Secretory carrier-associated membrane protein

Overview
NameSecretory carrier-associated membrane protein
Smed IDSMED30023392
Length (bp)1464
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Secretory carrier-associated membrane protein (SMED30023392) t-SNE clustered cells

Violin plots show distribution of expression levels for Secretory carrier-associated membrane protein (SMED30023392) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Secretory carrier-associated membrane protein (SMED30023392) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Secretory carrier-associated membrane protein (SMED30023392) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023392

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30023392SMESG000075964.1 dd_Smed_v4_2473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30023392SMESG000075964.1 dd_Smed_v4_2473_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP1 (secretory carrier membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:10563])

HSP 1 Score: 173.711 bits (439), Expect = 1.091e-49
Identity = 111/256 (43.36%), Postives = 167/256 (65.23%), Query Frame = 2
Query:  206 EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            +PA+++     P   +      +  A+L +RQ ELE +A EL R+E E +   +   G   N+PPLPS FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+ +    FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G +  G+CGWI SL  L ++I VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   34 QPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQN--LSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFC---VDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 284          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP1 (secretory carrier membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:10563])

HSP 1 Score: 174.481 bits (441), Expect = 1.428e-49
Identity = 115/282 (40.78%), Postives = 175/282 (62.06%), Query Frame = 2
Query:  179 LNDFNPFEN-----------------EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            L+++NPF +                 +PA+++     P   +      +  A+L +RQ ELE +A EL R+E E +   +   G   N+PPLPS FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+ +    FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G +  G+CGWI SL  L ++I VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   34 LDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQN--LSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFC---VDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP2 (secretory carrier membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:10564])

HSP 1 Score: 154.066 bits (388), Expect = 4.235e-42
Identity = 117/315 (37.14%), Postives = 183/315 (58.10%), Query Frame = 2
Query:   80 MSWNDNNPDFNPFAVXXXXXXXXXXXXTVQTETLNDFNPFE----------------NEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELK-KSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            MS  D NP  +P  V P ++             L +FNPF                 ++PAV+Q +  EP +    +  +   A L R+Q EL+ +A EL RKE E +           N+PPLPSW P+KPCFYQ+   EIP +Y+++ +  +Y+W+ +   +F+N+   L++    + +   G  FG+S+L FL+F+P +++CW+R +YKAFRSD+SF+FF+FFF+FF Q+ I IIQ++GI  LG  GWI +L+ L   S+ +   M +++G +T   V    L  +VH +YR TGASF++A+ EFS+ + S+
Sbjct:    1 MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPS-VEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSK---GVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQGIFSS 311          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP3 (secretory carrier membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:10565])

HSP 1 Score: 144.05 bits (362), Expect = 2.199e-38
Identity = 97/225 (43.11%), Postives = 144/225 (64.00%), Query Frame = 2
Query:  326 ELTRKEEEQRRRYMEFQGNI--------KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            EL RK EE  RR  E Q            N+PPLPS+ P++PCF+Q+I +EIP E+++ V   +Y+W+     + +N    L+   S  VE ++G  FG+S+L  LLF+P S++CW+R +YKAFRSDSSFNFF+FFFIFF Q ++ ++Q +GI   G  GWI +L   K +  V   M +++ L+T + V G ++  ++H +YR TGASF+KA+ EF+  + SNP
Sbjct:   79 ELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLA---SFCVETNNGAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNP 300          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP3 (secretory carrier membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:10565])

HSP 1 Score: 144.05 bits (362), Expect = 2.199e-38
Identity = 97/225 (43.11%), Postives = 144/225 (64.00%), Query Frame = 2
Query:  326 ELTRKEEEQRRRYMEFQGNI--------KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            EL RK EE  RR  E Q            N+PPLPS+ P++PCF+Q+I +EIP E+++ V   +Y+W+     + +N    L+   S  VE ++G  FG+S+L  LLF+P S++CW+R +YKAFRSDSSFNFF+FFFIFF Q ++ ++Q +GI   G  GWI +L   K +  V   M +++ L+T + V G ++  ++H +YR TGASF+KA+ EF+  + SNP
Sbjct:   79 ELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLA---SFCVETNNGAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNP 300          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 136.732 bits (343), Expect = 5.481e-36
Identity = 103/285 (36.14%), Postives = 157/285 (55.09%), Query Frame = 2
Query:  161 TVQTETLNDFNPFENEPAVIQANYTEPKKNETNSFQTITNADXX-XXXXXXXXXANELTRKEEEQRRRYMEFQGNI-------------KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            T++TE   DFNPF N      A  T  +   +   ++    D   R+Q++LE RA EL  +EEE  RR     G                N+PPLP+  P++PCFYQ+I+VEIP+++++ V + +Y+++ YV  + +N+  +L YMI     G S     ++ +   LFSP S++ WFR +YKAFR+DSSFNF +FFF+ F   I   +Q LG++   +CGWI +L     S+ +   M I +  +T  L        KVHR+YR  G S +KA+ EF+  + S+
Sbjct:   31 TIETE---DFNPFANRAGGSNAQPTTHQSTGSLGNKSAGMDDELFRKQQDLERRAQELRMREEELDRRQRSAAGGNNLNTNAQNNAPRPHNWPPLPTIIPIEPCFYQDIEVEIPVQFQKTVTFAYYVFLMYVLALVVNVLASLFYMI---FAGGSIGQLFLACIQLALFSPCSFLFWFRPVYKAFRNDSSFNFMVFFFVLFFHCIFTFVQTLGLSNY-ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAGFSIDKARQEFTNGVMSD 308          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 130.954 bits (328), Expect = 1.234e-34
Identity = 85/231 (36.80%), Postives = 130/231 (56.28%), Query Frame = 2
Query:  320 ANELTRKEEEQRRRYMEFQGNI-------------KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            A EL  +EEE  RR     G                N+PPLP+  P++PCFYQ+I+VEIP+++++ V + +Y+++ YV  + +N+  +L YMI       S     ++ +   LFSP S++ WFR +YKAFR+DSSFNF +FFF+ F   I   +Q LG++   +CGWI +L     S+ +   M I +  +T  L        KVHR+YR  G S +KA+ EF+  + S+
Sbjct:   16 AQELRMREEELDRRQRSAAGGNNLNTNAQNNAPRPHNWPPLPTIIPIEPCFYQDIEVEIPVQFQKTVTFAYYVFLMYVLALVVNVLASLFYMIFAG---GSIGQLFLACIQLALFSPCSFLFWFRPVYKAFRNDSSFNFMVFFFVLFFHCIFTFVQTLGLSNY-ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAGFSIDKARQEFTNGVMSD 242          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 72.7886 bits (177), Expect = 9.559e-15
Identity = 59/156 (37.82%), Postives = 87/156 (55.77%), Query Frame = 2
Query:  509 YVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            YV  + +N+  +L YMI     G S     ++ +   LFSP S++ WFR +YKAFR+DSSFNF +FFF+ F   I   +Q LG++   +CGWI +L     S+ +   M I +  +T  L        KVHR+YR  G S +KA+ EF+  + S+ 
Sbjct:    2 YVLALVVNVLASLFYMI---FAGGSIGQLFLACIQLALFSPCSFLFWFRPVYKAFRNDSSFNFMVFFFVLFFHCIFTFVQTLGLSNY-ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAGFSIDKARQEFTNGVMSDA 153          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Match: Scamp (gene:FBgn0040285 transcript:FBtr0332591)

HSP 1 Score: 154.836 bits (390), Expect = 1.372e-42
Identity = 112/285 (39.30%), Postives = 163/285 (57.19%), Query Frame = 2
Query:  176 TLNDFNPFE------------NEPAVIQANYTEPKKNETNSF-QTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNI---KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELK---KSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            +L D+NPFE            N  AV+Q         +T+S   +  +  ++    EL+ R  EL RK  E  RR  + QGN+    N+PPLP  F +KPCFYQ+ +VEIP E+++LV+  +YIWI Y   +  N+ G L  +            F +++   +LFSPASY+CWFR  YKAFR+DSSFNF +FFFI+F Q +  I+Q +G N +G CG+I ++ +       I VG  +  ++  +TAV V+  ++  K+H IYRSTGAS  KA+AEF+ +   N
Sbjct:   39 SLEDYNPFEEQAKPQLQINSTNTAAVVQPLSQNIPPPQTSSLGASAPSTSIQITSEELQRRQEELDRKAAELDRREQQLQGNVPQLNNWPPLPDNFCVKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLF----HAGEFETFFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFITAIGQFDGQASGIIVGILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEFTTEFLRN 319          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Match: Scamp (gene:FBgn0040285 transcript:FBtr0074079)

