Zinc finger C2HC domain-containing protein 1A

Overview
NameZinc finger C2HC domain-containing protein 1A
Smed IDSMED30023406
Length (bp)1122
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger C2HC domain-containing protein 1A (SMED30023406) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger C2HC domain-containing protein 1A (SMED30023406) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger C2HC domain-containing protein 1A (SMED30023406) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger C2HC domain-containing protein 1A (SMED30023406) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023406

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023406SMESG000054669.1 dd_Smed_v4_2762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30023406SMESG000054669.1 Contig53082uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30023406SMESG000054669.1 Contig53082newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30023406SMESG000054669.1 OX_Smed_1.0.11761ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
tail stripeSMED30023406SMESG000044342.1 isotig03820be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023406SMESG000044342.1 isotig03820be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30023406SMESG000054669.1 dd_Smed_v4_2762_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Human
Match: ZC2HC1A (zinc finger C2HC-type containing 1A [Source:HGNC Symbol;Acc:HGNC:24277])

HSP 1 Score: 146.362 bits (368), Expect = 3.157e-40
Identity = 113/329 (34.35%), Postives = 156/329 (47.42%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSN---------ASKKPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGRPQASPSINTNNQTVPTSA-NIRPG-------SYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +L  CK CGR F P  L KH PIC K+  K+RK FDS +QRAEG+DIP  K                   +   WR+KHE  I + +AA+    A + G  LPPPPPP  D   ++CPYC RRFNE+A +RH+ FCKEQ A++  +            S+  VYK P LK      +  P T +       Q + +        + +   SS+     ++T  P+   +  P A  ++   N T P+ A N  PG       +Y  S    P    AS +        K + G S  + P  FCHECG  + V  A+FC ECG+RR+ +
Sbjct:   15 ELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKP---------LKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALK-----KSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNI---KGIEGHSPGNLPK-FCHECGTKYPVEWAKFCCECGIRRMIL 325          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Human
Match: ZC2HC1B (zinc finger C2HC-type containing 1B [Source:HGNC Symbol;Acc:HGNC:21174])

HSP 1 Score: 99.3673 bits (246), Expect = 8.194e-24
Identity = 64/146 (43.84%), Postives = 87/146 (59.59%), Query Frame = 1
Query:   49 GDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIP-INKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAK 483
            G+ +L  C+ CGR F  DVL +H PIC K   ++RK F S KQR +G+DIP + KT        P SK  +   R   WRQ+HE  I + ++A+    A + G PLPPPPPP ++   ++ PYC RRFNE A  RH  FCK+Q ++
Sbjct:   11 GNQELFPCEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDIPTVKKT--------PQSK--SPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLPPPPPPSLNPDYIQRPYCMRRFNESAAERHTNFCKDQSSR 146          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Celegans
Match: T03G11.3 (Zinc finger C2HC domain-containing protein T03G11.3 [Source:UniProtKB/Swiss-Prot;Acc:Q22122])

HSP 1 Score: 88.9669 bits (219), Expect = 9.621e-20
Identity = 56/143 (39.16%), Postives = 72/143 (50.35%), Query Frame = 1
Query:   70 CKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPI--------NKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQ 474
            C  C R F    L KHE  C K     RK FDSGKQRA GSD+           K    G  P+P +           WR++H   I++  +++    A +TGAPLPPPP   + +  V+C YC R FN  A  RH+PFC+EQ
Sbjct:   13 CPICDRRFIKSSLEKHESACRKLASLHRKPFDSGKQRASGSDLTYADIKKVQHEKNKNGGVFPRPQT----------NWRERHGNFIDAVSSSKRVDYALKTGAPLPPPPKTAVPSDYVQCEYCSRNFNAAAAERHIPFCREQ 145          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Fly
Match: CG42675 (gene:FBgn0261561 transcript:FBtr0302726)

HSP 1 Score: 87.0409 bits (214), Expect = 6.728e-20
Identity = 51/140 (36.43%), Postives = 71/140 (50.71%), Query Frame = 1
Query:   70 CKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAE------ARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTS--LVECPYCHRRFNEDACNRHVPFC 465
            C+ CGR+F  D L KHE +C +    +RK+FD+ KQR EG++         G   +     AA +       +   WR+KHE  I+S +AA+        G  L   PPP    +   V+CP+C RRFNE A  RH+P C
Sbjct:   31 CRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQKGLTTGVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQCPHCGRRFNEQAAERHIPKC 170          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Fly
Match: CG42675 (gene:FBgn0261561 transcript:FBtr0302725)

HSP 1 Score: 88.1965 bits (217), Expect = 4.315e-19
Identity = 51/140 (36.43%), Postives = 71/140 (50.71%), Query Frame = 1
Query:   70 CKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAE------ARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTS--LVECPYCHRRFNEDACNRHVPFC 465
            C+ CGR+F  D L KHE +C +    +RK+FD+ KQR EG++         G   +     AA +       +   WR+KHE  I+S +AA+        G  L   PPP    +   V+CP+C RRFNE A  RH+P C
Sbjct:  227 CRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQKGLTTGVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQCPHCGRRFNEQAAERHIPKC 366          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Fly
Match: CG42675 (gene:FBgn0261561 transcript:FBtr0303165)

HSP 1 Score: 88.1965 bits (217), Expect = 4.315e-19
Identity = 51/140 (36.43%), Postives = 71/140 (50.71%), Query Frame = 1
Query:   70 CKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAE------ARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTS--LVECPYCHRRFNEDACNRHVPFC 465
            C+ CGR+F  D L KHE +C +    +RK+FD+ KQR EG++         G   +     AA +       +   WR+KHE  I+S +AA+        G  L   PPP    +   V+CP+C RRFNE A  RH+P C
Sbjct:  227 CRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQKGLTTGVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQCPHCGRRFNEQAAERHIPKC 366          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Fly
Match: CG42675 (gene:FBgn0261561 transcript:FBtr0302724)

HSP 1 Score: 88.1965 bits (217), Expect = 4.315e-19
Identity = 51/140 (36.43%), Postives = 71/140 (50.71%), Query Frame = 1
Query:   70 CKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAE------ARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTS--LVECPYCHRRFNEDACNRHVPFC 465
            C+ CGR+F  D L KHE +C +    +RK+FD+ KQR EG++         G   +     AA +       +   WR+KHE  I+S +AA+        G  L   PPP    +   V+CP+C RRFNE A  RH+P C
Sbjct:  227 CRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQKGLTTGVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQCPHCGRRFNEQAAERHIPKC 366          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Fly
Match: CG42675 (gene:FBgn0261561 transcript:FBtr0302727)

HSP 1 Score: 87.8113 bits (216), Expect = 7.214e-19
Identity = 51/140 (36.43%), Postives = 71/140 (50.71%), Query Frame = 1
Query:   70 CKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAE------ARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTS--LVECPYCHRRFNEDACNRHVPFC 465
            C+ CGR+F  D L KHE +C +    +RK+FD+ KQR EG++         G   +     AA +       +   WR+KHE  I+S +AA+        G  L   PPP    +   V+CP+C RRFNE A  RH+P C
Sbjct:  256 CRYCGRHFNTDRLAKHEEVCQRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQKGLTTGVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQCPHCGRRFNEQAAERHIPKC 395          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Zebrafish
Match: zc2hc1a (zinc finger, C2HC-type containing 1A [Source:NCBI gene;Acc:324412])

