Ankyrin

Overview
NameAnkyrin
Smed IDSMED30023391
Length (bp)5562
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin (SMED30023391) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin (SMED30023391) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin (SMED30023391) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin (SMED30023391) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023391

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30023391SMESG000040152.1 dd_Smed_v4_3523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023391SMESG000040152.1 dd_Smed_v4_3523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30023391SMESG000040152.1 dd_Smed_v4_3523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023391SMESG000040152.1 dd_Smed_v4_3523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023391SMESG000040152.1 dd_Smed_v6_3523_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 1473.37 bits (3813), Expect = 0.000e+0
Identity = 794/1651 (48.09%), Postives = 1081/1651 (65.48%), Query Frame = 1
Query:   85 LSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTM--------SNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQ----TKLGHEYAVASPVADWDYAP-DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDAL-GTSFGDNF-----ETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSE-DNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEY--EQRNQGETLPINTDQDKME-PFDIPDTDIVRESESMTTSDFDD 4959
            +++ + K DS  SFLRAAR+GN+ K++++L  G DI T N NGLNALH+A+KEG V +V+ LL + + V+SATKKGNT+LHIA LAG+ +VV  L++ GA +N QSQNGFTPLYMAAQENH++VVK LL N A+Q+ AT+DGFTPLAVALQQGH + VAILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  + + L+++G Q++ KTRDGLTPLHCA RSG++ +   LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNR+KV+ELL+K GASI+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ET+LH+A RA Q E+++ LL+NG+LVDARA+E+QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHI+A+E  VD A VL+EAGA   L T+KGFT LH+AAKYG + +A LLLQ    ++  G+NGLTPLH+A HY +  + +LL+E  ASP  T+KNGYTPLHIAA+KN ++IA  L+   A  N  ++ G TPLHL SQEGH  M   L+D  A+ +   K+ L+S+HLAAQEDKV VA++L   G + D+ TK GYTPL  ACH+G + M+ FL+K   N+NA+T  G T LH AAQQGH  +I  LL   A PN   +   TA  +A+R  Y+++ + LK V   VT       E   K +L+ PE M E  V D  D+ GD   T      L   +          S+    G N   ++  G +S   +L    SD++ T+S            H  + +DS    D  +      + L  E    S    W     DNV ++  P+ SGFLVSF+VDARGG+MRG RH GLRI++PP   +APTRVTCR++K  R+   P + +GEGLA R++E+GP   +F  PV++E+PHFA+LRG++RE+V+LR +NG++WKEH  + ++  + + L G   G +F     ++ E L++KRI RI+T +FP YFA+V+R++Q+ ++IG +GGV+SS+V+ QVQAVFPEGAL KRI+VGLQA  +  ELV K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P+A++  M+N   G+   LRLLCSI+GGT PAQWEDITG+TPL+ V +CVSFTT VSARFWL+DC+   E      ++Y+E I VPYM KFV+FAK+ +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  +++  GN++P+TK G      F AFKENRLP   +++D + E   G+++FM++P++ +G             + +C L I L                      I          +E + D  +  N  D   + +  L  +A  +G  W  LA+EL  T   I++++ E  N  +++S  LL  W E D KH AT   L   L +I R D+V     +      E  Q R  H  +     E +  +D    F VL +E    Q  Q E   ++ + +  + P  + + DI     S+  S F D