HSP 1 Score: 154.836 bits (390), Expect = 1.372e-42
Identity = 112/285 (39.30%), Postives = 163/285 (57.19%), Query Frame = 2
Query:  176 TLNDFNPFE------------NEPAVIQANYTEPKKNETNSF-QTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNI---KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELK---KSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            +L D+NPFE            N  AV+Q         +T+S   +  +  ++    EL+ R  EL RK  E  RR  + QGN+    N+PPLP  F +KPCFYQ+ +VEIP E+++LV+  +YIWI Y   +  N+ G L  +            F +++   +LFSPASY+CWFR  YKAFR+DSSFNF +FFFI+F Q +  I+Q +G N +G CG+I ++ +       I VG  +  ++  +TAV V+  ++  K+H IYRSTGAS  KA+AEF+ +   N
Sbjct:   39 SLEDYNPFEEQAKPQLQINSTNTAAVVQPLSQNIPPPQTSSLGASAPSTSIQITSEELQRRQEELDRKAAELDRREQQLQGNVPQLNNWPPLPDNFCVKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLF----HAGEFETFFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFITAIGQFDGQASGIIVGILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEFTTEFLRN 319          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp1 (secretory carrier membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1803])

HSP 1 Score: 169.474 bits (428), Expect = 5.812e-48
Identity = 128/314 (40.76%), Postives = 176/314 (56.05%), Query Frame = 2
Query:  104 DFNPFAVXXXXXXXXXXXXTVQTET----LNDFNPFENEPAV--------------IQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQ------GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            D NPFA P   N       T  T T    L ++NPF +   V               Q    +P +      Q+    D  R Q EL  R  EL RK  E  RR  E Q      G   N+PPLP  FP+ PCFY +I V+IP+EY++ V+  +Y+W+ +   +F NIFG LS+     V+ S G  FG+++L F+LF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q +GI   G+ GWI +L  L  SI VG  M +I+ L+TA  V   I+F KVH +YR+TGASFEKA+ EF+  + +N
Sbjct:    5 DSNPFADPDFSNPFQDPSVTQVTRTAPPGLEEYNPFTDTKPVPPGSAPKSVPPTTNTQPAIMKPTEEPPAYTQSQQTPDQSRAQAELLRRQEELERKAAELDRREREMQSLNASGGRKNNWPPLPEKFPVGPCFYHDISVDIPVEYQKTVKIMYYLWMFHTGTLFANIFGCLSWFC---VDASRGVDFGLAMLWFMLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAIGITGWGASGWISALTGLNTSIPVGIIMILIAALFTASAVISLIMFKKVHALYRTTGASFEKAQQEFATGVMAN 315          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp2l (secretory carrier membrane protein 2, like [Source:ZFIN;Acc:ZDB-GENE-030131-6432])

HSP 1 Score: 150.214 bits (378), Expect = 6.868e-41
Identity = 122/313 (38.98%), Postives = 186/313 (59.42%), Query Frame = 2
Query:   80 MSWNDNNPDFNPFAVXXXXXXXXXXXXTVQTETLNDFNPFE---------------NEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            MS  DNNP   P  V P ++           + + ++NPF                ++PAV+Q       +    S Q    A+L R+Q ELE +A EL RKE+E R R    +G   N+PPLP + P+KPCFYQ+ + EIP+EY+++ +  +Y+W+ +   +F+N+   L Y     V   +G  FG+S+L F+LF+P +++CW+R +YKAF+SDSSF+FF FFFIF  Q+I+ IIQ +GI   G+ GWI +++ +K +I +  FM +++G +T   V   IL   VH +YR TGASF+KA+ EFS+ + +N
Sbjct:    1 MSGFDNNPFAEPVDVNPFQDPSVTQVTNTSADGIGEYNPFTAGALDGHRTVPLSATSQPAVLQTTVEPSPQASVASGQ----AELLRQQAELERKAAELERKEQELRDRDAA-RGKENNWPPLPKFLPIKPCFYQDFNEEIPVEYQRVCKMMYYLWMYHSVTLFLNLLACLVYF---TVSTQNGVDFGLSILWFILFTPVAFVCWYRPVYKAFKSDSSFSFFFFFFIFSFQVIVYIIQSVGIPGWGNSGWITAISVIKTNIALSVFMMVVAGFFTVNAVFSVILLKMVHSMYRHTGASFQKAQEEFSQGVVTN 305          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp3 (secretory carrier membrane protein 3 [Source:ZFIN;Acc:ZDB-GENE-041114-33])

HSP 1 Score: 145.976 bits (367), Expect = 3.953e-39
Identity = 119/321 (37.07%), Postives = 173/321 (53.89%), Query Frame = 2
Query:   92 DNNPDFNPFAVXXXXXXXXXXXXTVQTETLNDFNPFENEPAVIQANY-------------------TEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNI--------KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            D++ D NPF           +       TL+ +NPF+N        Y                   TEP+   +   Q+  NA      ++      EL RK +E  RR  E   +          N+PPLPS+ P+ PCFYQ+I++EI   +++ V   +Y W+     + IN+   L+      V+ ++G  FG+++L FLLF+P S++CW+R +YKAFRSDSSFNFF FFF+FFAQL++ ++  +GI   G  GWI+SLA L  S  VGA M + + L+TA L  G +L  +VH +YR T ASFEKA+AEF+  + SN
Sbjct:    9 DSSDDHNPF----QDPSVTQHSSNTGYATLDLYNPFDNNQTAPPPPYEATSPAAPPAQTPPSRTTPTEPRNYGSYGSQSAVNATTADLLKKQ----EELERKAQELERRERELNAHALGSGASRQNNWPPLPSFCPVGPCFYQDINLEISQSFQRTVTTMYYYWMFTACTLLINLISCLAVFC---VDPNNGVGFGLAILWFLLFTPCSFVCWYRPVYKAFRSDSSFNFFAFFFVFFAQLVLYVMMTIGIPGWGFSGWIVSLAALSTSKAVGAIMMMNAVLFTAQLAMGIVLLKRVHSMYRQTEASFEKAQAEFATGVLSN 318          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp4 (secretory carrier membrane protein 4 [Source:ZFIN;Acc:ZDB-GENE-050913-40])

HSP 1 Score: 128.642 bits (322), Expect = 5.702e-34
Identity = 88/197 (44.67%), Postives = 120/197 (60.91%), Query Frame = 2
Query:  386 KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
             NFPPLP +  +KPCFYQ  D EIP  +RQLVR  + +W+ Y   + +N+ G +++         + T FG SLL  L+FSP SY CWFR LYKAFR+DSSFNF  FFFIFF Q ++  IQ LGI+  G CGWI ++      +    FM I + L+T   +  + +  KVHR+YR  G SF++A+ E++     NP
Sbjct:    6 NNFPPLPKFLRIKPCFYQNFDEEIPQPHRQLVRRVYNLWMLYSMTLCVNVVGCIAWWAGGG----NATNFGFSLLWLLIFSPCSYTCWFRPLYKAFRADSSFNFMAFFFIFFLQCVLAFIQSLGISGWGVCGWIATVIFFGTDVVAAIFMLICTLLFTVNALLMAFVLIKVHRLYRGGGGSFQRAQEEWTTGAWKNP 198          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp4 (secretory carrier membrane protein 4 [Source:ZFIN;Acc:ZDB-GENE-050913-40])

HSP 1 Score: 128.642 bits (322), Expect = 5.702e-34
Identity = 88/197 (44.67%), Postives = 120/197 (60.91%), Query Frame = 2
Query:  386 KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
             NFPPLP +  +KPCFYQ  D EIP  +RQLVR  + +W+ Y   + +N+ G +++         + T FG SLL  L+FSP SY CWFR LYKAFR+DSSFNF  FFFIFF Q ++  IQ LGI+  G CGWI ++      +    FM I + L+T   +  + +  KVHR+YR  G SF++A+ E++     NP
Sbjct:    6 NNFPPLPKFLRIKPCFYQNFDEEIPQPHRQLVRRVYNLWMLYSMTLCVNVVGCIAWWAGGG----NATNFGFSLLWLLIFSPCSYTCWFRPLYKAFRADSSFNFMAFFFIFFLQCVLAFIQSLGISGWGVCGWIATVIFFGTDVVAAIFMLICTLLFTVNALLMAFVLIKVHRLYRGGGGSFQRAQEEWTTGAWKNP 198          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 168.318 bits (425), Expect = 2.207e-47
Identity = 111/256 (43.36%), Postives = 166/256 (64.84%), Query Frame = 2
Query:  206 EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            +PA++         N+ +    I  A+L +RQ ELE++A EL R+E E +    +  G   N+PPLP  FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+   G  FG+++L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G    G+CGWI +L  L +SI VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   61 QPAIMNPTEEPSAYNQISKEHAIAQAELLKRQEELEKKAAELDRREREMQS-LNQPGGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHTVTLFVNIFGCLAWFC---VDSGRGVDFGLAILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 168.318 bits (425), Expect = 2.568e-47
Identity = 111/256 (43.36%), Postives = 166/256 (64.84%), Query Frame = 2
Query:  206 EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            +PA++         N+ +    I  A+L +RQ ELE++A EL R+E E +    +  G   N+PPLP  FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+   G  FG+++L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G    G+CGWI +L  L +SI VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   61 QPAIMNPTEEPSAYNQISKEHAIAQAELLKRQEELEKKAAELDRREREMQS-LNQPGGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHTVTLFVNIFGCLAWFC---VDSGRGVDFGLAILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 168.318 bits (425), Expect = 3.824e-47
Identity = 111/256 (43.36%), Postives = 166/256 (64.84%), Query Frame = 2
Query:  206 EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            +PA++         N+ +    I  A+L +RQ ELE++A EL R+E E +    +  G   N+PPLP  FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+   G  FG+++L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G    G+CGWI +L  L +SI VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   61 QPAIMNPTEEPSAYNQISKEHAIAQAELLKRQEELEKKAAELDRREREMQS-LNQPGGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHTVTLFVNIFGCLAWFC---VDSGRGVDFGLAILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp2 (secretory carrier membrane protein 2 [Source:NCBI gene;Acc:407901])