HSP 1 Score: 150.599 bits (379), Expect = 4.805e-42
Identity = 113/354 (31.92%), Postives = 167/354 (47.18%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKP----------GEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGR------PQASPSINTNNQTVPTSAN-IRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPV-------------------------GFCHECGASFTVASARFCSECGVRRLAV 993
            +L  CK CGR+F P VL KH PIC K+  K+RKVFDSG+QRAEG++I   K +KP           + P+P  K +        WR+KHE  I + +AA++ +   + G PLPPPPPP  D   ++CPYC RRF E+A +RH+ FCKEQ +++  +S  +     K P     +P A +K  + T                                 SV + LP RS  G+      P + PS   + ++ PT  + +R  S G ++           M+++ +++R    G  +N K +                          FCHECG  + V SA+FC ECGV+R+ +
Sbjct:   13 ELVPCKICGRSFFPKVLKKHVPICQKTAAKRRKVFDSGRQRAEGTEISTVKPIKPKLQSSSSSSKSDKPEPPKKQS-------NWRRKHEEFIATIRAAKSINQVIKDGGPLPPPPPPSYDPDYIQCPYCQRRFGENAADRHIKFCKEQASRISNKSKLAGGDKTKPPARTQYKPPAPKKANSPT-------------------------------TSSVSSRLPQRSAYGQGAGTGIPSSKPSSTGSIKSTPTGYSPLRNNSSGLTSPPSEGNMKPKGMVSQ-SSLRNPSTGIGMNKKKIQNADNCISRNDMKNENDFNYSTTGTKFCHECGTKYPVESAKFCCECGVKRMYI 327          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Zebrafish
Match: zc2hc1a (zinc finger, C2HC-type containing 1A [Source:NCBI gene;Acc:324412])

HSP 1 Score: 136.732 bits (343), Expect = 1.402e-36
Identity = 112/353 (31.73%), Postives = 163/353 (46.18%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKP----------GEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRS-----NASKKPV---YKAP-PLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGR------PQASPSINTNNQTVPTSAN-IRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPV-------------------------GFCHECGASFTVASARFC 963
            +L  CK CGR+F P VL KH PIC K+  K+RKVFDSG+QRAEG++I   K +KP           + P+P  K +        WR+KHE  I + +AA++ +   + G PLPPPPPP  D   ++CPYC RRF E+A +RH+ FCKEQ +++  +S     + +K P    YK P P KA  PTA+                                        SV + LP RS  G+      P + PS   + ++ P+  + +R  S G ++           M+++ +++R    G  +N K +                          FCHECG  + V SA+FC
Sbjct:   13 ELVPCKICGRSFFPKVLKKHVPICQKTAAKRRKVFDSGRQRAEGTEISTVKPIKPKLQSSSSSSKSDKPEPPKKQS-------NWRRKHEEFIATIRAAKSINQVIKDGGPLPPPPPPSYDPDYIQCPYCQRRFGENAADRHIKFCKEQASRISNKSKLAGGDKTKPPARTQYKPPAPKKANSPTAS----------------------------------------SVSSRLPQRSAYGQGAGTGIPSSKPSSTGSIKSTPSGYSPLRNNSSGLTSPPSEGNMKPKGMVSQ-SSLRNPSTGIGINKKKIQNADNCISRNDMKNENDFNYSTTGTKFCHECGTKYPVESAKFC 317          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Zebrafish
Match: zc2hc1a (zinc finger, C2HC-type containing 1A [Source:NCBI gene;Acc:324412])

HSP 1 Score: 120.168 bits (300), Expect = 4.795e-31
Identity = 77/177 (43.50%), Postives = 104/177 (58.76%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRS-----NASKKPV---YKAP-PLKAKQPTAT 561
            +L  CK CGR+F P VL KH PIC K+  K+RKVFDSG+QRAEG++I            KP         +   WR+KHE  I + +AA++ +   + G PLPPPPPP  D   ++CPYC RRF E+A +RH+ FCKEQ +++  +S     + +K P    YK P P KA  PT +
Sbjct:   13 ELVPCKICGRSFFPKVLKKHVPICQKTAAKRRKVFDSGRQRAEGTEI---------STVKPIKPKPEPPKKQSNWRRKHEEFIATIRAAKSINQVIKDGGPLPPPPPPSYDPDYIQCPYCQRRFGENAADRHIKFCKEQASRISNKSKLAGGDKTKPPARTQYKPPAPKKANSPTTS 180          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Zebrafish
Match: zc2hc1c (zinc finger, C2HC-type containing 1C [Source:ZFIN;Acc:ZDB-GENE-111020-1])

HSP 1 Score: 67.3958 bits (163), Expect = 7.236e-12
Identity = 44/133 (33.08%), Postives = 65/133 (48.87%), Query Frame = 1
Query:   70 CKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCK 468
            C  C R F P+ L  H  +C K  R QRKVFD  K RA G+++         E  K +S+    E +   WRQKHE  I++ +  R+ ST+++  +         +    + CP+C R+F      RHVP C+
Sbjct:  325 CSVCRRCFAPERLETHMRVCEKK-RPQRKVFDMSKYRARGTELE--------EFMKTNSRSRTPERKKNMWRQKHEAFIQTMRQGRS-STSQQPNSTSG------LHQEYITCPHCGRKFAPGPAERHVPKCQ 441          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Xenopus
Match: zc2hc1a (zinc finger, C2HC-type containing 1A [Source:NCBI gene;Acc:100124952])

HSP 1 Score: 146.362 bits (368), Expect = 5.898e-40
Identity = 124/384 (32.29%), Postives = 170/384 (44.27%), Query Frame = 1
Query:   40 MDAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEI-PKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQK---PATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTR---SVVGRPQAS-------------------PSINTNNQTVPTSANIRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVN-----------------------SKPVG-----------------FCHECGASFTVASARFCSECGVRRLAV 993
            M+  + +L+ CK CGR F    L KH PIC KS  K+RK FDS +QRAEG+DI    T+KP +  P+P  K +        WR+KHE  I + +AA+  S   + G  LPPPPPP  D   V+CPYC RRFN++A +RH+ FCKEQ A++G +      P  K  P    +P + +K   PA V+       Q       +S   + +S  +S  P    +T  P     + V  PQA                     S N  +  +P   +++P   GA   + P           P+ VR    GTS N                       SKPV                  FCHECG  + V  A+FC ECG+RR+ +
Sbjct:    1 MEEIEEELKPCKICGRTFFTSTLKKHIPICQKSAVKKRKAFDSSRQRAEGTDI---STVKPVKARPEPPKKQST-------WRRKHEEFIATIRAAKGISQIIKEGGELPPPPPPSYDPDYVQCPYCQRRFNQNAADRHINFCKEQAARMGNKMKGGPDPKGKPAPRPQHKPLSLKKTNSPAAVSSPASRLPQPPNFGKTTSGIPSGKSVANSGAPGNKYQTQSPAHKNSTTVTSPQAGKLDTIGPPLRTGRDILRMHESDNKTDSYIPRVNDLQPIHKGALKSRTP-----------PSLVRNPSSGTSFNKRKTYNENNARPEAKMAYDATDYSKPVNDGRIRAADNNTSGQLTKFCHECGTKYPVEWAKFCCECGIRRMVL 363          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Xenopus
Match: zc2hc1a (zinc finger, C2HC-type containing 1A [Source:NCBI gene;Acc:100124952])

HSP 1 Score: 119.013 bits (297), Expect = 2.573e-30
Identity = 101/299 (33.78%), Postives = 147/299 (49.16%), Query Frame = 1
Query:  145 KQRKVFDSGKQRAEGSDIPINKTLKPGEI-PKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQK---PATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTR---SVVGRPQASPSINT-------NNQTVPTSANIRPGSYGASAQKMPAKTTASPM-ITKP-TAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            K+RK FDS +QRAEG+DI    T+KP +  P+P  K +        WR+KHE  I + +AA+  S   + G  LPPPPPP  D   V+CPYC RRFN++A +RH+ FCKEQ A++G +      P  K  P    +P + +K   PA V+       Q       +S   + +S  +S  P    +T  P     + V  PQA  ++ +        N +  TS N R  +Y  +  +  AK        +KP    R      + + +   FCHECG  + V  A+FC ECG+RR+ +
Sbjct:   16 KKRKAFDSSRQRAEGTDI---STVKPVKARPEPPKKQST-------WRRKHEEFIATIRAAKGISQIIKEGGELPPPPPPSYDPDYVQCPYCQRRFNQNAADRHINFCKEQAARMGNKMKGGPDPKGKPAPRPQHKPLSLKKTNSPAAVSSPASRLPQPPNFGKTTSGIPSGKSVANSGAPGNKYQTQSPAHKNSTTVTSPQAGGALKSRTPPSLVRNPSSGTSFNKR-KTYNENNARPEAKMAYDATDYSKPVNDGRIRAADNNTSGQLTKFCHECGTKYPVEWAKFCCECGIRRMVL 303          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Xenopus
Match: zc2hc1a (zinc finger, C2HC-type containing 1A [Source:NCBI gene;Acc:100124952])