Sbjct:    1 MTTMLQKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITE---KHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--DSLRSFSSDRSHTLS------------HASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEGGSFLVLVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQE-PCGRLSFMKEPKSTRGLV----------HQAICNLNITLP---------------------IYTKESESDQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKH-ATDTNLVECLTKINRMDIV-----HLMETNTEPLQERISHSYAE---IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDI-----SVGYSTFQD 1586          
BLAST of Ankyrin vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 1472.99 bits (3812), Expect = 0.000e+0
Identity = 781/1599 (48.84%), Postives = 1060/1599 (66.29%), Query Frame = 1
Query:   85 LSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTM--------SNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQ----TKLGHEYAVASPVADWDYAP-DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSE-DNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDE 4830
            +++ + K DS  SFLRAAR+GN+ K++++L  G DI T N NGLNALH+A+KEG V +V+ LL + + V+SATKKGNT+LHIA LAG+ +VV  L++ GA +N QSQNGFTPLYMAAQENH++VVK LL N A+Q+ AT+DGFTPLAVALQQGH + VAILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  + + L+++G Q++ KTRDGLTPLHCA RSG++ +   LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNR+KV+ELL+K GASI+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ET+LH+A RA Q E+++ LL+NG+LVDARA+E+QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHI+A+E  VD A VL+EAGA   L T+KGFT LH+AAKYG + +A LLLQ    ++  G+NGLTPLH+A HY +  + +LL+E  ASP  T+KNGYTPLHIAA+KN ++IA  L+   A  N  ++ G TPLHL SQEGH  M   L+D  A+ +   K+ L+S+HLAAQEDKV VA++L   G + D+ TK GYTPL  ACH+G + M+ FL+K   N+NA+T  G T LH AAQQGH  +I  LL   A PN   +   TA  +A+R  Y+++ + LK V   VT       E   K +L+ PE M E  V D  D+ GD   T      L   +          S+    G N   ++  G +S   +L    SD++ T+S            H  + +DS    D  +      + L  E    S    W     DNV ++  P+ SGFLVSF+VDARGG+MRG RH GLRI++PP   +APTRVTCR++K  R+   P + +GEGLA R++E+GP   +F  PV++E+PHFA+LRG++RE+V+LR +NG++WKEH  + ++  + + L     +  ++ E L++KRI RI+T +FP YFA+V+R++Q+ ++IG +GGV+SS+V+ QVQAVFPEGAL KRI+VGLQA  +  ELV K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P+A++  M+N   G+   LRLLCSI+GGT PAQWEDITG+TPL+ V +CVSFTT VSARFWL+DC+   E      ++Y+E I VPYM KFV+FAK+ +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  +++  GN++P+TK G      F AFKENRLP   +++D + E   G+++FM++P++ +G             + +C L I L                      I          +E + D  +  N  D   + +  L  +A  +G  W  LA+EL  T   I++++ E  N  +++S  LL  W E D KH AT   L   L +I R D+V     +      E  Q R  H  +     E +  +D    F VL +E
Sbjct:    1 MTTMLQKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITE---KHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--DSLRSFSSDRSHTLS------------HASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEIL-NGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQE-PCGRLSFMKEPKSTRGLV----------HQAICNLNITLP---------------------IYTKESESDQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKH-ATDTNLVECLTKINRMDIV-----HLMETNTEPLQERISHSYAE---IEQTITLDHSEGFSVLQEE 1538          