HSP 1 Score: 147.517 bits (371), Expect = 9.478e-40
Identity = 117/317 (36.91%), Postives = 184/317 (58.04%), Query Frame = 2
Query:   80 MSWNDNNPDFNPFAVXXXXXXXXXXXXTVQTETLNDFNPF-------------------ENEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            MS  D NP  +P  V P ++             L +FNPF                   +++PAV+Q +     +    + QT     L ++Q ELE +A +L RKE+E R   +  + N  N+PPLP   P+KPCFYQ+I V+IP +Y++  +  +Y+W+ +   +F+N+   LSY  + +     G  FG+S+L F++F+P +++CW+R +YKAFR+DSSF+FF+FF IFF Q++I IIQ +GI   G  GWI++L+ +K +I V   M +++  +T   V    L  +VH +YR TGASF++A+ EFS+ + SN
Sbjct:    1 MSGYDTNPFADPVDVNPFQDPSVTQITAGNHGNLEEFNPFSEGSHLTNPNQKTIPAQPAQSQPAVLQPSVEPTPQAAAMAAQT----GLLQQQEELERKAADLDRKEQEMRNVNINLRQN--NWPPLPPKCPIKPCFYQDISVDIPADYQRTCKMLYYLWMLHTFTLFLNLLACLSYFTAVST---GGVDFGLSILWFVMFTPCAFLCWYRPIYKAFRTDSSFSFFVFFIIFFCQIVIYIIQAVGIPGWGDSGWIMALSMIKTNIAVTVIMIVVASFFTVCSVFSLFLLKRVHSMYRRTGASFQRAQEEFSQGILSN 308          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp5 (secretory carrier membrane protein 5 gene 2 [Source:NCBI gene;Acc:779947])

HSP 1 Score: 132.494 bits (332), Expect = 3.337e-35
Identity = 86/196 (43.88%), Postives = 121/196 (61.73%), Query Frame = 2
Query:  389 NFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            NFPPLP + P+KPCFYQ+ D +IP  +R   +  +Y+W+     + +N+ G L+++I       S T FG++ L  +LF+P SY+CWFR +YKAF++DSSFNF  FFF F  QL+I IIQ +GI   G CGWI +++    SIG    M I + ++TAV V   +   KVHR YR  G S  KA+ E++     NP
Sbjct:    7 NFPPLPRFIPLKPCFYQDFDTDIPDLHRTTAKRLYYLWMLNSITLGVNLIGCLAWLIGGG----SATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFNFMAFFFTFTGQLVISIIQAVGIPGWGVCGWIATISFFGTSIGAAVVMLIPTIMFTAVAVLSFVALTKVHRFYRGAGGSLSKAQEEWTTGAWKNP 198          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 176.022 bits (445), Expect = 5.597e-51
Identity = 113/256 (44.14%), Postives = 167/256 (65.23%), Query Frame = 2
Query:  206 EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            +PA+++     P   +      +  A+L +RQ ELE +A EL R+E E +   +   G   N+PPLPS FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+ S    FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G +  G+CGWI SL  L K+I VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:    8 QPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQN--LSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFC---VDSSRAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 258          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 176.022 bits (445), Expect = 5.597e-51
Identity = 113/256 (44.14%), Postives = 167/256 (65.23%), Query Frame = 2
Query:  206 EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            +PA+++     P   +      +  A+L +RQ ELE +A EL R+E E +   +   G   N+PPLPS FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+ S    FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G +  G+CGWI SL  L K+I VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:    8 QPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQN--LSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFC---VDSSRAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 258          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 176.407 bits (446), Expect = 1.695e-50
Identity = 117/282 (41.49%), Postives = 175/282 (62.06%), Query Frame = 2
Query:  179 LNDFNPFEN-----------------EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            L+++NPF +                 +PA+++     P   +      +  A+L +RQ ELE +A EL R+E E +   +   G   N+PPLPS FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+ S    FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G +  G+CGWI SL  L K+I VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   34 LDEYNPFSDSRTPPPGSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQN--LSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFC---VDSSRAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp2 (secretory carrier membrane protein 2 [Source:MGI Symbol;Acc:MGI:1346518])

HSP 1 Score: 147.517 bits (371), Expect = 8.096e-40
Identity = 118/317 (37.22%), Postives = 187/317 (58.99%), Query Frame = 2
Query:   80 MSWNDNNPDFNPFAVXXXXXXXXXXXXTVQTETLNDFNPFE----------------NEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKS-IGVGAFMCIISGLYTAVLVSGSILFF--KVHRIYRSTGASFEKAKAEFSRDLASN 973
            MS  D NP  +P  V P ++             L +FNPF                 ++PAV+Q +  EP +    +      A L R+Q EL+ +A EL RKE E +           N+PPLPSW P+KPCFYQ+   EIP +Y+++ +  +Y+W+ +   +F+N+   L++  S   + ++GT FG+S+L FL+F+P +++CW+R +YKAFRSD+SF+FF+FFF+FF Q+ I  IQ++G+  LG+ GW+ +L+ +K   + V   M +++G +T  L +G  LF   +VH  YR TGASF++A+ EFS+ + S+
Sbjct:    1 MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQSGLAEFNPFSETNAATTVPATQAPGPSQPAVLQPS-VEPAQPTPQAVAAAAQAGLLRQQEELDRKAAELERKERELQNTAANLHVRDNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFTS---DAANGTAFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYFIQLIGLPNLGTSGWLAALSTMKNGPLAVTIIMMVVAGFFT--LCAGLSLFLLQRVHAFYRRTGASFQQAQEEFSQGIFSS 311          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp3 (secretory carrier membrane protein 3 [Source:MGI Symbol;Acc:MGI:1346346])