HSP 1 Score: 117.472 bits (293), Expect = 1.914e-29
Identity = 108/349 (30.95%), Postives = 150/349 (42.98%), Query Frame = 1
Query:  145 KQRKVFDSGKQRAEGSDIPINKTLKPGEI-PKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQK---PATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTR---SVVGRPQAS-------------------PSINTNNQTVPTSANIRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVN-----------------------SKPVG-----------------FCHECGASFTVASARFCSECGVRRLAV 993
            K+RK FDS +QRAEG+DI    T+KP +  P+P  K +        WR+KHE  I + +AA+  S   + G  LPPPPPP  D   V+CPYC RRFN++A +RH+ FCKEQ A++G +      P  K  P    +P + +K   PA V+       Q       +S   + +S  +S  P    +T  P     + V  PQA                     S N  +  +P   +++P   GA   + P           P+ VR    GTS N                       SKPV                  FCHECG  + V  A+FC ECG+RR+ +
Sbjct:    5 KKRKAFDSSRQRAEGTDI---STVKPVKARPEPPKKQST-------WRRKHEEFIATIRAAKGISQIIKEGGELPPPPPPSYDPDYVQCPYCQRRFNQNAADRHINFCKEQAARMGNKMKGGPDPKGKPAPRPQHKPLSLKKTNSPAAVSSPASRLPQPPNFGKTTSGIPSGKSVANSGAPGNKYQTQSPAHKNSTTVTSPQAGKLDTIGPPLRTGRDILRMHESDNKTDSYIPRVNDLQPIHKGALKSRTP-----------PSLVRNPSSGTSFNKRKTYNENNARPEAKMAYDATDYSKPVNDGRIRAADNNTSGQLTKFCHECGTKYPVEWAKFCCECGIRRMVL 332          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Xenopus
Match: ENSXETT00000006755.1 (zinc finger, C2HC-type containing 1C [Source:NCBI gene;Acc:100492184])

HSP 1 Score: 71.2478 bits (173), Expect = 5.365e-13
Identity = 51/147 (34.69%), Postives = 75/147 (51.02%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYS--TAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGP 492
            +L  C  CGR F    L KH  +C K  +  RKVFDS K RA+G++  + + L+     +P+      + ++  WRQKHE   ++ + AR      AK       PPPPP  +   V CP+C+RRF      RH+P C+  ++K  P
Sbjct:  329 ELLPCNLCGRQFLAHRLEKHTQVCQKMQKSNRKVFDSSKARAKGTE--LEQYLQTKGKTRPN----VPKVQSNAWRQKHESFQQTIRHARTVQQVIAKGGKLSDLPPPPPEENPDYVTCPHCNRRFAPRVAERHIPKCENIKSKPRP 469          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Mouse
Match: Zc2hc1a (zinc finger, C2HC-type containing 1A [Source:MGI Symbol;Acc:MGI:1914556])

HSP 1 Score: 152.525 bits (384), Expect = 1.055e-42
Identity = 120/332 (36.14%), Postives = 160/332 (48.19%), Query Frame = 1
Query:   40 MDAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKL---GPRSNASK-----KPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNL-PTRSVVGRPQASPSINTNNQTVPTSA-NIRPGSYGASAQKMPAKTTASPMITKPTAVR----KTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +  GD  L  CK CGR F P  L KH PIC K+  K+RK FDS +QRAEG+DIP  K L                 +   WR+KHE  I + +AA+    A + G  LPPPPPP  D   ++CPYC RRFNE+A +RH+ FCKEQ A++   G  S  SK     +P YK  PLK   P        +  +G S      +TS +     +    S N P+ +    L P+   +  PQA  +    N T P+ A N   G      + +     A P     ++V     K + G S    P  FCHECG  + V  A+FC ECG+RR+ +
Sbjct:   11 VQVGD--LLPCKICGRTFFPLALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPL---------KPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDSKGKPASRPQYKPSPLKKSNPPG------IPSSGSSRLPQPSTTSKTIVGVPTGKASSVNSPLGNKPQTLSPSHRAIAAPQAGANTKARNTTPPSLARNSVAGVLTNKRKTLTENYAARPDGDYTSSVNGGNSKGIEGNSSGHLPK-FCHECGTKYPVEWAKFCCECGIRRMIL 324          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Mouse
Match: Zc2hc1a (zinc finger, C2HC-type containing 1A [Source:MGI Symbol;Acc:MGI:1914556])

HSP 1 Score: 144.821 bits (364), Expect = 3.246e-40
Identity = 113/327 (34.56%), Postives = 150/327 (45.87%), Query Frame = 1
Query:   40 MDAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKL---GPRSNASK-----KPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNL-PTRSVVGRPQASPSINTNNQTVPTSANIRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +  GD  L  CK CGR F P  L KH PIC K+  K+RK FDS +QRAEG+DIP  K L                 +   WR+KHE  I + +AA+    A + G  LPPPPPP  D   ++CPYC RRFNE+A +RH+ FCKEQ A++   G  S  SK     +P YK  PLK   P        +  +G S      +TS +     +    S N P+ +    L P+   +  PQA P     + T   +     G  G S+  +P                              FCHECG  + V  A+FC ECG+RR+ +
Sbjct:   11 VQVGD--LLPCKICGRTFFPLALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPL---------KPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDSKGKPASRPQYKPSPLKKSNPPG------IPSSGSSRLPQPSTTSKTIVGVPTGKASSVNSPLGNKPQTLSPSHRAIAAPQAGPD---GDYTSSVNGGNSKGIEGNSSGHLPK-----------------------------FCHECGTKYPVEWAKFCCECGIRRMIL 288          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Mouse
Match: Zc2hc1b (zinc finger, C2HC-type containing 1B [Source:MGI Symbol;Acc:MGI:1922372])

HSP 1 Score: 107.842 bits (268), Expect = 1.331e-27
Identity = 63/148 (42.57%), Postives = 90/148 (60.81%), Query Frame = 1
Query:   40 MDAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAK 483
            ++ G+ +L  C+ CGR F  DVL +H PIC K   K+RK F+S KQR +G+DIP       G+ P+P  +      R   WRQ+HE  I + ++A+ ++ A + G PLPPPP P  +   ++CPYC RRFNE A  RH+ FCK Q ++
Sbjct:    8 VEDGNQKLFPCEVCGRCFATDVLERHGPICKKVFNKKRKPFNSLKQRLQGTDIPT-----VGKSPQPKVQ----PVRKSNWRQQHEDFINTIRSAKQFTLAIKEGRPLPPPPRPTSNPDYIQCPYCMRRFNETAAQRHINFCKNQTSR 146          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Mouse
Match: Zc2hc1c (zinc finger, C2HC-type containing 1C [Source:MGI Symbol;Acc:MGI:1919600])

