  R   R                         R +  N+ I+++HL  LD+  L +Y+ ++ + ++ R    PYL
Sbjct:    1 MSHFDHGPLATYNSLTDTHLAGFFANTRKRRHLVKSGLVSRNGVIVSEATYRLNMSRKEHKKYVKDMLAQAIVHKTLDLERTRQAEIKKKLEEIAKIQLVQRVRASRGRKGDEEILPLLTLKAGRPYSSP-TSKPRGRSPNSKYRPYSAPGARPDSRFSQTSTEDDGDVLYLDDEGQPITSHRELGSNDHIDTRHLYSLDTAALRKYAMMMSQMEQGRGLSSPYL 224          

HSP 2 Score: 84.7297 bits (208), Expect = 1.657e-12
Identity = 44/123 (35.77%), Postives = 62/123 (50.41%), Query Frame = 2
Query: 1052 NQSKVQSMTKLSILFHA-----------PTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRC 1387
            ++ + +SM K+++ +H            PTQ    +I VEQQ  GGNTL +                        LT Y++   DSR+STCCE +H  G +IGG  GHFS+  V+GA PCY+C
Sbjct:  274 HEGQQESMCKITMKYHGWDLHLAREQMDPTQ----EIQVEQQHCGGNTLTV------------------------LTLYVDGHVDSRVSTCCEDRHSPGAKIGGKQGHFSIICVDGAVPCYKC 368          
BLAST of Glutamate-rich 3 vs. Ensembl Cavefish
Match: ENSAMXT00000057268.1 (glutamate rich 3 [Source:NCBI gene;Acc:103031994])

HSP 1 Score: 116.701 bits (291), Expect = 9.680e-26
Identity = 50/126 (39.68%), Postives = 76/126 (60.32%), Query Frame = 2
Query: 1034 TKTGRSNQSKVQSMTKLSILFHAPTQNRDFDIM-------VEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCL 1390
            T+ G   ++  QS   + +++   + +   D+M       V QQ  GG  L +Y+  +     F  VS RH+GFPFSLTF++N ++  R+S+CCE+KH+ G R+GG +GHF    VEGA+PCYRC+
Sbjct:  264 TQEGTVQRASAQSTVLVKMIYFGKSVHLSHDLMDLKDEVKVFQQHCGGENLCVYKGRVKELETFQFVSRRHRGFPFSLTFFLNGLQVERLSSCCEFKHRKGSRLGGRHGHFGFTGVEGASPCYRCI 389          

HSP 2 Score: 101.293 bits (251), Expect = 5.437e-21
Identity = 54/121 (44.63%), Postives = 84/121 (69.42%), Query Frame = 2
Query:   62 MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSP 424
            M   + G L  YNSLTD+HL  YF+N R+R HL K GL++++G ++P+  YR K+ +R H+R +R+ +AQAI HK L+MER  QI+I++++E+ A+ E V +++ +RS   +ED I   SP
Sbjct:    1 MNHLNPGLLGAYNSLTDKHLTGYFNNTRIRRHLQKVGLLSRSGRIIPEKEYRHKLIQRAHQRHIRECLAQAIFHKVLDMERLHQIEIKRRLEDFARRERVHKIKVERSNRYEEDHIMMLSP 121          
BLAST of Glutamate-rich 3 vs. Ensembl Cavefish
Match: ENSAMXT00000055432.1 (glutamate rich 3 [Source:NCBI gene;Acc:103031994])

HSP 1 Score: 115.161 bits (287), Expect = 1.156e-25
Identity = 51/131 (38.93%), Postives = 77/131 (58.78%), Query Frame = 2
Query: 1034 TKTGRSNQSKVQSMTKLSILFHAPTQNRDFDIM-------VEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDL 1405
            T+ G   ++  QS   + +++   + +   D+M       V QQ  GG  L +Y+  +     F  VS RH+GFPFSLTF++N ++  R+S+CCE+KH+ G R+GG +GHF    VEGA+PCYRC+    L
Sbjct:  259 TQEGTVQRASAQSTVLVKMIYFGKSVHLSHDLMDLKDEVKVFQQHCGGENLCVYKGRVKELETFQFVSRRHRGFPFSLTFFLNGLQVERLSSCCEFKHRKGSRLGGRHGHFGFTGVEGASPCYRCIIAMGL 389          

HSP 2 Score: 88.9669 bits (219), Expect = 1.715e-17
Identity = 51/121 (42.15%), Postives = 80/121 (66.12%), Query Frame = 2
Query:   62 MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSP 424
            M   + G L  YNSLTD+HL  YF+N R+R HL K GL++++G ++P+  YR K+ +R H+R +R+ +AQAI HK L      QI+I++++E+ A+ E V +++ +RS   +ED I   SP
Sbjct:    1 MNHLNPGLLGAYNSLTDKHLTGYFNNTRIRRHLQKVGLLSRSGRIIPEKEYRHKLIQRAHQRHIRECLAQAIFHKRL-----HQIEIKRRLEDFARRERVHKIKVERSNRYEEDHIMMLSP 116          
BLAST of Glutamate-rich 3 vs. Ensembl Cavefish
Match: ENSAMXT00000050022.1 (glutamate-rich protein 3-like [Source:NCBI gene;Acc:103037853])