HSP 1 Score: 133.65 bits (335), Expect = 1.656e-34
Identity = 96/225 (42.67%), Postives = 142/225 (63.11%), Query Frame = 2
Query:  326 ELTRKEEEQRRRYMEFQG--------NIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            EL RK EE  RR  E Q            N+PPLPS+ P+KPCF+Q+I +EIP E+++ V   +Y+W+     + +N F  L+      V+  SG+ FG+S+L  LLF+P S++CW+R +YKAFRSDSSFNFF+FFFIFF Q +  ++Q +GI   G  GW+ +L  +     V   M +++ L+T + V G ++  ++H +YR TGASF+KA+ EF+  + SNP
Sbjct:  107 ELNRKAEELDRRERELQHVALGGAGTRQNNWPPLPSFCPVKPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFFACLARFC---VDTGSGSGFGLSMLWLLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVFFVLQAIGIPGWGFSGWVTALVVVGSKPAVAVLMLLVALLFTGIAVLGIVMLKRIHSLYRQTGASFQKAQQEFAAGVFSNP 328          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|P56603|SCAM1_RAT (Secretory carrier-associated membrane protein 1 OS=Rattus norvegicus OX=10116 GN=Scamp1 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.091e-49
Identity = 117/282 (41.49%), Postives = 175/282 (62.06%), Query Frame = 2
Query:  179 LNDFNPFEN-----------------EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            L+++NPF +                 +PA+++     P   +      +  A+L +RQ ELE +A EL R+E E +   +   G   N+PPLPS FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+ S    FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G +  G+CGWI SL  L K+I VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   34 LDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQN--LSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFC---VDSSRAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q8K021|SCAM1_MOUSE (Secretory carrier-associated membrane protein 1 OS=Mus musculus OX=10090 GN=Scamp1 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.186e-49
Identity = 117/282 (41.49%), Postives = 175/282 (62.06%), Query Frame = 2
Query:  179 LNDFNPFEN-----------------EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            L+++NPF +                 +PA+++     P   +      +  A+L +RQ ELE +A EL R+E E +   +   G   N+PPLPS FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+ S    FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G +  G+CGWI SL  L K+I VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   34 LDEYNPFSDSRTPPPGSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQN--LSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFC---VDSSRAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|O15126|SCAM1_HUMAN (Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1 PE=1 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 6.857e-49
Identity = 115/282 (40.78%), Postives = 175/282 (62.06%), Query Frame = 2
Query:  179 LNDFNPFEN-----------------EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            L+++NPF +                 +PA+++     P   +      +  A+L +RQ ELE +A EL R+E E +   +   G   N+PPLPS FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+ +    FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G +  G+CGWI SL  L ++I VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   34 LDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQN--LSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFC---VDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|O77735|SCAM1_PIG (Secretory carrier-associated membrane protein 1 OS=Sus scrofa OX=9823 GN=SCAMP1 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.547e-48
Identity = 117/282 (41.49%), Postives = 175/282 (62.06%), Query Frame = 2
Query:  179 LNDFNPFEN-----------------EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            L+++NPF +                 +PA+++     P   +      +  A+L +RQ ELE +A EL R+E E +   +   G   N+PPLP  FP+ PCFYQ+  V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+ S G  FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q  G +  G+CGWI SL  L +SI VG  M II+ L+TA  V   ++F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   34 LDEYNPFSDSRTPPPGNVKMPNVPSTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQN--LSQHGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHAVTLFLNIFGCLAWFC---VDPSRGVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|O15127|SCAM2_HUMAN (Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 2.034e-41
Identity = 117/315 (37.14%), Postives = 183/315 (58.10%), Query Frame = 2
Query:   80 MSWNDNNPDFNPFAVXXXXXXXXXXXXTVQTETLNDFNPFE----------------NEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELK-KSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            MS  D NP  +P  V P ++             L +FNPF                 ++PAV+Q +  EP +    +  +   A L R+Q EL+ +A EL RKE E +           N+PPLPSW P+KPCFYQ+   EIP +Y+++ +  +Y+W+ +   +F+N+   L++    + +   G  FG+S+L FL+F+P +++CW+R +YKAFRSD+SF+FF+FFF+FF Q+ I IIQ++GI  LG  GWI +L+ L   S+ +   M +++G +T   V    L  +VH +YR TGASF++A+ EFS+ + S+
Sbjct:    1 MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPS-VEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSK---GVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQGIFSS 311          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A4S2KAL2 (Secretory carrier-associated membrane protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011151 PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.617e-60
Identity = 134/276 (48.55%), Postives = 188/276 (68.12%), Query Frame = 2
Query:  164 VQTETLNDFNPFENEPAV----IQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEF-QGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            +QT  L D+NPFE + +     I +N   P    +   Q +T  +LERRQ+EL+ +A EL R+E EQ R   +  QG IKN+PPLPS+FP +PCFYQ+ID+EI  EYR++VR+G+Y+W+AY  ++ IN  G L Y          G+LFG+S+++ +   PAS+ICWFR LYKAFRSDSS NFF+FF +F AQ+++LIIQ LGI   GSCGWI  LA +K++  +G     I+  +T + V+ ++   +VHRIYR+TGASF KA+ EF+R ++SNP
Sbjct:   35 IQTGALGDYNPFERDTSTLTGTIASNPDFPPPYSSLEAQRLTTTELERRQKELDAKAAELARREAEQNRLAEQVRQGPIKNWPPLPSFFPCEPCFYQDIDLEINSEYRRIVRFGYYLWVAYAGLLLINFLGALLYFAGTG-RSDGGSLFGVSIIICIFCIPASFICWFRPLYKAFRSDSSINFFIFFIVFGAQILVLIIQALGILNWGSCGWITGLAAVKETPAIGGITLAIACFFTGMAVACALYLIRVHRIYRNTGASFGKAREEFARGVSSNP 309          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A075AJ61 (Secretory carrier-associated membrane protein OS=Opisthorchis viverrini OX=6198 GN=T265_01121 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.031e-59
Identity = 135/279 (48.39%), Postives = 187/279 (67.03%), Query Frame = 2
Query:  164 VQTETLNDFNPFENEPAV----IQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEF----QGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            +QT  L D+NPFE + +     I +N   P    +   Q +T  +LERRQ+EL+ +A EL R+E EQ R   +     QG IKN+PPLPS+FP  PCFYQ+ID+EI  EYR++VR+G+Y+W+AY  ++ IN FG L Y          G+LFG+S+++ +   PAS+ICWFR LYKAFRSDSS NFF+FF +F AQ+++LIIQ LGI   GSCGWI  LA +K +  +G     I+ ++T + V+ +    +VHRIYR+TGASF KA+ EF+R ++SNP
Sbjct:   48 IQTGALGDYNPFERDTSTLTGTIASNPDFPPPYSSLEAQRLTTTELERRQKELDAKAAELARREAEQNRLAEQVRQGSQGPIKNWPPLPSFFPCGPCFYQDIDLEINSEYRRIVRFGYYLWVAYAGLLLINFFGALLYFAGTG-RSDGGSLFGVSIIVCIFCIPASFICWFRPLYKAFRSDSSINFFIFFIVFGAQILVLIIQSLGILNWGSCGWITGLAAVKDTPAIGGITLAIACVFTGMAVACAFYLIRVHRIYRNTGASFGKAREEFTRGVSSNP 325          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A3S5A8H2 (Secretory carrier-associated membrane protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS16156 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.387e-58
Identity = 143/301 (47.51%), Postives = 208/301 (69.10%), Query Frame = 2
Query:  161 TVQTETLNDFNPFENEPAVIQANYTEPKK---NETNS-----FQTITNADXXXXXXXXXXXANELTRKEEEQRR-----RYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAV-LVSG---------------SILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            TV++E L+++NPFEN+      + +EP     N+T S      + ITN +LE+RQREL+ RA EL R+EEEQRR     R  ++ G  KN+PPLPS+ P +PCFYQ I++EI  EY+++VR G+++W+ Y  ++ IN+FG++ Y      +   G++FG++LL  +LF+P SY+CWFR LYKAFRSDSSFNFF+FFF+FFAQ+I+++IQ LGI +LG+CGWI+ LA +++   VGA +  I+ L+T++ +VSG                 LFFK+HRIYR+TGAS +KA+ EF   ++SNP
Sbjct:   39 TVKSEGLDNYNPFENK-VTSTLSSSEPNMTPLNDTGSPASQDIRKITNEELEKRQRELDARAAELQRREEEQRRLDERARAGDYNGAKKNWPPLPSFLPCRPCFYQNIEIEISEEYQKVVRMGYFLWMCYAGLLLINVFGSIFYFAGTQ-KPDGGSVFGVALLTAILFAPLSYVCWFRPLYKAFRSDSSFNFFVFFFVFFAQVIVMVIQSLGITSLGACGWIVGLAAVREVGWVGAIVLAIAALFTSIAVVSGFFLVHIKITHDIVIQGTLFFKIHRIYRATGASLDKARQEFVSGMSSNP 337          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A4E0R665 (Secretory carrier-associated membrane protein OS=Fasciola hepatica OX=6192 GN=D915_006917 PE=3 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 4.374e-58
Identity = 137/281 (48.75%), Postives = 186/281 (66.19%), Query Frame = 2
Query:  164 VQTETLNDFNPFE----NEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQ------GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            V++  L D+NPFE    N    I A    P        Q +T A+LERRQREL+ +A EL R+EEEQ R   E        G  KN+PPLP +FP KPCFYQ I++EI +EY+++VR G+Y+WIAY +++ +N+ GTL Y    +     GT+FG++LL+F+L  PASYICWFR LYKAFRS+SS NFF+FF +  AQ++ L+IQ LGI+  GSCGW++ L  LK   GVGA + II+ L+T +  +       VH+IYRSTGASF +A+ EF+R + S+P
Sbjct:   34 VESSALGDYNPFESREENLTGTISAAPGFPPSYSPAEAQILTTAELERRQRELDAKAAELARREEEQNRLAAEAHLRGYGSGPPKNWPPLPYFFPCKPCFYQNIELEITLEYQKIVRIGYYLWIAYASLLAVNLLGTLVYFAGTS-RTDGGTIFGVALLVFILCIPASYICWFRPLYKAFRSNSSVNFFIFFIVAAAQILGLVIQSLGISNWGSCGWLVGLTALKSDPGVGALVLIIASLFTGLTAAYIFYLIHVHKIYRSTGASFGRAREEFARGVISDP 313          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A267GUG7 (Secretory carrier-associated membrane protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003135g1 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.118e-53
Identity = 124/271 (45.76%), Postives = 178/271 (65.68%), Query Frame = 2
Query:  185 DFNPFENEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNI------KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSY-MISQNVEXXXXXXX-XXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            D+NPF+            P     ++ Q I++ +LERRQRELE ++ EL R+E EQR+R  E            N+PPLP+  P+ PCFYQ+ D EIP EYR +V+ G+Y+W+ +  ++ +NI GTL+Y ++S   E  +     G+SLL+ ++  P SY+CWFR LYKAF++DSSFNFF FF +F  Q+ +LI+Q LGIN LGSCGWI   A LK  +G G FM +I+ L+T ++++  +L  +VHRIYRS+GASF KA+ E S+ +A+N
Sbjct:   18 DYNPFDK---TQPQQAAPPPAYTASAQQRISSDELERRQRELEAKSRELERREAEQRQREAESSAGAVGSQRPNNWPPLPACCPVGPCFYQDFDQEIPAEYRLVVKLGYYLWLVHSVLLLVNIIGTLTYFIVSPKTEAITSGTVFGVSLLVCIILVPCSYLCWFRPLYKAFKNDSSFNFFFFFLLFAVQICVLIVQCLGINYLGSCGWINGAATLKVKLGAGVFMMVIAALFTLLVIADVLLIIRVHRIYRSSGASFAKARQELSQGVAAN 285          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:103025528])