HSP 1 Score: 68.9366 bits (167), Expect = 2.712e-12
Identity = 45/143 (31.47%), Postives = 62/143 (43.36%), Query Frame = 1
Query:   61 LQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLK-----PGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXV--IDTSLVECPYCHRRFNEDACNRHVPFCK 468
            L  C  CGR+F    L +H  +C K    +RKVFDS + RA+G+++      +       E P P         R   WRQKHE  I + + AR        G      P  +   +   V+CP+C R F      RH+P CK
Sbjct:  379 LAKCSHCGRSFLSLRLQRHSTVCGKMQGSKRKVFDSSRARAKGTELEQYLNWRGPATAKAETPPP--------PRKSTWRQKHESFIRTLRHARQVQQVIARGGNPSDLPSILPADNPDYVQCPHCSRHFAPKVAERHIPKCK 513          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. UniProt/SwissProt
Match: sp|Q5PPV5|ZC21A_XENLA (Zinc finger C2HC domain-containing protein 1A OS=Xenopus laevis OX=8355 GN=zc2hc1a PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.760e-44
Identity = 121/341 (35.48%), Postives = 172/341 (50.44%), Query Frame = 1
Query:   40 MDAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLG--------PRSNASKKPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTR---SVVGRPQA-------SPSINTNNQTVPTSANIRPGSYGASAQKMP--AKTTASPMITKPT---AVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            M+  + +L+ CK CGR F P  L KH PIC K++ K+RK F+S +QRAEG+DI   K +KP   P+P  K +        W++KHE  I + ++A+  S   + G  LPPPPPP  D   V+CPYC RRFN++A +RH+ FCKEQ A++G        P+   + +P YK P LK   P A   PA+  P              +S   + +S  +S  P    +T  P     ++V  PQA       +P     N +  TS N R  +Y A     P  A    S   +KP     +R      +++ +   FCHECG  + V  A+FC ECGVRR+ +
Sbjct:    1 MEETEEELRPCKICGRTFFPATLKKHVPICQKTSVKKRKTFESSRQRAEGTDINTVKPVKP--RPEPPKKQS-------NWKRKHEEFIATIRSAKGISQILKEGGELPPPPPPSYDPDYVQCPYCQRRFNQNAADRHINFCKEQSARMGQKIKGGTDPKRKPTVRPQYKPPSLKTDSPAAVSSPASRLPQ------PPNFGKPTSGIPSGKSVANSGAPGNKYQTQSPAHKNSTMVTSPQAGGALKARTPPSLVKNPSSGTSFNKR-KTYNAENNARPEAAMGYDSSDYSKPLNDGHIR--AADNNMSGQLTKFCHECGTKYPVEWAKFCCECGVRRMVL 323          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. UniProt/SwissProt
Match: sp|Q8BJH1|ZC21A_MOUSE (Zinc finger C2HC domain-containing protein 1A OS=Mus musculus OX=10090 GN=Zc2hc1a PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 7.381e-42
Identity = 120/332 (36.14%), Postives = 160/332 (48.19%), Query Frame = 1
Query:   40 MDAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKL---GPRSNASK-----KPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNL-PTRSVVGRPQASPSINTNNQTVPTSA-NIRPGSYGASAQKMPAKTTASPMITKPTAVR----KTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +  GD  L  CK CGR F P  L KH PIC K+  K+RK FDS +QRAEG+DIP  K L                 +   WR+KHE  I + +AA+    A + G  LPPPPPP  D   ++CPYC RRFNE+A +RH+ FCKEQ A++   G  S  SK     +P YK  PLK   P        +  +G S      +TS +     +    S N P+ +    L P+   +  PQA  +    N T P+ A N   G      + +     A P     ++V     K + G S    P  FCHECG  + V  A+FC ECG+RR+ +
Sbjct:   11 VQVGD--LLPCKICGRTFFPLALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPL---------KPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDSKGKPASRPQYKPSPLKKSNPPG------IPSSGSSRLPQPSTTSKTIVGVPTGKASSVNSPLGNKPQTLSPSHRAIAAPQAGANTKARNTTPPSLARNSVAGVLTNKRKTLTENYAARPDGDYTSSVNGGNSKGIEGNSSGHLPK-FCHECGTKYPVEWAKFCCECGIRRMIL 324          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. UniProt/SwissProt
Match: sp|Q7SXT7|ZC21A_DANRE (Zinc finger C2HC domain-containing protein 1A OS=Danio rerio OX=7955 GN=zc2hc1a PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 6.950e-40
Identity = 116/363 (31.96%), Postives = 170/363 (46.83%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKP----------GEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRS-----NASKKPV---YKAP-PLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGR------PQASPSINTNNQTVPTSAN-IRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPV-------------------------GFCHECGASFTVASARFCSECGVRRLAV 993
            +L  CK CGR+F P VL KH PIC K+  K+RKVFDSG+QRAEG++I   K +KP           + P+P  K +        WR+KHE  I + +AA++ +   + G PLPPPPPP  D   ++CPYC RRF E+A +RH+ FCKEQ +++  +S     + +K P    YK P P KA  PTA+                                        SV + LP RS  G+      P + PS   + ++ P+  + +R  S   ++           M+++ +++R    G  +N K +                          FCHECG  + V SA+FC ECGV+R+ +
Sbjct:   13 ELVPCKICGRSFFPKVLKKHVPICQKTAAKRRKVFDSGRQRAEGTEISTVKPIKPKLQSSSSSSKSDKPEPPKKQS-------NWRRKHEEFIATIRAAKSINQVIKDGGPLPPPPPPSYDPDYIQCPYCQRRFGENAADRHIKFCKEQASRISNKSKLAGGDKTKPPARTQYKPPAPKKANSPTAS----------------------------------------SVSSRLPQRSAYGQGAGTGIPSSKPSSTGSIKSTPSGYSPLRNNSSSLTSPPSEGNMKPKGMVSQ-SSLRNPSTGIGMNKKKIQNADNCISRNDMKNENDFNYSTTGTKFCHECGTKYPVESAKFCCECGVKRMYI 327          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. UniProt/SwissProt
Match: sp|Q96GY0|ZC21A_HUMAN (Zinc finger C2HC domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ZC2HC1A PE=1 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 1.516e-39
Identity = 113/329 (34.35%), Postives = 156/329 (47.42%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSN---------ASKKPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGRPQASPSINTNNQTVPTSA-NIRPG-------SYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +L  CK CGR F P  L KH PIC K+  K+RK FDS +QRAEG+DIP  K                   +   WR+KHE  I + +AA+    A + G  LPPPPPP  D   ++CPYC RRFNE+A +RH+ FCKEQ A++  +            S+  VYK P LK      +  P T +       Q + +        + +   SS+     ++T  P+   +  P A  ++   N T P+ A N  PG       +Y  S    P    AS +        K + G S  + P  FCHECG  + V  A+FC ECG+RR+ +
Sbjct:   15 ELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKP---------LKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALK-----KSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNI---KGIEGHSPGNLPK-FCHECGTKYPVEWAKFCCECGIRRMIL 325          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. UniProt/SwissProt
Match: sp|A4FUE7|ZC21A_BOVIN (Zinc finger C2HC domain-containing protein 1A OS=Bos taurus OX=9913 GN=ZC2HC1A PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.236e-38
Identity = 116/339 (34.22%), Postives = 156/339 (46.02%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLG--------PRSNASKKPVYKAPPLK--------------AKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRS----VVGRPQASPSINTNNQTVPTSANIRP-GSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +L  CK CGR F P  L KH PIC K+  K+RK FDS +QRAEG+DIP  K                   +   WR+KHE  I + +AA+      + G  LPPPPPP  D   ++CPYC RRFNE+A +RH+ FCKEQ A++          +  ++ +  YK P LK                QP+ T K     P+G   S S+ S +     + S  G    +P   V TN+  R+     + R  AS  + +  +T   S   RP G Y +S                     K + G S    P  FCHECG  + V  A+FC ECGVRR+ +
Sbjct:   14 ELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKP---------LKPRPEPPKKPSNWRRKHEEFIATIRAAKGLGQVLKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKSTSRTQYKPPALKKFNSPGTTSSGSSRLPQPSGTSKTVVGAPSGKVSSVSSSSGNKLQTLSPSHKG----IPAPHVGTNIKPRNSTPPSLARNPASGVLTSKRKTYSDSYMARPDGDYISSFN---------------GGNTKGIEGNSAGHLPK-FCHECGTKYPVEWAKFCCECGVRRMVL 323          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. TrEMBL
Match: A0A315V4X1 (Uncharacterized protein (Fragment) OS=Gambusia affinis OX=33528 GN=CCH79_00004305 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.499e-43
Identity = 125/334 (37.43%), Postives = 166/334 (49.70%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRS---NASKKPV---YKAP-PLKAKQPTAT-----------QKP---ATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGRPQASPSINTNNQTV-PTSANIRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +L  CK C R F P VL KH  IC K+  K+RKVFDS +QRAEG+DIPI K LKP         +A    +   WR+KHE  I S +AA+  + A R GAPLPPPPPP  D   ++CPYC RRFNE+A +RH+ FC+EQ A++  +S   +A K P+   +K P P+K   P  T           QKP   +TV+P+G                       +S  PVK        R++ G P     +    + V P    ++   +G  A K  A T  S            +   S+ SK   FCH CGA + V SA FC ECG+RR+ +
Sbjct:   13 ELSQCKTCARFFFPSVLEKHARICQKAAVKRRKVFDSSRQRAEGTDIPILKPLKP---------VAEPPKKPSNWRKKHEDFIASIRAAKAATLAMREGAPLPPPPPPTYDPDYIQCPYCQRRFNENAADRHINFCREQAARMPNKSKLVDAKKTPLRTQFKPPGPVKKTTPPGTSALPSTSSRVPQKPLGQSTVSPSGK---------------------TNSAAPVK--------RNISGIPSPPSGVGNKAKGVSPGYGGVKNSQFGIGANKKKADTNMS-------GNDVNISNGSMKSK---FCHGCGAKYPVDSANFCCECGIRRIIL 298          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. TrEMBL
Match: M4AEC5 (Zinc finger, C2HC-type containing 1A OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 9.861e-42
Identity = 121/320 (37.81%), Postives = 163/320 (50.94%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKA--KQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPT-RSVVGRPQASPSINTNNQTVPTS-----ANIRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +L  CK C R F P VL KH  IC K+  K+RKVFDS +QRAEG+DIP+ K LKP       ++ A    +   WR+KHE  I + +AA+  + A R GAPLPPPPPP  D   ++CPYC RRFNE+A +RH+ FC+EQ A++    N +K    K  PL+   K P   +K    TP G     ++   S SS+      G S+  P     +  P  R++ G P     +    + V +        +R   +G  A K  A T  S            VG   + SK   FCH CGA + V SA FC ECG+RR+ +
Sbjct:   13 ELSQCKTCARFFFPSVLEKHARICQKAAAKRRKVFDSSRQRAEGTDIPVLKPLKPVSQTSAAAQKAEPPKKPSNWRKKHEDFIATIQAAKAATLAMREGAPLPPPPPPTYDPDYIQCPYCQRRFNENAADRHINFCREQAARM---PNKNKLVDAKKTPLRTQFKPPGPVKK---TTPPG-----TSTLPSTSSRVPQRPLGQSAVSPPGKTNSASPGRRNISGIPSPPSGVGNKAKGVSSGYGGVCGGVRNSQFGIGANKKKADTNMS-------GNDVNVGNGGMKSK---FCHACGAKYPVDSANFCCECGIRRMCI 311          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. TrEMBL
Match: A0A267FCS0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028289g1 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.527e-41
Identity = 86/152 (56.58%), Postives = 109/152 (71.71%), Query Frame = 1
Query:   43 DAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPD-SKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKL-GP 492
            D+ D  LQSC  CGR FRPDVL+KH PIC K+ +K+R+VF+SGKQRA GSD+PI K +K  + P  D +K+ AA  R   WRQ+HE  I + +AA+ Y  A  TG PLPPPPPP ID SL+ C YC RRFNE A +RH+PFC+E+ A++ GP
Sbjct:   19 DSAD--LQSCSTCGRTFRPDVLMKHSPICKKAAQKKRRVFESGKQRATGSDVPITKIIKVNQPPPRDPAKVQAAAERKHNWRQRHEDFIRNIRAAKQYQHAAETGGPLPPPPPPTIDPSLILCNYCGRRFNEKAADRHIPFCREKNARISGP 168          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. TrEMBL
Match: A0A1I8GYS4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.578e-41
Identity = 86/152 (56.58%), Postives = 109/152 (71.71%), Query Frame = 1
Query:   43 DAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPD-SKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKL-GP 492
            D+ D  LQSC  CGR FRPDVL+KH PIC K+ +K+R+VF+SGKQRA GSD+PI K +K  + P  D +K+ AA  R   WRQ+HE  I + +AA+ Y  A  TG PLPPPPPP ID SL+ C YC RRFNE A +RH+PFC+E+ A++ GP
Sbjct:   20 DSAD--LQSCSTCGRTFRPDVLMKHSPICKKAAQKKRRVFESGKQRATGSDVPITKIIKVNQPPPRDPAKVQAAAERKHNWRQRHEDFIRNIRAAKQYQHAAETGGPLPPPPPPTIDPSLILCNYCGRRFNEKAADRHIPFCREKNARISGP 169          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. TrEMBL
Match: A0A1I8HAC9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019994g1 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.283e-41
Identity = 86/152 (56.58%), Postives = 109/152 (71.71%), Query Frame = 1
Query:   43 DAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPD-SKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKL-GP 492
            D+ D  LQSC  CGR FRPDVL+KH PIC K+ +K+R+VF+SGKQRA GSD+PI K +K  + P  D +K+ AA  R   WRQ+HE  I + +AA+ Y  A  TG PLPPPPPP ID SL+ C YC RRFNE A +RH+PFC+E+ A++ GP
Sbjct:   20 DSAD--LQSCFTCGRTFRPDVLMKHSPICKKAAQKKRRVFESGKQRATGSDVPITKIIKVNQPPPRDPAKVQAAAERKHNWRQRHEDFIRNIRAAKQYQHAAETGGPLPPPPPPTIDPSLILCNYCGRRFNEKAADRHIPFCREKNARISGP 169          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Cavefish
Match: zc2hc1a (zinc finger C2HC-type containing 1A [Source:NCBI gene;Acc:103039924])