HSP 1 Score: 80.4925 bits (197), Expect = 4.208e-15
Identity = 44/140 (31.43%), Postives = 73/140 (52.14%), Query Frame = 2
Query: 1070 SMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCL-TEQDLANERKGGQ--------KKGILGNENVS 1462
            +MT L       TQ+   ++ V QQ  GG  + +++ ++     F   S RH G+PFS TFY+N +   RIS+CCEY++  G +  G +  F L  + G  PCY+C+ +   + +E K  Q        ++G++G+   S
Sbjct:  164 TMTYLGQGMPGTTQD---EMKVLQQICGGENICVFKGSVQPGEPFQFTSQRHLGYPFSATFYVNGLIAGRISSCCEYRYTPGFQQ-GRSSCFRLTRLSGGKPCYKCVNSRHGIGHEAKAIQDNLPAIKPQEGVMGDSRPS 299          
BLAST of Glutamate-rich 3 vs. Ensembl Cavefish
Match: ENSAMXT00000034544.1 (glutamate-rich protein 3-like [Source:NCBI gene;Acc:103037853])

HSP 1 Score: 80.4925 bits (197), Expect = 4.208e-15
Identity = 44/140 (31.43%), Postives = 73/140 (52.14%), Query Frame = 2
Query: 1070 SMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCL-TEQDLANERKGGQ--------KKGILGNENVS 1462
            +MT L       TQ+   ++ V QQ  GG  + +++ ++     F   S RH G+PFS TFY+N +   RIS+CCEY++  G +  G +  F L  + G  PCY+C+ +   + +E K  Q        ++G++G+   S
Sbjct:  164 TMTYLGQGMPGTTQD---EMKVLQQICGGENICVFKGSVQPGEPFQFTSQRHLGYPFSATFYVNGLIAGRISSCCEYRYTPGFQQ-GRSSCFRLTRLSGGKPCYKCVNSRHGIGHEAKAIQDNLPAIKPQEGVMGDSRPS 299          
BLAST of Glutamate-rich 3 vs. Ensembl Nematostella
Match: EDO34193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ35])

HSP 1 Score: 121.324 bits (303), Expect = 3.041e-32
Identity = 54/117 (46.15%), Postives = 79/117 (67.52%), Query Frame = 2
Query: 1061 KVQSMTKLSILFHAPT---------QNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYR 1384
            ++QSM ++++ F  P+         ++R  ++MV QQ  GG+TL ++R+ L  ++IF  +S RH+G PF LTFYI+ ++D R+S+CCEYKHK G  +GG NGHF    VEGA PCYR
Sbjct:    4 QLQSMAEVTMKFLGPSLVLTNSMFPEDRLSEVMVLQQHCGGSTLCVFRELLPPSTIFTFISRRHRGAPFGLTFYIDGMQDIRLSSCCEYKHKPGHILGGRNGHFQFVQVEGAAPCYR 120          
BLAST of Glutamate-rich 3 vs. Ensembl Medaka
Match: ENSORLT00000027463.1 (glutamate rich 3 [Source:NCBI gene;Acc:105353910])

HSP 1 Score: 110.538 bits (275), Expect = 9.326e-24
Identity = 41/89 (46.07%), Postives = 61/89 (68.54%), Query Frame = 2
Query: 1124 DIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCL 1390
            ++ V QQ  GG  L +Y+  L     F  +S RH+GFPFSLTF++N ++  R+S CCE+K++ G R+GG +G+F    VEGA+PCY+C+
Sbjct:  302 EVKVFQQHCGGENLCVYKGMLREGETFQFLSRRHRGFPFSLTFFLNGLQVERLSACCEFKYRKGSRLGGKHGNFGFLGVEGASPCYKCI 390          

HSP 2 Score: 109.383 bits (272), Expect = 2.031e-23
Identity = 56/121 (46.28%), Postives = 83/121 (68.60%), Query Frame = 2
Query:   62 MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSP 424
            M+  + G L  YNSLTD+HL  YFSN R+R HL++ GLIT++G +VPD  YR ++ +R H++ VR+ +AQAI HK LEMER  + +I+KK+EE  + E V +++   S+  +ED +   SP
Sbjct:    1 MSHLNSGLLLAYNSLTDKHLTGYFSNTRIRRHLLRAGLITRSGRIVPDKEYRHRLLQRAHQKHVRECLAQAIFHKVLEMERLHRTEIKKKLEEFTRRERVHKIKVQHSKRYEEDVVRVLSP 121          
BLAST of Glutamate-rich 3 vs. Ensembl Medaka
Match: ENSORLT00000000910.2 (uncharacterized LOC105354674 [Source:NCBI gene;Acc:105354674])