BLAST of Ankyrin vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 1472.99 bits (3812), Expect = 0.000e+0
Identity = 781/1599 (48.84%), Postives = 1060/1599 (66.29%), Query Frame = 1
Query:   85 LSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTM--------SNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQ----TKLGHEYAVASPVADWDYAP-DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSE-DNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDE 4830
            +++ + K DS  SFLRAAR+GN+ K++++L  G DI T N NGLNALH+A+KEG V +V+ LL + + V+SATKKGNT+LHIA LAG+ +VV  L++ GA +N QSQNGFTPLYMAAQENH++VVK LL N A+Q+ AT+DGFTPLAVALQQGH + VAILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  + + L+++G Q++ KTRDGLTPLHCA RSG++ +   LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNR+KV+ELL+K GASI+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ET+LH+A RA Q E+++ LL+NG+LVDARA+E+QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHI+A+E  VD A VL+EAGA   L T+KGFT LH+AAKYG + +A LLLQ    ++  G+NGLTPLH+A HY +  + +LL+E  ASP  T+KNGYTPLHIAA+KN ++IA  L+   A  N  ++ G TPLHL SQEGH  M   L+D  A+ +   K+ L+S+HLAAQEDKV VA++L   G + D+ TK GYTPL  ACH+G + M+ FL+K   N+NA+T  G T LH AAQQGH  +I  LL   A PN   +   TA  +A+R  Y+++ + LK V   VT       E   K +L+ PE M E  V D  D+ GD   T      L   +          S+    G N   ++  G +S   +L    SD++ T+S            H  + +DS    D  +      + L  E    S    W     DNV ++  P+ SGFLVSF+VDARGG+MRG RH GLRI++PP   +APTRVTCR++K  R+   P + +GEGLA R++E+GP   +F  PV++E+PHFA+LRG++RE+V+LR +NG++WKEH  + ++  + + L     +  ++ E L++KRI RI+T +FP YFA+V+R++Q+ ++IG +GGV+SS+V+ QVQAVFPEGAL KRI+VGLQA  +  ELV K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P+A++  M+N   G+   LRLLCSI+GGT PAQWEDITG+TPL+ V +CVSFTT VSARFWL+DC+   E      ++Y+E I VPYM KFV+FAK+ +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  +++  GN++P+TK G      F AFKENRLP   +++D + E   G+++FM++P++ +G             + +C L I L                      I          +E + D  +  N  D   + +  L  +A  +G  W  LA+EL  T   I++++ E  N  +++S  LL  W E D KH AT   L   L +I R D+V     +      E  Q R  H  +     E +  +D    F VL +E
Sbjct:    1 MTTMLQKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITE---KHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--DSLRSFSSDRSHTLS------------HASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEIL-NGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQE-PCGRLSFMKEPKSTRGLV----------HQAICNLNITLP---------------------IYTKESESDQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKH-ATDTNLVECLTKINRMDIV-----HLMETNTEPLQERISHSYAE---IEQTITLDHSEGFSVLQEE 1538          
BLAST of Ankyrin vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 1472.99 bits (3812), Expect = 0.000e+0
Identity = 781/1599 (48.84%), Postives = 1060/1599 (66.29%), Query Frame = 1
Query:   85 LSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTM--------SNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQ----TKLGHEYAVASPVADWDYAP-DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSE-DNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDE 4830