HSP 1 Score: 141.354 bits (355), Expect = 1.242e-38
Identity = 121/354 (34.18%), Postives = 161/354 (45.48%), Query Frame = 1
Query:   61 LQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPG-EIPKPDSKLAAAEARTKQ--WRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQ-KPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGRPQASPSINTNNQTVPTSA-NIRPGSYGASAQKMPAKTTASPMITKPTAV-------------RKTVGGTSVNSKPV-------------------------GFCHECGASFTVASARFCSECGVRRLAV 993
            L  CK CGR+F   VL KH PIC KS  K+RKVFDS +QRAEG+DI   K +KP  +     SK    E   KQ  WR+KHE  I + +AA+  +   + G PLPPPPPP  D   ++CPYC RRF+E+A +RH+ FCKEQ +++  +   S          KAK P  TQ KP  V                            +N       + LP RS  G+        T  Q+  TSA ++R  S G S    P++T    + + P+ V             R T  G  +N K +                          FCHECG  + V  A+FC ECGV+R+ +
Sbjct:   14 LLPCKICGRSFFSKVLKKHVPICQKSAAKRRKVFDSSRQRAEGTDISTVKPIKPKLQSSTTSSKSDKPEPPKKQSNWRRKHEEFIATIRAAKGLNQVIKDGGPLPPPPPPSYDPDYIQCPYCQRRFSENAADRHIKFCKEQASRISNKGKFSGNE-------KAKPPAKTQFKPPAVK--------------------------KANSVSSVSSSRLPQRSGYGQ-----GAGTGIQSSKTSAGSVRSMSTGFS----PSRTNLGGLTSPPSGVNMKPKGVVSQSAQRNTTPGIGINKKKIYNADNYNSRNDIKNEEELDYSTQGTKFCHECGTKYPVDWAKFCCECGVKRMCI 325          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Cavefish
Match: zc2hc1a (zinc finger C2HC-type containing 1A [Source:NCBI gene;Acc:103039924])