HSP 1 Score: 82.4185 bits (202), Expect = 1.481e-15
Identity = 35/88 (39.77%), Postives = 52/88 (59.09%), Query Frame = 2
Query: 1124 DIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRC 1387
            ++ V QQ +GG  + +++  +T    F  VS RH G+PFS + YIN +  +RIS+CCEY++  G +  G    F L  + G  PCYRC
Sbjct:  197 ELKVLQQVTGGENICVFKGLITRGEQFQFVSQRHIGYPFSASIYINGIMVTRISSCCEYRYAPGFQQ-GRKSFFRLTWLAGGTPCYRC 283          
BLAST of Glutamate-rich 3 vs. Planmine SMEST
Match: SMESG000029846.1 (SMESG000029846.1)

HSP 1 Score: 1660.58 bits (4299), Expect = 0.000e+0
Identity = 965/966 (99.90%), Postives = 966/966 (100.00%), Query Frame = 2
Query: 1037 KTGRSNQSKVQSMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKKGILGNENVSMSNDFTLSLLNTSYWVSTNCTDPIMASIKVKSDKKSERSKKTFTKINVQRPVSNNRSKSLRILMPLVNFYTRSSEAEVNQPESISVGNSSERSNHEEDPNIXXXXXXXXXXXXXXXXXLNESEKMGNDDDKLKKRKVSENKDESDNSVEISVNDSDSKSEIXXXXXXXXXXXXXAVDVHRKHSNEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEENGDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQXXXXXXXXXXXXXXXXXXXXTTENRKPIQLENELIVSPNNGELSERXXXXXXXXXXXXNYKATEPPVSKGSSGQIILVGXXXXXXXXXXXXXXXXXXXTENELKSADSNLSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNKELKVIAEKSNLDNLIXXXXXXXXXXXXXXXXXXPTKPNIHEMLKKPXXXXXXXXXXXXXXXXXXXXDGELEKPVNVPENINETELKLDLPKDDNDTGQPLSSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDYDAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEICQSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGLLNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFKQCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEICKALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI 3934
            +TGRSNQSKVQSMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKKGILGNENVSMSNDFTLSLLNTSYWVSTNCTDPIMASIKVKSDKKSERSKKTFTKINVQRPVSNNRSKSLRILMPLVNFYTRSSEAEVNQPESISVGNSSERSNHEEDPNISNYSQNYSSDSDSDSDSLNESEKMGNDDDKLKKRKVSENKDESDNSVEISVNDSDSKSEINRRELNLDNRNNNAVDVHRKHSNEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEENGDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQSHLDKSRSLSSSSENSRFSDTTENRKPIQLENELIVSPNNGELSERKDKEKTTTKTDDNYKATEPPVSKGSSGQIILVGISSDNKSSISSKDRSARDSTENELKSADSNLSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNKELKVIAEKSNLDNLIVKEDSNVSSSISKDSEINPTKPNIHEMLKKPSINSESEEESSSESFTSSDSDGELEKPVNVPENINETELKLDLPKDDNDTGQPLSSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDYDAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEICQSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGLLNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFKQCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEICKALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI
Sbjct:   82 QTGRSNQSKVQSMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKKGILGNENVSMSNDFTLSLLNTSYWVSTNCTDPIMASIKVKSDKKSERSKKTFTKINVQRPVSNNRSKSLRILMPLVNFYTRSSEAEVNQPESISVGNSSERSNHEEDPNISNYSQNYSSDSDSDSDSLNESEKMGNDDDKLKKRKVSENKDESDNSVEISVNDSDSKSEINRRELNLDNRNNNAVDVHRKHSNEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEENGDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQSHLDKSRSLSSSSENSRFSDTTENRKPIQLENELIVSPNNGELSERKDKEKTTTKTDDNYKATEPPVSKGSSGQIILVGISSDNKSSISSKDRSARDSTENELKSADSNLSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNKELKVIAEKSNLDNLIVKEDSNVSSSISKDSEINPTKPNIHEMLKKPSINSESEEESSSESFTSSDSDGELEKPVNVPENINETELKLDLPKDDNDTGQPLSSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDYDAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEICQSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGLLNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFKQCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEICKALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI 1047          

HSP 2 Score: 120.939 bits (302), Expect = 3.015e-27
Identity = 83/86 (96.51%), Postives = 83/86 (96.51%), Query Frame = 2
Query:  527 MRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYLGIGXXXXXXXXXXXXXXXXXXXXXSGENSVSDDHIQVNPS 784
            MRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYLGIGKTTKICKNSVKKKKPKKKRTKSGENSVSDDHIQ   S
Sbjct:    1 MRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYLGIGKTTKICKNSVKKKKPKKKRTKSGENSVSDDHIQTGRS 86          
BLAST of Glutamate-rich 3 vs. Planmine SMEST
Match: SMESG000029846.1 (SMESG000029846.1)