            +++ + K DS  SFLRAAR+GN+ K++++L  G DI T N NGLNALH+A+KEG V +V+ LL + + V+SATKKGNT+LHIA LAG+ +VV  L++ GA +N QSQNGFTPLYMAAQENH++VVK LL N A+Q+ AT+DGFTPLAVALQQGH + VAILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  + + L+++G Q++ KTRDGLTPLHCA RSG++ +   LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNR+KV+ELL+K GASI+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ET+LH+A RA Q E+++ LL+NG+LVDARA+E+QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHI+A+E  VD A VL+EAGA   L T+KGFT LH+AAKYG + +A LLLQ    ++  G+NGLTPLH+A HY +  + +LL+E  ASP  T+KNGYTPLHIAA+KN ++IA  L+   A  N  ++ G TPLHL SQEGH  M   L+D  A+ +   K+ L+S+HLAAQEDKV VA++L   G + D+ TK GYTPL  ACH+G + M+ FL+K   N+NA+T  G T LH AAQQGH  +I  LL   A PN   +   TA  +A+R  Y+++ + LK V   VT       E   K +L+ PE M E  V D  D+ GD   T      L   +          S+    G N   ++  G +S   +L    SD++ T+S            H  + +DS    D  +      + L  E    S    W     DNV ++  P+ SGFLVSF+VDARGG+MRG RH GLRI++PP   +APTRVTCR++K  R+   P + +GEGLA R++E+GP   +F  PV++E+PHFA+LRG++RE+V+LR +NG++WKEH  + ++  + + L     +  ++ E L++KRI RI+T +FP YFA+V+R++Q+ ++IG +GGV+SS+V+ QVQAVFPEGAL KRI+VGLQA  +  ELV K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P+A++  M+N   G+   LRLLCSI+GGT PAQWEDITG+TPL+ V +CVSFTT VSARFWL+DC+   E      ++Y+E I VPYM KFV+FAK+ +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  +++  GN++P+TK G      F AFKENRLP   +++D + E   G+++FM++P++ +G             + +C L I L                      I          +E + D  +  N  D   + +  L  +A  +G  W  LA+EL  T   I++++ E  N  +++S  LL  W E D KH AT   L   L +I R D+V     +      E  Q R  H  +     E +  +D    F VL +E
Sbjct:    1 MTTMLQKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITE---KHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--DSLRSFSSDRSHTLS------------HASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEIL-NGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQE-PCGRLSFMKEPKSTRGLV----------HQAICNLNITLP---------------------IYTKESESDQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKH-ATDTNLVECLTKINRMDIV-----HLMETNTEPLQERISHSYAE---IEQTITLDHSEGFSVLQEE 1538          
BLAST of Ankyrin vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 1472.6 bits (3811), Expect = 0.000e+0
Identity = 790/1645 (48.02%), Postives = 1078/1645 (65.53%), Query Frame = 1
Query:   85 LSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTM--------SNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQ----TKLGHEYAVASPVADWDYAP-DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSE-DNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEY--EQRNQGETLPINTDQDKME-PFDIPDTDIVRESESMTTSDFDD 4959
            +++ + K DS  SFLRAAR+GN+ K++++L  G DI T N NGLNALH+A+KEG V +V+ LL + + V+SATKKGNT+LHIA LAG+ +VV  L++ GA +N QSQNGFTPLYMAAQENH++VVK LL N A+Q+ AT+DGFTPLAVALQQGH + VAILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  + + L+++G Q++ KTRDGLTPLHCA RSG++ +   LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNR+KV+ELL+K GASI+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ET+LH+A RA Q E+++ LL+NG+LVDARA+E+QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHI+A+E  VD A VL+EAGA   L T+KGFT LH+AAKYG + +A LLLQ    ++  G+NGLTPLH+A HY +  + +LL+E  ASP  T+KNGYTPLHIAA+KN ++IA  L+   A  N  ++ G TPLHL SQEGH  M   L+D  A+ +   K+ L+S+HLAAQEDKV VA++L   G + D+ TK GYTPL  ACH+G + M+ FL+K   N+NA+T  G T LH AAQQGH  +I  LL   A PN   +   TA  +A+R  Y+++ + LK V   VT        +  K +L+ PE M E  V D  D+ GD   T      L   +          S+    G N   ++  G +S   +L    SD++ T+S            H  + +DS    D  +      + L  E    S    W     DNV ++  P+ SGFLVSF+VDARGG+MRG RH GLRI++PP   +APTRVTCR++K  R+   P + +GEGLA R++E+GP   +F  PV++E+PHFA+LRG++RE+V+LR +NG++WKEH  + ++  + + L     +  ++ E L++KRI RI+T +FP YFA+V+R++Q+ ++IG +GGV+SS+V+ QVQAVFPEGAL KRI+VGLQA  +  ELV K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P+A++  M+N   G+   LRLLCSI+GGT PAQWEDITG+TPL+ V +CVSFTT VSARFWL+DC+   E      ++Y+E I VPYM KFV+FAK+ +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  +++  GN++P+TK G      F AFKENRLP   +++D + E   G+++FM++P++ +G             + +C L I L                      I          +E + D  +  N  D   + +  L  +A  +G  W  LA+EL  T   I++++ E  N  +++S  LL  W E D KH AT   L   L +I R D+V     +      E  Q R  H  +     E +  +D    F VL +E    Q  Q E   ++ + +  + P  + + DI     S+  S F D
Sbjct:    1 MTTMLQKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVT---TTTTTITEKHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--DSLRSFSSDRSHTLS------------HASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEIL-NGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQE-PCGRLSFMKEPKSTRGLV----------HQAICNLNITLP---------------------IYTKESESDQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKH-ATDTNLVECLTKINRMDIV-----HLMETNTEPLQERISHSYAE---IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDI-----SVGYSTFQD 1579          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 454/812 (55.91%), Postives = 615/812 (75.74%), Query Frame = 1
Query:  121 SFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDD 2556
            SFLRAAR+G+++K+++ L  G DI T+NANGLN+LH+ASKEG  ++V+ L+ + A V++AT+KGNT+LHIA LAG+  +V  L+E+GA VNVQS NGFTPLYMAAQENH EVVK LL + A+Q L+T+DGFTPLAVALQQGH++VVA+LLENDS+G++RLPALHIAAKKDD  AA LLL N+ N D  S SGFTPLHIAAHYG+ N+  LL+E+G +VN+QA++NI+PLHV+TKWG   +   L+ +GA ++ +T+D LTPLHCA RSG++ +   L+  G+  SAKT+NGL  LHMA+QGDH++  + L+ +   ++D T+DYLTPLHVAAHCGHVR+A LL++ + + N+RALNGFTPLHIACKKNR+KVVELLLK  A+IEATTESGL+PLHVAAFMG  NI + L+Q GANP+++T+R ET LHLA RANQ +++++L++NG+ VDA+A+E QTPLHIA+RLGN DI+ +LLQ  AN N  T+DNYS LHIAAKE   + A +L++  A   L T+KGFT LH+A+KYG + +  LLL+ GT  +++G+N +TPLH+A HY++  + +LL+E  AS    +KNGYTPLHIAA+KN +EIA  L++ +A+PN++SR GFTPLHL +QEGH +++  LI++ +D  AKA N L++MHL AQED V VA++L   G EI+SKT AGYTPLH ACHFGQ+NM+ FL+++  ++  +T    T LH AAQQGH   +  LL+  A PN + +   T   +A+R  Y+++ E L+ V       E    +  +K +   PE M E   ++SED+
Sbjct:   36 SFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQ--NPEAMNETMFSESEDE 845          

HSP 2 Score: 573.933 bits (1478), Expect = 1.253e-168
Identity = 306/626 (48.88%), Postives = 400/626 (63.90%), Query Frame = 1
Query: 2878 DNVPITRKPVTSG-------FLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSF-GDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ------GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPF--PARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLD--LHE-VAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSC 4698