HSP 1 Score: 141.354 bits (355), Expect = 1.378e-38
Identity = 121/354 (34.18%), Postives = 161/354 (45.48%), Query Frame = 1
Query:   61 LQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPG-EIPKPDSKLAAAEARTKQ--WRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQ-KPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGRPQASPSINTNNQTVPTSA-NIRPGSYGASAQKMPAKTTASPMITKPTAV-------------RKTVGGTSVNSKPV-------------------------GFCHECGASFTVASARFCSECGVRRLAV 993
            L  CK CGR+F   VL KH PIC KS  K+RKVFDS +QRAEG+DI   K +KP  +     SK    E   KQ  WR+KHE  I + +AA+  +   + G PLPPPPPP  D   ++CPYC RRF+E+A +RH+ FCKEQ +++  +   S          KAK P  TQ KP  V                            +N       + LP RS  G+        T  Q+  TSA ++R  S G S    P++T    + + P+ V             R T  G  +N K +                          FCHECG  + V  A+FC ECGV+R+ +
Sbjct:   14 LLPCKICGRSFFSKVLKKHVPICQKSAAKRRKVFDSSRQRAEGTDISTVKPIKPKLQSSTTSSKSDKPEPPKKQSNWRRKHEEFIATIRAAKGLNQVIKDGGPLPPPPPPSYDPDYIQCPYCQRRFSENAADRHIKFCKEQASRISNKGKFSGNE-------KAKPPAKTQFKPPAVK--------------------------KANSVSSVSSSRLPQRSGYGQ-----GAGTGIQSSKTSAGSVRSMSTGFS----PSRTNLGGLTSPPSGVNMKPKGVVSQSAQRNTTPGIGINKKKIYNADNYNSRNDIKNEEELDYSTQGTKFCHECGTKYPVDWAKFCCECGVKRMCI 325          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Cavefish
Match: ENSAMXT00000014957.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:28110660:28118492:-1 gene:ENSAMXG00000040113.1 transcript:ENSAMXT00000014957.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.047e-13
Identity = 54/145 (37.24%), Postives = 70/145 (48.28%), Query Frame = 1
Query:   34 F*MDAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCK 468
            F +DA   QL  C+ C R F  + L KH  IC K  + +RK FDS + RA+G++  + K +K     KP             WRQKHE LI + + AR    A   G   P P   V +   V CP+C RRF      RH+P CK
Sbjct:    1 FFLDATG-QLVPCEICNRCFAEERLEKHIRICEKLQQSKRKTFDSAQFRAKGTE--LEKFMKTNIQSKPRFIF------KNNWRQKHEALIHNLRQAR----APAPGGFSPKPSLDV-NPDYVSCPHCSRRFAPGPAERHIPKCK 131          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Cavefish
Match: ENSAMXT00000054229.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:28113548:28117691:-1 gene:ENSAMXG00000040113.1 transcript:ENSAMXT00000054229.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 9.306e-12
Identity = 50/142 (35.21%), Postives = 71/142 (50.00%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAK 483
            QL  C+ C R F  + L KH  IC K  + +RK FDS + RA+G+++         +  K + +  A E +   WRQKHE LI + + AR    A   G   P P   V +   V CP+C RRF      RH+P C+  ++K
Sbjct:  570 QLVPCEICNRCFAEERLEKHIRICEKLQQSKRKTFDSAQFRAKGTELE--------KFMKTNIQRKAPEPKKNNWRQKHEALIHNLRQAR----APAPGGFSPKPSLDV-NPDYVSCPHCSRRFAPGPAERHIPKCQNIKSK 698          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Sea Lamprey
Match: zc2hc1a (zinc finger, C2HC-type containing 1A [Source:NCBI gene;Acc:324412])

HSP 1 Score: 122.094 bits (305), Expect = 2.342e-32
Identity = 113/325 (34.77%), Postives = 156/325 (48.00%), Query Frame = 1
Query:   70 CKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEA------RTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKL---GPRSNASKKPVYKA---PPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPV-----KSVKTNLPTRSVVGRPQASPSINTNNQTVPTSANIRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            C  CGR F P  L KH  +C K   K+RKVFDS +QR +G++I    TLKP        KLA+A+       +   WRQKHE  +++ +AA+  + A + G PLPPPPPP ++   V+CP C RRFNE A  RH+ FCKEQ A++   GP   AS +   +    PP  A    AT   A+         ++      +S +T SR G  +  P      KS+  + P R+  G  QA  ++N  N  + + A   P  +    +   A+T   P   +P                  FCHECG    V  A+FC ECG RR+A 
Sbjct:   17 CSVCGRTFAPQSLKKHINVCRKQATKKRKVFDSQRQRFDGTEI---STLKP--------KLASAKQSQPLPQKKSNWRQKHEEFVKTIRAAKGVTQALKEGGPLPPPPPPSLNPDYVQCPCCQRRFNEGAAERHITFCKEQAARIGRSGPSQQASSRLAVRIQVPPPACA---GATSALASRLREASPAREARTGVGKASSSTPSRRGTLARSPTPPSGYKSMGNSAPRRT--GPTQA--ALNERNDGI-SGARREPWEHSNGDETAHARTPPGPSSRRPLPR---------------FCHECGTRHPVDWAKFCCECGARRVAA 307          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009229.1 (pep scaffold:Pmarinus_7.0:GL476498:140544:146501:-1 gene:ENSPMAG00000008345.1 transcript:ENSPMAT00000009229.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 5.604e-14
Identity = 51/150 (34.00%), Postives = 72/150 (48.00%), Query Frame = 1
Query:   55 IQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIP---INKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDT-SLVECPYCHRRFNEDACNRHVPFCKEQQAKLGP 492
            + L  C  CGR F  + L KH  IC K+ +K+RKV D  K R +G+D+     NK+  P +  KP+            W+ K E L  + + AR    A+  G     PPP   +    V CP+C RRF  D   RHVP C+  +++  P
Sbjct:  191 LDLAKCHTCGRTFAKERLEKHANICTKTTQKKRKVIDFSKIRVQGTDMEKFCKNKSKTPEQAKKPN------------WKAKSEALQRTLREAR---IAQHGGKLSDLPPPAPAENPDYVSCPHCQRRFAPDVAERHVPKCQNLRSRPAP 325          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Nematostella
Match: EDO46282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQF9])

HSP 1 Score: 106.301 bits (264), Expect = 8.044e-28
Identity = 68/146 (46.58%), Postives = 92/146 (63.01%), Query Frame = 1
Query:   61 LQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEG-SDIPINKTLKPGEIPKPDSKLAAAEARTKQ--WRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLG 489
            L+ C  CGR F  D L +H+ IC K   K+RK FDS K+R EG  DI + K+ KP  I        A E + K+  W+QKHE  + + ++AR  +TA + G PLPPPPPP I+   V+CP+C RRFNE A  RH+ FCKEQ++++G
Sbjct:    1 LEPCGNCGRTFNTDTLARHQKICTKL--KKRKQFDSSKKRTEGIVDISLLKS-KPSNI--------ALELKPKRSNWKQKHEEFLATVRSARQVTTAVKRGEPLPPPPPPTINPDYVQCPHCSRRFNEHAAERHISFCKEQKSRIG 135          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Nematostella
Match: EDO29664 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T301])

HSP 1 Score: 78.5666 bits (192), Expect = 8.356e-18
Identity = 50/145 (34.48%), Postives = 78/145 (53.79%), Query Frame = 1
Query:   61 LQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPG-EIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGP 492
            L  C  CGRNF+ D L KH+ +C K++ ++RK FD  KQR  G++    K +K G    +P+ K+         WR +HE  I++ + A+  S           PPP + +   V+CP+C R+FN +   RH+P CK+ +A+  P
Sbjct:    1 LSPCSICGRNFQTDRLEKHQKVCAKNSTRKRKAFDMTKQRTAGTE--HEKYVKAGAHKQEPEKKV--------DWRAQHESFIKAIRYAKGSSD---------EPPPVMENPHYVQCPHCERKFNPETAERHIPRCKDIKARPAP 126          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Nematostella
Match: EDO38611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCJ1])

HSP 1 Score: 77.411 bits (189), Expect = 2.200e-17
Identity = 50/137 (36.50%), Postives = 65/137 (47.45%), Query Frame = 1
Query:   61 LQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXX--XXXVIDTSLVECPYCHRRFNEDACNRHVPFC 465
            L  C  CGRNF  D + KHE IC K+  KQRKVFDS K R  G++       +PG   KP+  +         WR KH+  I + + A+  S    +G  +     P    +   V C YC RRFN     RH+P C
Sbjct:    3 LVPCPNCGRNFAMDRIAKHETICRKTGTKQRKVFDSTKARTSGTEAAGYN--RPGARKKPEPAVPKG-----NWRAKHQEFIRAIRDAKKVSQHIASGGKVSDLPPPQYSENPDYVLCRYCQRRFNPTVAERHIPKC 132          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Medaka
Match: zc2hc1a (zinc finger C2HC-type containing 1A [Source:NCBI gene;Acc:101163365])