HSP 1 Score: 167.162 bits (422), Expect = 4.067e-47
Identity = 113/263 (42.97%), Postives = 163/263 (61.98%), Query Frame = 2
Query:  203 NEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQ------GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
             +PA+++     P  +++   Q     D  R Q EL  R  EL RK  E  RR  E Q      G   N+PPLP  FP+ PCFY +I V+IP+E+++ V+  +Y+W+ +   +F+NIFG L++     V+   G  FG+++L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  + ++Q +GI   G+ GWI +L  L  SI VG  M +I+ L+TA  V   I+F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   61 TQPAIMKPTEEPPAYSQSQQTQ-----DQARAQAELMRRQEELERKAAELDRREREMQSLSASGGRKNNWPPLPEKFPVGPCFYHDISVDIPVEFQKTVKIMYYLWMFHTGTLFLNIFGCLAWFC---VDPYRGVDFGLAMLWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAIGIAGWGASGWISALTGLNTSIPVGIIMILIAALFTASAVISLIMFKKVHGLYRTTGASFEKAQQEFATGVMSN 315          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp2l (secretory carrier-associated membrane protein 2-like [Source:NCBI gene;Acc:103024986])

HSP 1 Score: 146.362 bits (368), Expect = 1.510e-39
Identity = 127/315 (40.32%), Postives = 185/315 (58.73%), Query Frame = 2
Query:   80 MSWNDNNPDFNPFAVXXXXXXXXXXXXTVQTETLNDFNPFE-----------------NEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            MS  D+NP  +P  V P ++          TE L +FNPF                  ++PAV+Q    EP             ADL ++Q ELE +A EL RKEE+ + R    +G   N+PPLP + P+KPCFYQ+ + EIP+E+ ++ +  +Y+W+ +   +F+N+   L+      V    G  FG+S+L FLLFSPA++ICW+R +YKAF+SDSSF+FF FFFIF  Q+I+ IIQ +GI + G+ GWI +++ L  +IGV  FM +++  +T   V   IL   VH  YR TGASF+KA+ EFS+ + +N
Sbjct:    1 MSGFDSNPFVHPVDVNPFQDPSVTQVTNTNTEGLEEFNPFSARALDDLSGSTIPITAASQPAVLQPT-VEPSPRAA---AAAAQADLLKQQAELERKAAELQRKEEDLQSRDTA-RGKENNWPPLPKFLPIKPCFYQDFNEEIPVEFHRVCKMMYYLWMYHCVTLFLNVLACLACF---TVNAQKGIDFGLSILWFLLFSPAAFICWYRPVYKAFKSDSSFSFFFFFFIFSFQVIVYIIQSVGIPSWGNSGWISAISVLNFNIGVAVFMLLVAMFFTVNAVLAVILLKMVHSKYRRTGASFQKAQEEFSQGVVTN 307          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp3 (secretory carrier membrane protein 3 [Source:NCBI gene;Acc:103021636])

HSP 1 Score: 141.739 bits (356), Expect = 9.834e-38
Identity = 118/289 (40.83%), Postives = 171/289 (59.17%), Query Frame = 2
Query:  176 TLNDFNPFENEPA----------------VIQANYTEPKKNETNSFQ----TITNADXXXXXXXXXXXANELTRKEEE---QRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            TL+ +NPF+   A                  +   TEP+   +   Q    + T ADL R+Q ELE +A EL R+E E   Q R     + N  N+PPLPS+ P+ PCFYQ+I+VEI   +++ V   +Y W+   +++  N+   LS      V+ S G   G+++L  LLF+P S++CW+R +YKAFRSDSSFNFF FFFIFFAQ+++ +I  +GI   G  GWI+ L  LKK++ VG  M + + L+TA    G ++  KVH +YR T ASF+KA+AEF+ ++ SN
Sbjct:   33 TLDLYNPFDTRTAGPPPPYDATPPPAQTPPSRTTPTEPRNYGSYGTQQAAVSATTADLLRKQEELERKAKELERRERELDSQSRSTGSSRQN--NWPPLPSFCPVGPCFYQDINVEISQAFQRTVTIMYYFWMFTASVLAFNLISCLSLFC---VDPSGGVGLGLAILWILLFTPCSFVCWYRPVYKAFRSDSSFNFFAFFFIFFAQVVVYVIMTIGIPGWGFSGWIVGLYALKKNVAVGVIMLLNAVLFTAQAAMGVVMLKKVHSMYRQTDASFQKAQAEFATEVFSN 316          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp2 (secretory carrier-associated membrane protein 2 [Source:NCBI gene;Acc:103046607])

HSP 1 Score: 137.887 bits (346), Expect = 8.924e-37
Identity = 105/269 (39.03%), Postives = 158/269 (58.74%), Query Frame = 2
Query:  185 DFNPFENEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQ------GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            D NPF N P  +      P +   +S     +A     Q  L  +  EL RK  E  RR  E Q      G   N+PPLP  FP+KPCFYQ+   EIP E++++ +  +Y+W+ Y   +F+N+   L++  +   +   G  FG+S+L F+LF+P S++CWFR +YKAFR+DSS NFF FFFIFFAQ+++ +IQ +GI   G+ GWI +++ ++ ++ V   M +++  +T       +L   VH  YR TGASFEKA+ EFS+ + +N
Sbjct:    5 DSNPFGN-PVDVNPFQVSPCRRSPHSLPLFPSATAAAAQANLLRQQEELERKAAELDRREQELQNRDRTTGKENNWPPLPRSFPIKPCFYQDFSEEIPPEHQRICKMMYYLWMLYCVTLFLNVLACLAFFTA---DAGYGVDFGLSILWFILFTPCSFLCWFRPVYKAFRTDSSINFFFFFFIFFAQVVVTVIQSVGIPKWGNSGWISAISVVRSNLAVSVVMMVVAAFFTVCATMSIVLLKMVHSHYRRTGASFEKAQQEFSQGVLTN 269          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp2 (secretory carrier-associated membrane protein 2 [Source:NCBI gene;Acc:103046607])

HSP 1 Score: 135.191 bits (339), Expect = 2.184e-35
Identity = 94/222 (42.34%), Postives = 142/222 (63.96%), Query Frame = 2
Query:  326 ELTRKEEEQRRRYMEFQ------GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            EL RK  E  RR  E Q      G   N+PPLP  FP+KPCFYQ+   EIP E++++ +  +Y+W+ Y   +F+N+   L++  +   +   G  FG+S+L F+LF+P S++CWFR +YKAFR+DSS NFF FFFIFFAQ+++ +IQ +GI   G+ GWI +++ ++ ++ V   M +++  +T       +L   VH  YR TGASFEKA+ EFS+ + +N
Sbjct:   90 ELERKAAELDRREQELQNRDRTTGKENNWPPLPRSFPIKPCFYQDFSEEIPPEHQRICKMMYYLWMLYCVTLFLNVLACLAFFTA---DAGYGVDFGLSILWFILFTPCSFLCWFRPVYKAFRTDSSINFFFFFFIFFAQVVVTVIQSVGIPKWGNSGWISAISVVRSNLAVSVVMMVVAAFFTVCATMSIVLLKMVHSHYRRTGASFEKAQQEFSQGVLTN 308          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: scamp1 (secretory carrier membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1803])