            DNVPI    VT         FL+SFLVDARGG+MRG RH G+RI+VPP  AS P RVTCR ++ D++ HPP L++GE LA RILEM P   KF  PV+LEVPHFASLR R+REIVILR D+G+ WKEH LE ++ AV + L  SF  ++    + L+  RI RILT++FPMYFA+VTR+RQE+  +G +GGVI SSV+ +VQA+FP+G+L K IKV +QA  +  E+V +L GNR+AVSPIVT+EPRRRKFHKPIT+ IPLPQ+ N+GM+ Q       E   LRLLCSI+GG+ PAQWEDITG+T L+     VSFTTTVSARFWLMDCQ   + A M  ++Y EAI +PYM KF +FA+ T   E  LR FC+TDDK DKTLE QE F+L A S +VEVL  +  +LE +GN++P+TK GDQL L F  F+ENRL F    R  D +   + G++ FM +P+          S    PQ+P+CTL I L                  + G+I    K  P     +KD         +  + DL   +H+ V + +G+DWP L + L + +  I  ++  Y  +E K+   L  W    K  A  + LD+ALR+IGR+D+V+S 
Sbjct:  989 DNVPIGHH-VTQPSKLQHRTFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKI--------RSDALPPQQPICTLAISLPE----------------YTGEI----KTAPP---PKKDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKKEDANQDNLDQALRQIGRDDIVRSI 1580          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 454/812 (55.91%), Postives = 615/812 (75.74%), Query Frame = 1
Query:  121 SFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDD 2556
            SFLRAAR+G+++K+++ L  G DI T+NANGLN+LH+ASKEG  ++V+ L+ + A V++AT+KGNT+LHIA LAG+  +V  L+E+GA VNVQS NGFTPLYMAAQENH EVVK LL + A+Q L+T+DGFTPLAVALQQGH++VVA+LLENDS+G++RLPALHIAAKKDD  AA LLL N+ N D  S SGFTPLHIAAHYG+ N+  LL+E+G +VN+QA++NI+PLHV+TKWG   +   L+ +GA ++ +T+D LTPLHCA RSG++ +   L+  G+  SAKT+NGL  LHMA+QGDH++  + L+ +   ++D T+DYLTPLHVAAHCGHVR+A LL++ + + N+RALNGFTPLHIACKKNR+KVVELLLK  A+IEATTESGL+PLHVAAFMG  NI + L+Q GANP+++T+R ET LHLA RANQ +++++L++NG+ VDA+A+E QTPLHIA+RLGN DI+ +LLQ  AN N  T+DNYS LHIAAKE   + A +L++  A   L T+KGFT LH+A+KYG + +  LLL+ GT  +++G+N +TPLH+A HY++  + +LL+E  AS    +KNGYTPLHIAA+KN +EIA  L++ +A+PN++SR GFTPLHL +QEGH +++  LI++ +D  AKA N L++MHL AQED V VA++L   G EI+SKT AGYTPLH ACHFGQ+NM+ FL+++  ++  +T    T LH AAQQGH   +  LL+  A PN + +   T   +A+R  Y+++ E L+ V       E    +  +K +   PE M E   ++SED+
Sbjct:   36 SFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQ--NPEAMNETMFSESEDE 845          

HSP 2 Score: 573.933 bits (1478), Expect = 1.253e-168
Identity = 306/626 (48.88%), Postives = 400/626 (63.90%), Query Frame = 1
Query: 2878 DNVPITRKPVTSG-------FLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSF-GDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ------GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPF--PARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLD--LHE-VAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSC 4698
            DNVPI    VT         FL+SFLVDARGG+MRG RH G+RI+VPP  AS P RVTCR ++ D++ HPP L++GE LA RILEM P   KF  PV+LEVPHFASLR R+REIVILR D+G+ WKEH LE ++ AV + L  SF  ++    + L+  RI RILT++FPMYFA+VTR+RQE+  +G +GGVI SSV+ +VQA+FP+G+L K IKV +QA  +  E+V +L GNR+AVSPIVT+EPRRRKFHKPIT+ IPLPQ+ N+GM+ Q       E   LRLLCSI+GG+ PAQWEDITG+T L+     VSFTTTVSARFWLMDCQ   + A M  ++Y EAI +PYM KF +FA+ T   E  LR FC+TDDK DKTLE QE F+L A S +VEVL  +  +LE +GN++P+TK GDQL L F  F+ENRL F    R  D +   + G++ FM +P+          S    PQ+P+CTL I L                  + G+I    K  P     +KD         +  + DL   +H+ V + +G+DWP L + L + +  I  ++  Y  +E K+   L  W    K  A  + LD+ALR+IGR+D+V+S 