HSP 1 Score: 152.91 bits (385), Expect = 4.641e-43
Identity = 117/330 (35.45%), Postives = 158/330 (47.88%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGRPQASPS----------INTNNQTVPTSA---NIRPGSYGASAQKMPA-----KTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +L  C  C R F P VL KH  IC K+  K+RKVFDS +QRAEG+DIP+ K +KP        + A    +   WR+KHE  I + +AA++ +   + G PLPPPPPP  D   ++CPYC RRFNE A +RH+ FC+EQ A++ P       P  K P     +P A+ K    +P                         +S++P  S  + LP RS +G+    PS           NT+  T P S      R  +YG++    P      K   S M          VG   + SK   FCH CG  + V SA+FC ECGVRR+ +
Sbjct:   14 ELVQCNTCKRCFFPKVLEKHAKICQKTATKRRKVFDSSRQRAEGTDIPVLKPIKPKSQSSAGCQKAEPPKKPSNWRKKHEDFIATIRAAKSLTQVMKEGGPLPPPPPPSYDPDYIQCPYCQRRFNESAADRHIKFCQEQAARI-PTKGKLGDP-KKTPGRTQYKPPASVKKTNPSP-------------------------ASSIP--SATSRLPQRSGLGQSTGIPSNKAPSAGSVQSNTSGITSPPSGVGNKTRAPNYGSARNFQPGAGVNRKKADSFMSRNDVDGTNEVGNGGMKSK---FCHACGTKYPVESAKFCCECGVRRMCI 311          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Medaka
Match: zc2hc1a (zinc finger C2HC-type containing 1A [Source:NCBI gene;Acc:101163365])

HSP 1 Score: 142.51 bits (358), Expect = 2.996e-39
Identity = 115/330 (34.85%), Postives = 155/330 (46.97%), Query Frame = 1
Query:   58 QLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGRPQASPS----------INTNNQTVPTSA---NIRPGSYGASAQKMPA-----KTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            +L  C  C R F P VL KH  IC K+  K+RKVFDS +QRAEG+DIP+ K +            A    +   WR+KHE  I + +AA++ +   + G PLPPPPPP  D   ++CPYC RRFNE A +RH+ FC+EQ A++ P       P  K P     +P A+ K    +P                         +S++P  S  + LP RS +G+    PS           NT+  T P S      R  +YG++    P      K   S M          VG   + SK   FCH CG  + V SA+FC ECGVRR+ +
Sbjct:   14 ELVQCNTCKRCFFPKVLEKHAKICQKTATKRRKVFDSSRQRAEGTDIPVLKPI---------KPKAEPPKKPSNWRKKHEDFIATIRAAKSLTQVMKEGGPLPPPPPPSYDPDYIQCPYCQRRFNESAADRHIKFCQEQAARI-PTKGKLGDP-KKTPGRTQYKPPASVKKTNPSP-------------------------ASSIP--SATSRLPQRSGLGQSTGIPSNKAPSAGSVQSNTSGITSPPSGVGNKTRAPNYGSARNFQPGAGVNRKKADSFMSRNDVDGTNEVGNGGMKSK---FCHACGTKYPVESAKFCCECGVRRMCI 302          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Planmine SMEST
Match: SMESG000054669.1 (SMESG000054669.1)

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 315/318 (99.06%), Postives = 316/318 (99.37%), Query Frame = 1
Query:   40 MDAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQKPATVTPNGYXXXXXXXXXXXXXXXXXXXXGMSSNLPVKSVKTNLPTRSVVGRPQASPSINTNNQTVPTSANIRPGSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 993
            MDAGDIQLQ CKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAPLPPPPPPVIDTSLV+CPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQKPATVTPNGYSGSQSTQSTSMSSQNTASRSGMSSNLPVKSVKTNLPTRSVVGRPQASPSINTNNQTVPTSANIRPGSYGASAQK PAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV
Sbjct:    1 MDAGDIQLQPCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAPLPPPPPPVIDTSLVKCPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQKPATVTPNGYSGSQSTQSTSMSSQNTASRSGMSSNLPVKSVKTNLPTRSVVGRPQASPSINTNNQTVPTSANIRPGSYGASAQKTPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASFTVASARFCSECGVRRLAV 318          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Planmine SMEST
Match: SMESG000022203.1 (SMESG000022203.1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.226e-14
Identity = 57/170 (33.53%), Postives = 88/170 (51.76%), Query Frame = 1
Query:   61 LQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGE--IPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLGPRSNASKKPVYKAPPLKAKQPTATQ 564
            L SC+ C R F P  L KH+  C  S     K+ +   + +  +D         G+  I   +  LA    R   WR +HE  + +  AAR+Y+ A  +G PLPPPPPP+++  L +CP+C R+F+E A  RH+  CKEQ  +     N  ++P Y+   ++AK+  A +
Sbjct:   44 LTSCEFCNRTFLPGSLSKHKRGCYNS---WLKLKERESKMSNNTDKGFITNGYQGDKPILTIEQMLAKRRQRRLNWRLRHEEFMRAVHAARDYADAVASGNPLPPPPPPIVEPDLRQCPHCQRKFHEKAIERHIVRCKEQSIR-----NNKERPSYQT--MEAKRRLAVR 203          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Planmine SMEST
Match: SMESG000024917.1 (SMESG000024917.1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.031e-12
Identity = 44/151 (29.14%), Postives = 76/151 (50.33%), Query Frame = 1
Query:   55 IQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGS---DIPINKTLKP--GEIPKP--DSKLAAAEARTKQWRQKHEMLIESFKAARNYSTAKRTGAXXXXXXXXV-IDTSLVECPYCHRRFNEDACNRHVPFCKEQQAK 483
            + L  C+ C R F PD LVKH  +C K         D  K++++GS   ++  +K+ +   G++P       +   + R   WR +HE  I+S + AR Y+ +  +G  +PP    + +  ++ +C YC R F +D+  +H+  CKE   K
Sbjct:   22 VILSPCEFCQRTFLPDSLVKHRKVCYK---------DYLKKKSQGSKKTNMSRSKSAQNNCGDLPGMSCSELMVKRQIRRMHWRGRHEEFIQSIREAREYAISANSGIKIPPSNISLDLKENMQQCKYCLRNFQKDSFEKHLKRCKEYSIK 163          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Planmine SMEST
Match: SMESG000009557.1 (SMESG000009557.1)