HSP 1 Score: 173.326 bits (438), Expect = 3.337e-50
Identity = 134/312 (42.95%), Postives = 190/312 (60.90%), Query Frame = 2
Query:  104 DFNPFA---VXXXXXXXXXXXXTVQTE-TLNDFNPFEN------------------EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            D NPFA   V     DP   + T QT+  LND+NPF +                  +PAV+Q     P     ++      ADL RRQ ELE++A EL R+E E + +    + N  N+PPLP+  P+ PCFYQ+I VEIP+E+++ VR  +Y+W+ +   +F+N+ G L++     V  + G  FGM++L FLLF+P S++CWFR +YKAFRSDSSFNFF+FFFIFF Q ++ ++Q +GI   G+CGWI SL  L  SIGVG  + +++  +T   V   ++  KVH +YR TGASFEKA+ EF+  + SN
Sbjct:    5 DSNPFADPEVNSPFRDPAVTQVTRQTQPALNDYNPFGDGSKPGALVGATPAVLPTSQPAVMQPTEEPPPYTGPSASAAAAQADLLRRQEELEKKAAELDRREREMQTQPGAVKKN--NWPPLPTQCPVGPCFYQDIPVEIPVEFQKTVRMLYYMWMFHAVTLFLNLLGCLAWFC---VNTARGIDFGMAILWFLLFTPCSFVCWFRPVYKAFRSDSSFNFFLFFFIFFCQFVVHVMQSIGIPGWGNCGWIASLEALNHSIGVGIILMLLAAFFTGSAVLSVVMLKKVHSLYRQTGASFEKAQQEFATGVMSN 311          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: SCAMP5 (secretory carrier membrane protein 5 [Source:HGNC Symbol;Acc:HGNC:30386])

HSP 1 Score: 129.028 bits (323), Expect = 4.649e-35
Identity = 82/198 (41.41%), Postives = 123/198 (62.12%), Query Frame = 2
Query:  383 IKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            + NFPPLP +  +KPCFYQ+ + +IP  +R  V+  +Y+WI +   + +N+ G L+++I       S   FG+++L  +LF+P SY+CWFR++YK FRSDSSFN+ +FFF F  Q+++ IIQ +GI   G CGWI +++    +IGVG  M   + ++T + V   +   KVH  YR  G S  KA+ EFS     NP
Sbjct:    5 VNNFPPLPKFVRLKPCFYQDFNEDIPEPHRLSVKRLYYLWIMHGITLVVNLIGCLAWLIGGG----SAVNFGLAILWLILFTPCSYVCWFRAVYKGFRSDSSFNYMLFFFTFSGQVVLNIIQAVGIPGWGVCGWIATISYFGTNIGVGVVMLFPTIMFTGLAVISFLALIKVHSFYRGGGGSVGKAQQEFSTGAWKNP 198          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: SCAMP5 (secretory carrier membrane protein 5 [Source:HGNC Symbol;Acc:HGNC:30386])

HSP 1 Score: 73.1738 bits (178), Expect = 2.592e-16
Identity = 42/98 (42.86%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  389 NFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVA--IMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFR 676
            NFPPLP +  +KPCFYQ+I+ +IP  + Q V+  +Y+W   V    + +N+ G L+++I       S T FG++++  LLF+P SY+CWFR +YKAF+
Sbjct:    9 NFPPLPKFIRLKPCFYQDIEGDIPPPHTQTVKRLYYLWDVSVQGLTLAVNLIGCLAWIIGGG----SATNFGLAIVWLLLFTPCSYVCWFRPIYKAFK 102          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Nematostella
Match: EDO31962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWE3])

HSP 1 Score: 145.206 bits (365), Expect = 2.499e-39
Identity = 100/228 (43.86%), Postives = 140/228 (61.40%), Query Frame = 2
Query:  320 ANELTRKEEE-QRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYM-ISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAE---LKKSIGVGAFMCIISGLYTAVLVSG----SILFFKVHRIYRSTGASFEKAKAEFSRDLASNP 976
            A EL RKE+E QR +Y  ++ N  NFPPLP WF  KPCFY +I V+IPIEY++L R+ F  W AY  +MF N    L+ +  S     + G  FG+S+L  +   PAS++CW+R  YKA ++DSSF++ +FF IFF  + I I   LG+   GSCG+I +        K++ +  F+C       A+L++G     IL  KVHRIYR  GAS EKA+ EF++ +A+NP
Sbjct:  105 AAELQRKEQELQRMQYSGYREN--NFPPLPKWFKCKPCFYHDIQVDIPIEYQKLCRFLFIRWQAYSFVMFYNFIVALALLSTSATGNHNEGKTFGLSILYLVWNVPASFLCWYRPAYKALKNDSSFSYIIFFLIFFLHISINIYYTLGMPGGGSCGFITATDTWHGTNKAVSIMMFIC------AAMLLAGVGIDCILIVKVHRIYRQAGASLEKAQGEFAKGVATNP 324          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: SCAMP1 (secretory carrier-associated membrane protein 1 [Source:NCBI gene;Acc:101157947])

HSP 1 Score: 170.244 bits (430), Expect = 1.231e-48
Identity = 105/221 (47.51%), Postives = 149/221 (67.42%), Query Frame = 2
Query:  326 ELTRKEEEQRRRYMEFQ-----GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            EL +K  E  RR  E Q     G   N+PPLP  FP+ PCFY +I V+IP+E+++ V+  + +W+ +   +F+N+FG L++ I   V+ S G  FG+++L FLLF+P S+ICW+R LY AFRSDSSF FF+FFFI+  Q  + ++Q +GI   G+CGWI +L  L  SI VG  M +I+ L+TA+ V   I+F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   69 ELEKKAAELDRRERELQTHGAAGRKNNWPPLPEKFPVGPCFYHDIAVDIPVEFQKTVKIMYNLWMFHAGTLFVNMFGCLAWFI---VDASRGVDFGLAMLWFLLFTPCSFICWYRPLYGAFRSDSSFRFFVFFFIYICQFGVHVLQAIGITGWGTCGWIAALTGLNTSIPVGIIMLLIAALFTALAVGSLIMFKKVHALYRTTGASFEKAQQEFATGVMSN 286          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: SCAMP1 (secretory carrier-associated membrane protein 1 [Source:NCBI gene;Acc:101157947])

HSP 1 Score: 171.014 bits (432), Expect = 1.922e-48
Identity = 118/265 (44.53%), Postives = 163/265 (61.51%), Query Frame = 2
Query:  194 PFENEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQ-----GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            P +N    I     EP        Q  T  D  R Q EL  R  EL +K  E  RR  E Q     G   N+PPLP  FP+ PCFY +I V+IP+E+++ V+  + +W+ +   +F+N+FG L++ I   V+ S G  FG+++L FLLF+P S+ICW+R LY AFRSDSSF FF+FFFI+  Q  + ++Q +GI   G+CGWI +L  L  SI VG  M +I+ L+TA+ V   I+F KVH +YR+TGASFEKA+ EF+  + SN
Sbjct:   59 PSQNTQPAIMKPTEEPPAYTQQQTQRRTE-DQARAQAELLRRQEELEKKAAELDRRERELQTHGAAGRKNNWPPLPEKFPVGPCFYHDIAVDIPVEFQKTVKIMYNLWMFHAGTLFVNMFGCLAWFI---VDASRGVDFGLAMLWFLLFTPCSFICWYRPLYGAFRSDSSFRFFVFFFIYICQFGVHVLQAIGITGWGTCGWIAALTGLNTSIPVGIIMLLIAALFTALAVGSLIMFKKVHALYRTTGASFEKAQQEFATGVMSN 319          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:101169127])

HSP 1 Score: 158.303 bits (399), Expect = 8.411e-44
Identity = 120/313 (38.34%), Postives = 175/313 (55.91%), Query Frame = 2
Query:  104 DFNPFAVXXXXXXXXXXXXTVQTET----LNDFNPFENE---PAVIQANYTEPK----------KNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQ------GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            D NPFA P   +       T   +T    L ++NPF +    PA      T P            +E  ++      +  R   EL  R  EL RK  E  RR  E Q      G   N+PPLP   P+ PCFY +I V+IP+E++++V+  +Y+W+ +   +  N+   LS+     V+ + G  FG+S+L FLLF+P S++CW+R LY AFRSDSSF FF+FFF++  Q  I +IQ +GI+  G+ GWI +L  L  SI VG  M +++ L+T++ V   I+F K+H +YR+TGASFEKA+ EF+  + SN
Sbjct:    5 DSNPFAGPELNSPFQDPSVTKVRQTTAAGLEEYNPFTDAKPTPAGTAPRTTGPAVSTQPAIMKPSDEPPAYSQPQGQEATRAAAELLRRQEELERKAAELDRREREMQTLSASGGRKNNWPPLPENLPVAPCFYHDISVDIPVEFQKIVKIMYYLWMFHTGTLLANLIACLSWFC---VDATHGVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYVCQFGIYVIQCIGISGWGASGWISALMGLNTSIPVGIIMILVAALFTSLAVMSLIMFKKIHALYRTTGASFEKAQQEFATGVMSN 314          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp2 (secretory carrier-associated membrane protein 2 [Source:NCBI gene;Acc:101162341])