HSP 1 Score: 1208.74 bits (3126), Expect = 0.000e+0
Identity = 754/754 (100.00%), Postives = 754/754 (100.00%), Query Frame = 2
Query: 1673 TRSSEAEVNQPESISVGNSSERSNHEEDPNIXXXXXXXXXXXXXXXXXLNESEKMGNDDDKLKKRKVSENKDESDNSVEISVNDSDSKSEIXXXXXXXXXXXXXAVDVHRKHSNEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEENGDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQXXXXXXXXXXXXXXXXXXXXTTENRKPIQLENELIVSPNNGELSERXXXXXXXXXXXXNYKATEPPVSKGSSGQIILVGXXXXXXXXXXXXXXXXXXXTENELKSADSNLSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNKELKVIAEKSNLDNLIXXXXXXXXXXXXXXXXXXPTKPNIHEMLKKPXXXXXXXXXXXXXXXXXXXXDGELEKPVNVPENINETELKLDLPKDDNDTGQPLSSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDYDAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEICQSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGLLNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFKQCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEICKALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI 3934
            TRSSEAEVNQPESISVGNSSERSNHEEDPNISNYSQNYSSDSDSDSDSLNESEKMGNDDDKLKKRKVSENKDESDNSVEISVNDSDSKSEINRRELNLDNRNNNAVDVHRKHSNEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEENGDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQSHLDKSRSLSSSSENSRFSDTTENRKPIQLENELIVSPNNGELSERKDKEKTTTKTDDNYKATEPPVSKGSSGQIILVGISSDNKSSISSKDRSARDSTENELKSADSNLSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNKELKVIAEKSNLDNLIVKEDSNVSSSISKDSEINPTKPNIHEMLKKPSINSESEEESSSESFTSSDSDGELEKPVNVPENINETELKLDLPKDDNDTGQPLSSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDYDAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEICQSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGLLNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFKQCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEICKALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI
Sbjct:  216 TRSSEAEVNQPESISVGNSSERSNHEEDPNISNYSQNYSSDSDSDSDSLNESEKMGNDDDKLKKRKVSENKDESDNSVEISVNDSDSKSEINRRELNLDNRNNNAVDVHRKHSNEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEENGDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQSHLDKSRSLSSSSENSRFSDTTENRKPIQLENELIVSPNNGELSERKDKEKTTTKTDDNYKATEPPVSKGSSGQIILVGISSDNKSSISSKDRSARDSTENELKSADSNLSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNKELKVIAEKSNLDNLIVKEDSNVSSSISKDSEINPTKPNIHEMLKKPSINSESEEESSSESFTSSDSDGELEKPVNVPENINETELKLDLPKDDNDTGQPLSSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDYDAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEICQSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGLLNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFKQCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEICKALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI 969          

HSP 2 Score: 294.278 bits (752), Expect = 6.358e-83
Identity = 132/133 (99.25%), Postives = 133/133 (100.00%), Query Frame = 2
Query: 1037 KTGRSNQSKVQSMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKK 1435
            +TGRSNQSKVQSMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKK
Sbjct:   82 QTGRSNQSKVQSMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKK 214          

HSP 3 Score: 120.553 bits (301), Expect = 3.336e-27
Identity = 83/86 (96.51%), Postives = 83/86 (96.51%), Query Frame = 2
Query:  527 MRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYLGIGXXXXXXXXXXXXXXXXXXXXXSGENSVSDDHIQVNPS 784
            MRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYLGIGKTTKICKNSVKKKKPKKKRTKSGENSVSDDHIQ   S
Sbjct:    1 MRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYLGIGKTTKICKNSVKKKKPKKKRTKSGENSVSDDHIQTGRS 86          
BLAST of Glutamate-rich 3 vs. Planmine SMEST
Match: SMESG000029846.1 (SMESG000029846.1)