Sbjct:  989 DNVPIGHH-VTQPSKLQHRTFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKI--------RSDALPPQQPICTLAISLPE----------------YTGEI----KTAPP---PKKDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKKEDANQDNLDQALRQIGRDDIVRSI 1580          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 454/818 (55.50%), Postives = 617/818 (75.43%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDD 2556
            + +   SFLRAAR+G+++K+++ L  G DI T+NANGLN+LH+ASKEG  ++V+ L+ + A V++AT+KGNT+LHIA LAG+  +V  L+E+GA VNVQS NGFTPLYMAAQENH EVVK LL + A+Q L+T+DGFTPLAVALQQGH++VVA+LLENDS+G++RLPALHIAAKKDD  AA LLL N+ N D  S SGFTPLHIAAHYG+ N+  LL+E+G +VN+QA++NI+PLHV+TKWG   +   L+ +GA ++ +T+D LTPLHCA RSG++ +   L+  G+  SAKT+NGL  LHMA+QGDH++  + L+ +   ++D T+DYLTPLHVAAHCGHVR+A LL++ + + N+RALNGFTPLHIACKKNR+KVVELLLK  A+IEATTESGL+PLHVAAFMG  NI + L+Q GANP+++T+R ET LHLA RANQ +++++L++NG+ VDA+A+E QTPLHIA+RLGN DI+ +LLQ  AN N  T+DNYS LHIAAKE   + A +L++  A   L T+KGFT LH+A+KYG + +  LLL+ GT  +++G+N +TPLH+A HY++  + +LL+E  AS    +KNGYTPLHIAA+KN +EIA  L++ +A+PN++SR GFTPLHL +QEGH +++  LI++ +D  AKA N L++MHL AQED V VA++L   G EI+SKT AGYTPLH ACHFGQ+NM+ FL+++  ++  +T    T LH AAQQGH   +  LL+  A PN + +   T   +A+R  Y+++ E L+ V       E    +  +K +   PE M E   ++SED+
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQ--NPEAMNETMFSESEDE 845          

HSP 2 Score: 577.4 bits (1487), Expect = 6.890e-174
Identity = 302/618 (48.87%), Postives = 398/618 (64.40%), Query Frame = 1
Query: 2878 DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSF-GDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ------GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPF--PARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLD--LHE-VAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKS 4695
            DNVPI        FL+SFLVDARGG+MRG RH G+RI+VPP  AS P RVTCR ++ D++ HPP L++GE LA RILEM P   KF  PV+LEVPHFASLR R+REIVILR D+G+ WKEH LE ++ AV + L  SF  ++    + L+  RI RILT++FPMYFA+VTR+RQE+  +G +GGVI SSV+ +VQA+FP+G+L K IKV +QA  +  E+V +L GNR+AVSPIVT+EPRRRKFHKPIT+ IPLPQ+ N+GM+ Q       E   LRLLCSI+GG+ PAQWEDITG+T L+     VSFTTTVSARFWLMDCQ   + A M  ++Y EAI +PYM KF +FA+ T   E  LR FC+TDDK DKTLE QE F+L A S +VEVL  +  +LE +GN++P+TK GDQL L F  F+ENRL F    R  D +   + G++ FM +P+          S    PQ+P+CTL I L                  + G+I+        +   +KD         +  + DL   +H+ V + +G+DWP L + L + +  I  ++  Y  +E K+   L  W    K  A  + LD+ALR+IGR+D+V+S
Sbjct:  989 DNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKI--------RSDALPPQQPICTLAISLP----------------EYTGEIK-------TAPPPKKDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKKEDANQDNLDQALRQIGRDDIVRS 1573          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 454/818 (55.50%), Postives = 617/818 (75.43%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDD 2556