HSP 1 Score: 146.362 bits (368), Expect = 2.048e-39
Identity = 117/314 (37.26%), Postives = 177/314 (56.37%), Query Frame = 2
Query:   80 MSWNDNNPDFNPFAVXXXXXXXXXXXXTVQTETLNDFNPF---------ENEPAVI--QANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQ-----GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            MS  D+NP   P +V P  +           E ++ +NPF            PAV+  Q   T P   + +S  +   A   R Q +L  +  EL RK  E  RR  E Q     G   N+PPLP  FP+KPCFYQ+   EIP+EY+++ +  +Y+W+     +F+N+   +++ I+   +   G  FG+S+L  +LFSP S+ICW+R +Y AF++DSSF+FF FFF+FF Q+++ IIQ +G+   G+ GWI +++ +  +  VG  M I+S L+T       IL   VH +YR TGASF+KA+ EFS+ + +N
Sbjct:    1 MSGYDDNPFAEPVSVNPFNDPSVTQVTNSSIEPVDQYNPFPQSNDGLAIHTTPAVLRTQQPSTSPAVLQPSSDPS-PQASAARAQADLLRQQEELERKAAELDRREQELQSRGSTGKENNWPPLPKSFPIKPCFYQDFSEEIPVEYQRVCKMTYYLWMFNCVTLFLNLLACMAHFIT---DSKYGVDFGLSILWLILFSPCSFICWYRPVYNAFKTDSSFSFFTFFFVFFCQVVVFIIQSVGLPNWGNSGWIAAISIIGSNKAVGGIMIIVSILFTLCAAVSIILLKMVHSMYRHTGASFQKAQQEFSQGVFTN 310          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp3 (secretory carrier membrane protein 3 [Source:NCBI gene;Acc:101156986])

HSP 1 Score: 142.51 bits (358), Expect = 4.853e-38
Identity = 104/255 (40.78%), Postives = 150/255 (58.82%), Query Frame = 2
Query:  233 TEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNI--------KNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            TEPK   + + Q   NA       +L  +  EL RK +E  RR  E Q +          N+PPLPS+ P+ PCFYQ+IDVEI   +++ V   +Y W+     +  N+  + +   S       G   G+S+L  LLF+P S++CW+R +YKAFR+DSSFNFF+FFFIFFAQ+ + +I  +GI   G  GWI+SLA L+ S GVG  M + + ++T     G ++  K+H +YR T ASF+KA+AEF+  + SN
Sbjct:   67 TEPKNYGSYNSQPAVNA----ATSDLLRKQEELERKAQELERRERELQSHSLGPGATRQNNWPPLPSFCPVGPCFYQDIDVEIAQRFQRTVSTMYYFWMVCAGALLFNLISSFANFCSD--PSGGGVGLGLSILWALLFTPCSFVCWYRPVYKAFRTDSSFNFFIFFFIFFAQVCVFVIMTIGIPGWGFSGWIVSLAALRTSTGVGVIMVMNAIVFTGQAAMGVVMLKKIHSLYRQTDASFQKAQAEFASGVMSN 315          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000075964.1 (SMESG000075964.1)

HSP 1 Score: 482.641 bits (1241), Expect = 2.744e-170
Identity = 323/323 (100.00%), Postives = 323/323 (100.00%), Query Frame = 2
Query:   80 MSWNDNNPDFNPFAVXXXXXXXXXXXXTVQTETLNDFNPFENEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNPXXXXXXXXXXXXXXXXXLSRGNKY 1048
            MSWNDNNPDFNPFAVPPSKNDPPPYKPTVQTETLNDFNPFENEPAVIQANYTEPKKNETNSFQTITNADLERRQRELEERANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEGSSGTLFGMSLLLFLLFSPASYICWFRSLYKAFRSDSSFNFFMFFFIFFAQLIILIIQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNPTVQATATGVGTAAVSGALSRGNKY
Sbjct:    1 MSWNDNNPDFNPFAVPPSKNDPPPYKPTVQTETLNDFNPFENEPAVIQANYTEPKKNETNSFQTITNADLERRQRELEERANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEGSSGTLFGMSLLLFLLFSPASYICWFRSLYKAFRSDSSFNFFMFFFIFFAQLIILIIQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNPTVQATATGVGTAAVSGALSRGNKY 323          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000035622.1 (SMESG000035622.1)

HSP 1 Score: 189.119 bits (479), Expect = 4.801e-56
Identity = 144/291 (49.48%), Postives = 194/291 (66.67%), Query Frame = 2
Query:  107 FNPFAV--XXXXXXXXXXXXTVQTETLNDFNPFENEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            FNPF V    ++     ++PTV+T  ++D+ PF NEPA++Q   T   K +      +T  DLER QR+LEER+  L   EEE+R    E+     NFPPLP   P+KPCFYQ IDVEIP +YR +V+ GF +WI Y   +FINIFG LSYMIS N++  SG LFG+S+L F LF P SY+ WFR LYKAF+++SSFNFF+FF IF +Q+I+LIIQVLGI  LG+CGW++S     K+ GV AFM II+  ++  L +   +  +V+  +R++G S +KAK EF +D  SN
Sbjct:    5 FNPFNVPDTYTQEQSKKFQPTVKTNVIDDYEPFNNEPAILQTEATPVAKPK------VTVDDLERMQRDLEERSQRLA--EEEERLNKPEYAATRNNFPPLPKCCPLKPCFYQAIDVEIPEQYRLIVKLGFILWICYSMTLFINIFGALSYMISINLKDESGPLFGLSMLYFFLFVPLSYVFWFRPLYKAFKNNSSFNFFLFFIIFGSQIIVLIIQVLGIKYLGACGWVVSFMA-NKTPGVMAFMLIIAAAFSLNLAASFYIIIRVNLYFRTSGGSLQKAKEEFHKDALSN 286          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000037804.1 (SMESG000037804.1)

HSP 1 Score: 178.718 bits (452), Expect = 3.120e-52
Identity = 123/270 (45.56%), Postives = 177/270 (65.56%), Query Frame = 2
Query:  164 VQTETLNDFNPFENEPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 973
            VQTE + ++ PF+N P    A  ++ KK            DLE++Q+EL+ RA+EL R+E EQ    +     + NFPPL S+ P K CFYQ+I+VEIP +Y  +V  G+++WI+   I+ +N+F +L Y I+ +    +GT FG S+L+ LLF PASY+CWFR LY AF++DSS NFF+FFFI FAQ+++ +IQ LGI  LGSCGW+  L  L ++   G FM + +  +T + V  ++   KVHR+YR+T ASFEKAK+EF  + AS+
Sbjct:   13 VQTEGMENYQPFKNAPTSSTAKNSDTKK---------MYEDLEKKQKELDMRASELDRREREQSH-LLNDSSTVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSINFFIFFFIMFAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASS 272          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000064285.1 (SMESG000064285.1)