HSP 1 Score: 1207.2 bits (3122), Expect = 0.000e+0
Identity = 754/754 (100.00%), Postives = 754/754 (100.00%), Query Frame = 2
Query: 1673 TRSSEAEVNQPESISVGNSSERSNHEEDPNIXXXXXXXXXXXXXXXXXLNESEKMGNDDDKLKKRKVSENKDESDNSVEISVNDSDSKSEIXXXXXXXXXXXXXAVDVHRKHSNEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEENGDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQXXXXXXXXXXXXXXXXXXXXTTENRKPIQLENELIVSPNNGELSERXXXXXXXXXXXXNYKATEPPVSKGSSGQIILVGXXXXXXXXXXXXXXXXXXXTENELKSADSNLSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNKELKVIAEKSNLDNLIXXXXXXXXXXXXXXXXXXPTKPNIHEMLKKPXXXXXXXXXXXXXXXXXXXXDGELEKPVNVPENINETELKLDLPKDDNDTGQPLSSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDYDAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEICQSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGLLNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFKQCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEICKALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI 3934
            TRSSEAEVNQPESISVGNSSERSNHEEDPNISNYSQNYSSDSDSDSDSLNESEKMGNDDDKLKKRKVSENKDESDNSVEISVNDSDSKSEINRRELNLDNRNNNAVDVHRKHSNEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEENGDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQSHLDKSRSLSSSSENSRFSDTTENRKPIQLENELIVSPNNGELSERKDKEKTTTKTDDNYKATEPPVSKGSSGQIILVGISSDNKSSISSKDRSARDSTENELKSADSNLSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNKELKVIAEKSNLDNLIVKEDSNVSSSISKDSEINPTKPNIHEMLKKPSINSESEEESSSESFTSSDSDGELEKPVNVPENINETELKLDLPKDDNDTGQPLSSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDYDAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEICQSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGLLNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFKQCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEICKALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI
Sbjct:  305 TRSSEAEVNQPESISVGNSSERSNHEEDPNISNYSQNYSSDSDSDSDSLNESEKMGNDDDKLKKRKVSENKDESDNSVEISVNDSDSKSEINRRELNLDNRNNNAVDVHRKHSNEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEENGDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQSHLDKSRSLSSSSENSRFSDTTENRKPIQLENELIVSPNNGELSERKDKEKTTTKTDDNYKATEPPVSKGSSGQIILVGISSDNKSSISSKDRSARDSTENELKSADSNLSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNKELKVIAEKSNLDNLIVKEDSNVSSSISKDSEINPTKPNIHEMLKKPSINSESEEESSSESFTSSDSDGELEKPVNVPENINETELKLDLPKDDNDTGQPLSSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDYDAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEICQSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGLLNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFKQCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEICKALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI 1058          

HSP 2 Score: 538.495 bits (1386), Expect = 8.459e-171
Identity = 303/303 (100.00%), Postives = 303/303 (100.00%), Query Frame = 2
Query:  527 MRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYLGIGXXXXXXXXXXXXXXXXXXXXXSGENSVSDDHIQVNPSYIPTQPFEGSFPNRELGESFVTEKYCPICAEETKSDVCHNCSLSKDISINDEKXXXXXXXXXXXQGXXXXXXXXXXXXXXFLITKTGRSNQSKVQSMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKK 1435
            MRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYLGIGKTTKICKNSVKKKKPKKKRTKSGENSVSDDHIQVNPSYIPTQPFEGSFPNRELGESFVTEKYCPICAEETKSDVCHNCSLSKDISINDEKNSNNTNINYNNQGKKRKKLIKRKRKHKFLITKTGRSNQSKVQSMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKK
Sbjct:    1 MRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPYLGIGKTTKICKNSVKKKKPKKKRTKSGENSVSDDHIQVNPSYIPTQPFEGSFPNRELGESFVTEKYCPICAEETKSDVCHNCSLSKDISINDEKNSNNTNINYNNQGKKRKKLIKRKRKHKFLITKTGRSNQSKVQSMTKLSILFHAPTQNRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYINNVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLANERKGGQKK 303          
BLAST of Glutamate-rich 3 vs. Planmine SMEST
Match: SMESG000029848.1 (SMESG000029848.1)