HSP 1 Score: 60.4622 bits (145), Expect = 9.015e-10
Identity = 43/149 (28.86%), Postives = 68/149 (45.64%), Query Frame = 1
Query:   55 IQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEGSDIPINKTLKPGEIPKPDSKLAAAEA----RTKQWRQKHEMLIESFKAARNYSTA-KRTGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKL 486
             QLQ C  C R+F+ + L KH+ IC K N K+R  FDS KQR     +P+ +  +    P P S           + ++W +  E         R+   +  R  A            +++ECP+C R F E +  RH+ FC+E  +++
Sbjct:   10 YQLQKCDICNRSFQTNSLEKHQNICRKVNSKKRPAFDSKKQRT----VPLPEDYRGPIKPVPPSNKGNIHTLNGTQFQRWSKPSEKQKRIPSKTRSLDDSIFRNHAKPRSLYNS--KKAMIECPHCLRLFQEGSAERHIKFCEEIHSRI 152          
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Planmine SMEST
Match: SMESG000036198.1 (SMESG000036198.1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.737e-6
Identity = 22/71 (30.99%), Postives = 38/71 (53.52%), Query Frame = 1
Query:  280 WRQKHEMLIESFKAARNYSTAKR------TGAXXXXXXXXVIDTSLVECPYCHRRFNEDACNRHVPFCKEQ 474
            WRQ+H+  + + K  R  S   +       G         +  +SLV+CP+C+R+FN DA + H+P C+++
Sbjct:  209 WRQQHQDTLNAIKRDRERSERAQGTNWPEFGPGQTSFEYEMHQSSLVQCPHCNRKFNMDAASHHIPHCRQK 279          
The following BLAST results are available for this feature:
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZC2HC1A3.157e-4034.35zinc finger C2HC-type containing 1A [Source:HGNC S... [more]
ZC2HC1B8.194e-2443.84zinc finger C2HC-type containing 1B [Source:HGNC S... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T03G11.39.621e-2039.16Zinc finger C2HC domain-containing protein T03G11.... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG426756.728e-2036.43gene:FBgn0261561 transcript:FBtr0302726[more]
CG426754.315e-1936.43gene:FBgn0261561 transcript:FBtr0302725[more]
CG426754.315e-1936.43gene:FBgn0261561 transcript:FBtr0303165[more]
CG426754.315e-1936.43gene:FBgn0261561 transcript:FBtr0302724[more]
CG426757.214e-1936.43gene:FBgn0261561 transcript:FBtr0302727[more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zc2hc1a4.805e-4231.92zinc finger, C2HC-type containing 1A [Source:NCBI ... [more]
zc2hc1a1.402e-3631.73zinc finger, C2HC-type containing 1A [Source:NCBI ... [more]
zc2hc1a4.795e-3143.50zinc finger, C2HC-type containing 1A [Source:NCBI ... [more]
zc2hc1c7.236e-1233.08zinc finger, C2HC-type containing 1C [Source:ZFIN;... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zc2hc1a5.898e-4032.29zinc finger, C2HC-type containing 1A [Source:NCBI ... [more]
zc2hc1a2.573e-3033.78zinc finger, C2HC-type containing 1A [Source:NCBI ... [more]
zc2hc1a1.914e-2930.95zinc finger, C2HC-type containing 1A [Source:NCBI ... [more]
ENSXETT00000006755.15.365e-1334.69zinc finger, C2HC-type containing 1C [Source:NCBI ... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zc2hc1a1.055e-4236.14zinc finger, C2HC-type containing 1A [Source:MGI S... [more]
Zc2hc1a3.246e-4034.56zinc finger, C2HC-type containing 1A [Source:MGI S... [more]
Zc2hc1b1.331e-2742.57zinc finger, C2HC-type containing 1B [Source:MGI S... [more]
Zc2hc1c2.712e-1231.47zinc finger, C2HC-type containing 1C [Source:MGI S... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5PPV5|ZC21A_XENLA2.760e-4435.48Zinc finger C2HC domain-containing protein 1A OS=X... [more]
sp|Q8BJH1|ZC21A_MOUSE7.381e-4236.14Zinc finger C2HC domain-containing protein 1A OS=M... [more]
sp|Q7SXT7|ZC21A_DANRE6.950e-4031.96Zinc finger C2HC domain-containing protein 1A OS=D... [more]
sp|Q96GY0|ZC21A_HUMAN1.516e-3934.35Zinc finger C2HC domain-containing protein 1A OS=H... [more]
sp|A4FUE7|ZC21A_BOVIN2.236e-3834.22Zinc finger C2HC domain-containing protein 1A OS=B... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A315V4X12.499e-4337.43Uncharacterized protein (Fragment) OS=Gambusia aff... [more]
M4AEC59.861e-4237.81Zinc finger, C2HC-type containing 1A OS=Xiphophoru... [more]
A0A267FCS01.527e-4156.58Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GYS41.578e-4156.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HAC93.283e-4156.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zc2hc1a1.242e-3834.18zinc finger C2HC-type containing 1A [Source:NCBI g... [more]
zc2hc1a1.378e-3834.18zinc finger C2HC-type containing 1A [Source:NCBI g... [more]
ENSAMXT00000014957.21.047e-1337.24pep primary_assembly:Astyanax_mexicanus-2.0:9:2811... [more]
ENSAMXT00000054229.19.306e-1235.21pep primary_assembly:Astyanax_mexicanus-2.0:9:2811... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zc2hc1a2.342e-3234.77zinc finger, C2HC-type containing 1A [Source:NCBI ... [more]
ENSPMAT00000009229.15.604e-1434.00pep scaffold:Pmarinus_7.0:GL476498:140544:146501:-... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO462828.044e-2846.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296648.356e-1834.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386112.200e-1736.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zc2hc1a4.641e-4335.45zinc finger C2HC-type containing 1A [Source:NCBI g... [more]
zc2hc1a2.996e-3934.85zinc finger C2HC-type containing 1A [Source:NCBI g... [more]
back to top
BLAST of Zinc finger C2HC domain-containing protein 1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054669.10.000e+099.06SMESG000054669.1[more]
SMESG000022203.14.226e-1433.53SMESG000022203.1[more]
SMESG000024917.17.031e-1229.14SMESG000024917.1[more]
SMESG000009557.19.015e-1028.86SMESG000009557.1[more]
SMESG000036198.13.737e-630.99SMESG000036198.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023406 ID=SMED30023406|Name=Zinc finger C2HC domain-containing protein 1A|organism=Schmidtea mediterranea sexual|type=transcript|length=1122bp
AAATTTTTTTTGTAACAAAGCAACGCATAAATATTTTAAATGGATGCAGG
TGATATACAATTACAGTCTTGTAAATGTTGCGGTCGAAATTTCAGACCTG
ATGTTTTAGTTAAACATGAACCGATATGTATAAAGAGTAACAGGAAACAA
CGAAAAGTGTTTGACAGTGGTAAGCAAAGAGCAGAAGGAAGCGATATTCC
AATAAATAAAACTTTAAAACCTGGTGAAATACCCAAACCAGATTCTAAAT
TAGCTGCAGCAGAAGCGCGAACAAAACAATGGAGACAAAAGCATGAAATG
CTAATTGAATCTTTTAAGGCTGCTCGTAATTATAGTACAGCAAAACGAAC
AGGAGCTCCATTGCCACCGCCTCCCCCACCAGTTATAGATACTAGCCTCG
TTGAATGTCCTTATTGTCATAGAAGATTCAACGAAGATGCTTGCAATAGA
CATGTTCCTTTCTGCAAAGAACAACAGGCCAAATTGGGCCCCAGGAGTAA
TGCCTCCAAAAAACCTGTGTATAAAGCACCTCCATTAAAAGCTAAGCAGC
CGACAGCAACTCAAAAACCTGCTACAGTTACACCTAATGGATACAGCGGT
TCACAATCTACTCAATCAACCTCGATGTCATCTCAAAATACTGCTAGTCG
CAGTGGAATGTCTTCCAACTTACCTGTAAAATCTGTTAAAACAAATTTAC
CAACAAGAAGTGTTGTGGGCCGTCCACAAGCATCTCCATCTATCAATACA
AATAATCAAACAGTTCCAACAAGTGCGAATATTCGCCCTGGTTCATATGG
CGCCTCTGCCCAAAAGATGCCTGCAAAAACCACTGCTTCACCAATGATAA
CCAAGCCTACAGCTGTAAGAAAAACAGTTGGTGGAACAAGTGTGAATTCA
AAACCCGTGGGATTTTGTCACGAATGTGGGGCCTCATTTACTGTTGCCAG
TGCCAGATTTTGCTCCGAGTGTGGAGTTCGTAGATTGGCAGTTTAATGGG
GAAATTTTATCAATTTTCAAAATTGAGTTAATGACTTGTGATTTATTTAT
TTGGAGTTTTTATATGATAAATATTTGAATGAATCTTTTTTATTAAACAG
TTAGTGAATTTTATTTTAAGAT
back to top

protein sequence of SMED30023406-orf-1

>SMED30023406-orf-1 ID=SMED30023406-orf-1|Name=SMED30023406-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=319bp
MDAGDIQLQSCKCCGRNFRPDVLVKHEPICIKSNRKQRKVFDSGKQRAEG
SDIPINKTLKPGEIPKPDSKLAAAEARTKQWRQKHEMLIESFKAARNYST
AKRTGAPLPPPPPPVIDTSLVECPYCHRRFNEDACNRHVPFCKEQQAKLG
PRSNASKKPVYKAPPLKAKQPTATQKPATVTPNGYSGSQSTQSTSMSSQN
TASRSGMSSNLPVKSVKTNLPTRSVVGRPQASPSINTNNQTVPTSANIRP
GSYGASAQKMPAKTTASPMITKPTAVRKTVGGTSVNSKPVGFCHECGASF
TVASARFCSECGVRRLAV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000422tail stripe
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR026319ZC2HC1
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13913zf-C2HC_2coord: 7..30
e-value: 1.5E-9
score: 37.5
coord: 120..143
e-value: 9.5E-7
score: 28.6
NoneNo IPR availableGENE3DG3DSA:3.30.60.150coord: 116..161
e-value: 9.6E-7
score: 30.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 172..239
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 147..239
NoneNo IPR availablePANTHERPTHR13555:SF25ZINC FINGER C2HC DOMAIN-CONTAINING PROTEIN 1Acoord: 7..317
IPR026319Zinc finger C2HC domain-containing proteinPANTHERPTHR13555C2H2 ZINC FINGER CGI-62-RELATEDcoord: 7..317