HSP 1 Score: 117.087 bits (292), Expect = 1.743e-29
Identity = 102/270 (37.78%), Postives = 156/270 (57.78%), Query Frame = 2
Query:  164 VQTETLNDFNPF-EN----EPAVIQANYTEPKKNETNSFQTITNADXXXXXXXXXXXANELTRKEEEQRRRYMEFQGNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEXXXXXXXXXXXXXXXXXXPASYICWFRSLYKAFRSDSSXXXXXXXXXXXXXXXXXXXQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSR 958
            V  + L+++NPF EN    +PAVI      P++ E      ++N+  ++          E      ++  + ++  GN  N+PP P+  P++PCFY + D++IP ++R LV++ +YIWI Y   +  N+FG+L+Y I++N    SG+ FG +L+  +LF   S+I WF  LYKA R DSS N+FMFF I   Q++I  IQ+LGI+ LGSCG+I SL   +K I  G  M  I   ++A+     IL FKV+ IYR   A    A+A+ S+
Sbjct:    5 VVYDALDEYNPFNENNKAQQPAVINVT-NNPEEVEPTKKSLLSNSSNKKNF------QGEREDGSYKESTKLIDSPGN--NWPPFPTCCPIRPCFYIDFDLDIPEKHRGLVKFAYYIWITYAIAIVFNVFGSLAYYITEN-SMISGSTFGTALIFGILFPVLSFILWFWPLYKAIRWDSSTNYFMFFIIICCQIVITGIQMLGIDWLGSCGFINSLKMFRKDILTGCIMFFIGLWFSALFTLFLILLFKVNYIYRH--AIVPDAQADNSK 262          
The following BLAST results are available for this feature:
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCAMP11.091e-4943.36secretory carrier membrane protein 1 [Source:HGNC ... [more]
SCAMP11.428e-4940.78secretory carrier membrane protein 1 [Source:HGNC ... [more]
SCAMP24.235e-4237.14secretory carrier membrane protein 2 [Source:HGNC ... [more]
SCAMP32.199e-3843.11secretory carrier membrane protein 3 [Source:HGNC ... [more]
SCAMP32.199e-3843.11secretory carrier membrane protein 3 [Source:HGNC ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
scm-15.481e-3636.14Secretory carrier-associated membrane protein [So... [more]
scm-11.234e-3436.80Secretory carrier-associated membrane protein [So... [more]
scm-19.559e-1537.82Secretory carrier-associated membrane protein [So... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Scamp1.372e-4239.30gene:FBgn0040285 transcript:FBtr0332591[more]
Scamp1.372e-4239.30gene:FBgn0040285 transcript:FBtr0074079[more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp15.812e-4840.76secretory carrier membrane protein 1 [Source:ZFIN;... [more]
scamp2l6.868e-4138.98secretory carrier membrane protein 2, like [Source... [more]
scamp33.953e-3937.07secretory carrier membrane protein 3 [Source:ZFIN;... [more]
scamp45.702e-3444.67secretory carrier membrane protein 4 [Source:ZFIN;... [more]
scamp45.702e-3444.67secretory carrier membrane protein 4 [Source:ZFIN;... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp12.207e-4743.36secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp12.568e-4743.36secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp13.824e-4743.36secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp29.478e-4036.91secretory carrier membrane protein 2 [Source:NCBI ... [more]
scamp53.337e-3543.88secretory carrier membrane protein 5 gene 2 [Sourc... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scamp15.597e-5144.14secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp15.597e-5144.14secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp11.695e-5041.49secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp28.096e-4037.22secretory carrier membrane protein 2 [Source:MGI S... [more]
Scamp31.656e-3442.67secretory carrier membrane protein 3 [Source:MGI S... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56603|SCAM1_RAT1.091e-4941.49Secretory carrier-associated membrane protein 1 OS... [more]
sp|Q8K021|SCAM1_MOUSE1.186e-4941.49Secretory carrier-associated membrane protein 1 OS... [more]
sp|O15126|SCAM1_HUMAN6.857e-4940.78Secretory carrier-associated membrane protein 1 OS... [more]
sp|O77735|SCAM1_PIG1.547e-4841.49Secretory carrier-associated membrane protein 1 OS... [more]
sp|O15127|SCAM2_HUMAN2.034e-4137.14Secretory carrier-associated membrane protein 2 OS... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2KAL21.617e-6048.55Secretory carrier-associated membrane protein OS=O... [more]
A0A075AJ611.031e-5948.39Secretory carrier-associated membrane protein OS=O... [more]
A0A3S5A8H21.387e-5847.51Secretory carrier-associated membrane protein OS=P... [more]
A0A4E0R6654.374e-5848.75Secretory carrier-associated membrane protein OS=F... [more]
A0A267GUG73.118e-5345.76Secretory carrier-associated membrane protein (Fra... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp14.067e-4742.97secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp2l1.510e-3940.32secretory carrier-associated membrane protein 2-li... [more]
scamp39.834e-3840.83secretory carrier membrane protein 3 [Source:NCBI ... [more]
scamp28.924e-3739.03secretory carrier-associated membrane protein 2 [S... [more]
scamp22.184e-3542.34secretory carrier-associated membrane protein 2 [S... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
scamp13.337e-5042.95secretory carrier membrane protein 1 [Source:ZFIN;... [more]
SCAMP54.649e-3541.41secretory carrier membrane protein 5 [Source:HGNC ... [more]
SCAMP52.592e-1642.86secretory carrier membrane protein 5 [Source:HGNC ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319622.499e-3943.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCAMP11.231e-4847.51secretory carrier-associated membrane protein 1 [S... [more]
SCAMP11.922e-4844.53secretory carrier-associated membrane protein 1 [S... [more]
scamp18.411e-4438.34secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp22.048e-3937.26secretory carrier-associated membrane protein 2 [S... [more]
scamp34.853e-3840.78secretory carrier membrane protein 3 [Source:NCBI ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000075964.12.744e-170100.00SMESG000075964.1[more]
SMESG000035622.14.801e-5649.48SMESG000035622.1[more]
SMESG000037804.13.120e-5245.56SMESG000037804.1[more]
SMESG000064285.11.743e-2937.78SMESG000064285.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023392 ID=SMED30023392|Name=Secretory carrier-associated membrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1464bp
AGGTATTCTTTTTTGTTTAAACAAATAACTTATTTTAACCTTTTTATAAA
CAGTTAATATTTGAATTATTTACAACACAATGAGTTGGAATGATAATAAT
CCAGACTTTAACCCATTTGCTGTTCCACCTTCGAAAAATGATCCACCTCC
TTACAAACCTACTGTTCAAACTGAAACCCTAAATGATTTCAATCCCTTTG
AAAATGAACCAGCAGTGATCCAAGCAAATTATACAGAACCTAAAAAAAAT
GAAACTAATTCTTTTCAAACAATTACAAATGCTGATTTAGAAAGACGTCA
AAGAGAATTAGAAGAAAGAGCTAATGAATTAACTCGGAAAGAAGAAGAAC
AACGACGAAGATATATGGAATTTCAAGGTAATATAAAGAATTTTCCTCCG
CTTCCATCGTGGTTTCCTATGAAACCTTGTTTCTATCAAGAAATTGACGT
TGAAATTCCAATAGAGTATCGACAACTCGTTCGATATGGCTTTTATATTT
GGATTGCGTATGTTGCCATAATGTTTATTAACATTTTCGGCACACTAAGT
TATATGATTTCTCAAAACGTAGAAGGCTCATCTGGAACTTTGTTTGGAAT
GTCATTATTATTATTTTTGTTATTTTCACCTGCGTCTTATATTTGTTGGT
TTCGATCTCTTTACAAAGCATTCAGGAGTGATTCTTCTTTCAATTTTTTT
ATGTTCTTCTTTATTTTCTTTGCCCAATTGATCATATTGATTATTCAAGT
GCTGGGAATTAATACTCTTGGATCATGTGGTTGGATAATATCCTTAGCAG
AACTAAAAAAAAGCATTGGTGTTGGAGCATTTATGTGCATCATTTCTGGA
CTTTATACAGCGGTTCTGGTTTCAGGCTCGATTTTATTTTTTAAGGTTCA
TAGGATATATCGATCAACTGGGGCAAGTTTCGAAAAAGCTAAAGCGGAAT
TTTCACGGGACCTCGCATCAAATCCCACAGTCCAGGCGACAGCAACTGGA
GTGGGCACAGCAGCTGTATCAGGGGCGTTAAGTCGTGGAAATAAATATTA
AATGCAGTGTTGTCTGATTTACCATATATAACATGACTTTTGCAATAAGT
GAAATTGTTTATTCCAATATTATCTCTGTTCTTTGTCATTGCGATTATGA
AAATTCTTTTAACTCAAATAACTCAATAAAATATCGTTTACAGTTTATTG
ATCTTTTTACATCTATATTTTGGGTGCTTGCAGTTGTATGTATATTTACG
CTCTCCTGGAACCTGAATAATACCTTGATAATATCTATGAGCTCTCCCTA
CCGGTATGGAGTGCCCTTATTGATTATGAGAATATCAAATCTATTTACAA
TAATAATTTGGTGAATAAAATATTTCTTGTTAGTGATTCTAAGAAAGTGT
AAAAATTGATTGTGCGCTTTTTTGAAATTATTTTATTGATTTCTATGAAA
TTTGTGTTCACTTC
back to top

protein sequence of SMED30023392-orf-1

>SMED30023392-orf-1 ID=SMED30023392-orf-1|Name=SMED30023392-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=324bp
MSWNDNNPDFNPFAVPPSKNDPPPYKPTVQTETLNDFNPFENEPAVIQAN
YTEPKKNETNSFQTITNADLERRQRELEERANELTRKEEEQRRRYMEFQG
NIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFI
NIFGTLSYMISQNVEGSSGTLFGMSLLLFLLFSPASYICWFRSLYKAFRS
DSSFNFFMFFFIFFAQLIILIIQVLGINTLGSCGWIISLAELKKSIGVGA
FMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASNPT
VQATATGVGTAAVSGALSRGNKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007273SCAMP
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 67..101
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availablePANTHERPTHR10687:SF8SECRETORY CARRIER-ASSOCIATED MEMBRANE PROTEIN 1coord: 29..309
NoneNo IPR availableTMHMMTMhelixcoord: 246..268
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 169..191
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
IPR007273SCAMPPFAMPF04144SCAMPcoord: 103..280
e-value: 4.3E-58
score: 196.5
IPR007273SCAMPPANTHERPTHR10687SECRETORY CARRIER-ASSOCIATED MEMBRANE PROTEIN SCAMPcoord: 29..309