HSP 1 Score: 235.343 bits (599), Expect = 3.014e-71
Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 2
Query:   62 MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQXXXXXXXXXXXXXXLVRRVREDRSRMGDEDCISYFSPGNMDVPSKPGLDKKRSQS 478
            MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQIDIRKKIEEIAKIELVRRVREDRSRMGDEDCISYFSPGNMDVPSKPGLDKKRSQS
Sbjct:    1 MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAVYRVKMARREHRRRVRDLIAQAIVHKALEMERSRQIDIRKKIEEIAKIELVRRVREDRSRMGDEDCISYFSPGNMDVPSKPGLDKKRSQS 139          
The following BLAST results are available for this feature:
BLAST of Glutamate-rich 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ERICH31.049e-2538.81glutamate rich 3 [Source:HGNC Symbol;Acc:HGNC:2534... [more]
ERICH37.858e-2538.81glutamate rich 3 [Source:HGNC Symbol;Acc:HGNC:2534... [more]
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
erich32.542e-2738.03glutamate-rich 3 [Source:ZFIN;Acc:ZDB-GENE-070209-... [more]
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000023936.14.214e-2948.15glutamate rich 3 [Source:NCBI gene;Acc:100127552][more]
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Erich37.956e-2441.38glutamate rich 3 [Source:MGI Symbol;Acc:MGI:191909... [more]
Erich33.702e-2345.92glutamate rich 3 [Source:MGI Symbol;Acc:MGI:191909... [more]
back to top
BLAST of Glutamate-rich 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q5RHP9|ERIC3_HUMAN3.774e-2438.81Glutamate-rich protein 3 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Glutamate-rich 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H5722.085e-3450.74Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FT112.808e-3448.64Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
R7T5K74.509e-3049.19Uncharacterized protein (Fragment) OS=Capitella te... [more]
C3Z2427.054e-2945.83Uncharacterized protein (Fragment) OS=Branchiostom... [more]
A0A2T7PG441.014e-2838.67Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000057268.19.680e-2639.68glutamate rich 3 [Source:NCBI gene;Acc:103031994][more]
ENSAMXT00000055432.11.156e-2538.93glutamate rich 3 [Source:NCBI gene;Acc:103031994][more]
ENSAMXT00000050022.14.208e-1531.43glutamate-rich protein 3-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000034544.14.208e-1531.43glutamate-rich protein 3-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO341933.041e-3246.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate-rich 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000027463.19.326e-2446.07glutamate rich 3 [Source:NCBI gene;Acc:105353910][more]
ENSORLT00000000910.21.481e-1539.77uncharacterized LOC105354674 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Glutamate-rich 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000029846.13.015e-2799.90SMESG000029846.1[more]
SMESG000029846.16.358e-83100.00SMESG000029846.1[more]
SMESG000029846.18.459e-171100.00SMESG000029846.1[more]
SMESG000029848.13.014e-71100.00SMESG000029848.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023409 ID=SMED30023409|Name=Glutamate-rich 3|organism=Schmidtea mediterranea sexual|type=transcript|length=4109bp
CAATTCTTAAATGTTACTTTTTGAAATATTTTTTAATATTAAGATATATT
TTTAATTTTTAATGGCCGCCTTTGATCAAGGAACATTATTTAAGTACAAC
AGCCTTACCGATAGGCATTTAGTGAATTATTTCAGCAATGAGAGAATGAG
GCATCATTTAGTAAAAAATGGATTGATTACAAAAACCGGTGAAGTAGTAC
CTGACGCAGTTTATCGCGTTAAAATGGCGAGACGCGAACATCGCAGAAGA
GTGCGCGATTTAATTGCTCAGGCTATTGTACACAAAGCTTTAGAAATGGA
AAGATCCCGACAAATTGATATTCGCAAAAAAATAGAGGAAATTGCAAAAA
TAGAATTAGTTCGTCGAGTCAGGGAAGATCGAAGCCGAATGGGAGATGAG
GACTGCATCTCATATTTTTCACCTGGAAATATGGATGTTCCTTCTAAGCC
CGGATTGGATAAAAAACGGTCGCAATCTGATATAGATGAATACAAATTAC
CAGCTACCCCTGATGAGCGATCAAGAATGAGACTAAGAAGGATTTTACCC
AATGAAGAAATCGAATCCAAACATCTTTCTCAACTGGATTCATTAACACT
CGGAGAGTACTCAAGAATATTACAAAAGCAAGATAGGGAACGAATTAACA
AGTTGCCTTACTTAGGAATCGGTAAAACCACAAAGATTTGTAAAAATAGC
GTGAAAAAGAAAAAGCCTAAAAAGAAAAGGACAAAATCCGGCGAAAATTC
GGTATCTGACGACCATATTCAAGTAAATCCAAGCTATATACCGACGCAAC
CTTTTGAAGGTTCTTTTCCAAACCGTGAGTTAGGTGAAAGTTTCGTAACC
GAAAAGTATTGTCCGATTTGTGCTGAAGAAACGAAATCAGATGTCTGTCA
TAATTGCTCATTGTCAAAAGATATTTCTATTAATGACGAGAAAAACTCGA
ATAATACCAATATTAATTATAATAATCAAGGAAAAAAGAGGAAAAAATTA
ATTAAACGAAAAAGAAAGCACAAATTCCTAATAACAAAGACTGGTCGAAG
CAACCAGTCTAAGGTTCAATCCATGACCAAATTATCCATTTTGTTTCACG
CGCCAACTCAGAACCGCGATTTCGACATAATGGTTGAACAACAACCGAGT
GGAGGGAACACATTAATTTTGTATCGGGACACCCTGACAAACAATAGTAT
TTTTAATGTTGTGTCTCATCGCCATAAAGGATTTCCATTTTCCTTGACGT
TTTATATCAATAATGTCAAAGATTCTCGAATCAGCACATGCTGCGAATAT
AAACACAAAGTCGGTAAAAGAATTGGTGGCCCAAATGGGCATTTTAGTTT
ATTTTCCGTTGAAGGTGCAAATCCGTGTTACAGATGTCTCACTGAACAAG
ATTTGGCCAATGAACGCAAAGGTGGTCAGAAAAAAGGCATTCTAGGCAAT
GAGAATGTGTCCATGTCTAACGACTTCACTCTCTCATTATTAAACACGAG
TTATTGGGTCAGCACGAATTGCACAGATCCGATTATGGCGTCAATTAAAG
TTAAAAGTGATAAAAAGTCTGAAAGATCGAAAAAAACCTTTACTAAAATA
AATGTTCAAAGGCCAGTTAGTAATAACCGTTCAAAGTCTTTAAGGATCTT
AATGCCGCTCGTCAATTTTTATACTAGGTCAAGTGAAGCAGAAGTCAATC
AGCCGGAATCTATTTCAGTTGGTAACAGTTCAGAAAGATCAAATCACGAA
GAAGATCCTAATATATCAAATTATTCTCAAAATTATTCAAGCGATAGTGA
CAGCGACAGTGACAGTTTAAATGAAAGCGAAAAGATGGGAAATGACGACG
ATAAATTGAAAAAGAGAAAGGTATCAGAAAATAAAGATGAAAGTGATAAT
TCTGTCGAAATTTCTGTGAATGACAGCGATTCAAAATCAGAAATAAACCG
ACGGGAATTAAATTTAGATAATCGCAACAATAATGCTGTAGACGTCCACC
GTAAACATTCAAATGAAAAAAACATTAAAGAATCTACGTCGCTAGAAAAC
GAATTTAGTGCTCCCCTCACGAATGCCAACACCAAAGTTACAATAAAGCC
AAAAGAAAAAGATTCCTTGGTGGATTCAACGGAACATGTAGTCAATCATA
AAGAAGAAAACGGTGATTCTATTGTTGCTCAAGATTCTTCTATAAAAGTC
GATAAAAGCTCTGAAAAAGAAAATGAAAACTTTGTAGGCGAAAAAGAAAA
CATTCAACTTCAAGATCAAAATAACTTTCTTCAAAGTCATTTGGATAAAT
CTCGTTCTTTATCTAGTTCTTCGGAAAATTCCCGATTTTCGGATACGACC
GAGAATAGGAAACCGATCCAATTGGAAAACGAATTGATCGTGTCACCCAA
TAATGGTGAACTCTCTGAGAGAAAAGACAAAGAGAAAACAACCACCAAAA
CCGATGACAATTATAAGGCAACTGAACCTCCAGTGAGCAAGGGTTCAAGC
GGTCAAATTATCCTCGTAGGGATTAGTTCAGACAATAAGTCTTCTATTTC
TTCTAAGGATAGAAGTGCAAGGGATAGCACTGAAAATGAGCTCAAAAGCG
CCGACTCCAATTTAAGTGATATAAGGAAAAACGAAGGAAATAATAATCCA
AATTCTGAGGAGGTCAAACCTTTAAATTTGCGGTTTTCAACTCCGACAAA
TACCGCAGACTTTCAGAAAGATAATTCGCTTGACATTAATTCTGAAGGTA
GTTCCAATAAAGAGCTGAAAGTTATAGCGGAAAAAAGTAACTTGGATAAT
TTGATTGTCAAAGAAGATTCGAATGTTTCGTCTTCGATTTCGAAGGATTC
GGAAATAAACCCAACCAAACCTAATATTCACGAAATGTTAAAGAAGCCAT
CAATTAATAGTGAGAGTGAAGAGGAATCGTCCTCGGAATCGTTTACTAGT
TCTGATTCTGATGGAGAATTAGAGAAGCCAGTTAATGTCCCAGAAAATAT
TAATGAAACCGAACTGAAGTTAGACCTTCCTAAGGATGATAATGACACCG
GTCAACCGTTGAGCTCCAACCGAATTAATGAAAACTCAACAGATGAAGAT
TTAGAAACGGAACCCAACATCAAAGTTAAATCAAATCCATTAATAAAAAG
TCCAGATGAGAAACCAAATGTCTTGAGATCTTCTATGTCATCGGAATCTG
AAACGGACTATGATGCCAAGAGTTCCATTTCGATAGCTACAGAAAATGAT
GATGTTCAATCGAGTGCTCCAGCAGAAACGACAACAAATGATAATAATTC
TGGGAAAGATATTTACGCTGAAAATGATGACATCAATTTTAAACGGGCTA
AGGAAATTTGTCAGAGTTTCAATGGTGGTCGAATTAATTCATTAAAAATT
AAAAATTCCGAACTTCCCAGTTATGTGTTTGATTCGATTGCTGAACAACT
TGGAGCTCATCCGGAATTAAAGAGCATAGAATTGTCTGGATGTGAGGTGG
AAATCGGTTTATTAAATTTGTTGGCCAAATATTTACACAATTGGCCGAAT
CTCGAAACTTTGATACTGTCTGACAATGAATTCACCGACTATTCACTGCA
GAACTTAATTGATATGTTAAAATTTCTATATGACAATGATGGAAATCCAA
ACAGTTTCAAACAATGCTTGAAACTCTTGGATTTCGCTCGCTGTTCAATA
AAGGAAAATGACCTCACTCAGTTGATAGAAATGATCGGAAGAAATACAAA
AATTGAAAAGTTTGTTCTAGATGGATCCAAGAAAATACGATCTATATTCC
CGGAAATTTGCAAAGCCCTCCAGATGAACACAAATATCAAGCTGCTCTCG
CTAAAGAATTGCGACATCTCTGAAGAAATGTTGAACGAGGGCGTCGAAGA
ATTCGGAGTAACTATCAAAGGGAAATTCGTTATTTAGATTGTTATGAAAC
CTTTCATGGACTGTTATTATTATTACTATTACTATTGAAGCAGAGTGATT
TTTCCTAAATACAACTGAATATAACAATCGAAAATTTGGGGGAAAATAAG
TTTGATAATAAATATAAATTATTTAAAACATTGCATCAAAATAATACTGA
TAATTGCAC
back to top

protein sequence of SMED30023409-orf-1

>SMED30023409-orf-1 ID=SMED30023409-orf-1|Name=SMED30023409-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1292bp
MAAFDQGTLFKYNSLTDRHLVNYFSNERMRHHLVKNGLITKTGEVVPDAV
YRVKMARREHRRRVRDLIAQAIVHKALEMERSRQIDIRKKIEEIAKIELV
RRVREDRSRMGDEDCISYFSPGNMDVPSKPGLDKKRSQSDIDEYKLPATP
DERSRMRLRRILPNEEIESKHLSQLDSLTLGEYSRILQKQDRERINKLPY
LGIGKTTKICKNSVKKKKPKKKRTKSGENSVSDDHIQVNPSYIPTQPFEG
SFPNRELGESFVTEKYCPICAEETKSDVCHNCSLSKDISINDEKNSNNTN
INYNNQGKKRKKLIKRKRKHKFLITKTGRSNQSKVQSMTKLSILFHAPTQ
NRDFDIMVEQQPSGGNTLILYRDTLTNNSIFNVVSHRHKGFPFSLTFYIN
NVKDSRISTCCEYKHKVGKRIGGPNGHFSLFSVEGANPCYRCLTEQDLAN
ERKGGQKKGILGNENVSMSNDFTLSLLNTSYWVSTNCTDPIMASIKVKSD
KKSERSKKTFTKINVQRPVSNNRSKSLRILMPLVNFYTRSSEAEVNQPES
ISVGNSSERSNHEEDPNISNYSQNYSSDSDSDSDSLNESEKMGNDDDKLK
KRKVSENKDESDNSVEISVNDSDSKSEINRRELNLDNRNNNAVDVHRKHS
NEKNIKESTSLENEFSAPLTNANTKVTIKPKEKDSLVDSTEHVVNHKEEN
GDSIVAQDSSIKVDKSSEKENENFVGEKENIQLQDQNNFLQSHLDKSRSL
SSSSENSRFSDTTENRKPIQLENELIVSPNNGELSERKDKEKTTTKTDDN
YKATEPPVSKGSSGQIILVGISSDNKSSISSKDRSARDSTENELKSADSN
LSDIRKNEGNNNPNSEEVKPLNLRFSTPTNTADFQKDNSLDINSEGSSNK
ELKVIAEKSNLDNLIVKEDSNVSSSISKDSEINPTKPNIHEMLKKPSINS
ESEEESSSESFTSSDSDGELEKPVNVPENINETELKLDLPKDDNDTGQPL
SSNRINENSTDEDLETEPNIKVKSNPLIKSPDEKPNVLRSSMSSESETDY
DAKSSISIATENDDVQSSAPAETTTNDNNSGKDIYAENDDINFKRAKEIC
QSFNGGRINSLKIKNSELPSYVFDSIAEQLGAHPELKSIELSGCEVEIGL
LNLLAKYLHNWPNLETLILSDNEFTDYSLQNLIDMLKFLYDNDGNPNSFK
QCLKLLDFARCSIKENDLTQLIEMIGRNTKIEKFVLDGSKKIRSIFPEIC
KALQMNTNIKLLSLKNCDISEEMLNEGVEEFGVTIKGKFVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027962DUF4590
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 837..857
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 584..615
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 660..676
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 853..872
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 830..852
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 727..759
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1036..1082
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 541..872
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 677..703
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 498..517
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 800..829
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 921..1083
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 212..233
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 541..557
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 566..582
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 783..799
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 641..659
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 712..726
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 953..969
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 1095..1272
IPR027962Protein of unknown function DUF4590PFAMPF15257DUF4590coord: 354..451
e-value: 5.0E-37
score: 126.3
IPR027962Protein of unknown function DUF4590PANTHERPTHR23034UNCHARACTERIZEDcoord: 355..807
coord: 9..121
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 1082..1193
e-value: 1.2E-9
score: 39.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 1194..1282
e-value: 4.1E-8
score: 34.3