            + +   SFLRAAR+G+++K+++ L  G DI T+NANGLN+LH+ASKEG  ++V+ L+ + A V++AT+KGNT+LHIA LAG+  +V  L+E+GA VNVQS NGFTPLYMAAQENH EVVK LL + A+Q L+T+DGFTPLAVALQQGH++VVA+LLENDS+G++RLPALHIAAKKDD  AA LLL N+ N D  S SGFTPLHIAAHYG+ N+  LL+E+G +VN+QA++NI+PLHV+TKWG   +   L+ +GA ++ +T+D LTPLHCA RSG++ +   L+  G+  SAKT+NGL  LHMA+QGDH++  + L+ +   ++D T+DYLTPLHVAAHCGHVR+A LL++ + + N+RALNGFTPLHIACKKNR+KVVELLLK  A+IEATTESGL+PLHVAAFMG  NI + L+Q GANP+++T+R ET LHLA RANQ +++++L++NG+ VDA+A+E QTPLHIA+RLGN DI+ +LLQ  AN N  T+DNYS LHIAAKE   + A +L++  A   L T+KGFT LH+A+KYG + +  LLL+ GT  +++G+N +TPLH+A HY++  + +LL+E  AS    +KNGYTPLHIAA+KN +EIA  L++ +A+PN++SR GFTPLHL +QEGH +++  LI++ +D  AKA N L++MHL AQED V VA++L   G EI+SKT AGYTPLH ACHFGQ+NM+ FL+++  ++  +T    T LH AAQQGH   +  LL+  A PN + +   T   +A+R  Y+++ E L+ V       E    +  +K +   PE M E   ++SED+
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQ--NPEAMNETMFSESEDE 845          

HSP 2 Score: 577.4 bits (1487), Expect = 6.890e-174
Identity = 302/618 (48.87%), Postives = 398/618 (64.40%), Query Frame = 1
Query: 2878 DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSF-GDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ------GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPF--PARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLD--LHE-VAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKS 4695
            DNVPI        FL+SFLVDARGG+MRG RH G+RI+VPP  AS P RVTCR ++ D++ HPP L++GE LA RILEM P   KF  PV+LEVPHFASLR R+REIVILR D+G+ WKEH LE ++ AV + L  SF  ++    + L+  RI RILT++FPMYFA+VTR+RQE+  +G +GGVI SSV+ +VQA+FP+G+L K IKV +QA  +  E+V +L GNR+AVSPIVT+EPRRRKFHKPIT+ IPLPQ+ N+GM+ Q       E   LRLLCSI+GG+ PAQWEDITG+T L+     VSFTTTVSARFWLMDCQ   + A M  ++Y EAI +PYM KF +FA+ T   E  LR FC+TDDK DKTLE QE F+L A S +VEVL  +  +LE +GN++P+TK GDQL L F  F+ENRL F    R  D +   + G++ FM +P+          S    PQ+P+CTL I L                  + G+I+        +   +KD         +  + DL   +H+ V + +G+DWP L + L + +  I  ++  Y  +E K+   L  W    K  A  + LD+ALR+IGR+D+V+S
Sbjct:  989 DNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKI--------RSDALPPQQPICTLAISLP----------------EYTGEIK-------TAPPPKKDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKKEDANQDNLDQALRQIGRDDIVRS 1573          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 912.138 bits (2356), Expect = 0.000e+0
Identity = 454/818 (55.50%), Postives = 617/818 (75.43%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDD 2556
            + +   SFLRAAR+G+++K+++ L  G DI T+NANGLN+LH+ASKEG  ++V+ L+ + A V++AT+KGNT+LHIA LAG+  +V  L+E+GA VNVQS NGFTPLYMAAQENH EVVK LL + A+Q L+T+DGFTPLAVALQQGH++VVA+LLENDS+G++RLPALHIAAKKDD  AA LLL N+ N D  S SGFTPLHIAAHYG+ N+  LL+E+G +VN+QA++NI+PLHV+TKWG   +   L+ +GA ++ +T+D LTPLHCA RSG++ +   L+  G+  SAKT+NGL  LHMA+QGDH++  + L+ +   ++D T+DYLTPLHVAAHCGHVR+A LL++ + + N+RALNGFTPLHIACKKNR+KVVELLLK  A+IEATTESGL+PLHVAAFMG  NI + L+Q GANP+++T+R ET LHLA RANQ +++++L++NG+ VDA+A+E QTPLHIA+RLGN DI+ +LLQ  AN N  T+DNYS LHIAAKE   + A +L++  A   L T+KGFT LH+A+KYG + +  LLL+ GT  +++G+N +TPLH+A HY++  + +LL+E  AS    +KNGYTPLHIAA+KN +EIA  L++ +A+PN++SR GFTPLHL +QEGH +++  LI++ +D  AKA N L++MHL AQED V VA++L   G EI+SKT AGYTPLH ACHFGQ+NM+ FL+++  ++  +T    T LH AAQQGH   +  LL+  A PN + +   T   +A+R  Y+++ E L+ V       E    +  +K +   PE M E   ++SED+
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQ--NPEAMNETMFSESEDE 845          

HSP 2 Score: 571.237 bits (1471), Expect = 5.892e-172
Identity = 303/624 (48.56%), Postives = 399/624 (63.94%), Query Frame = 1
Query: 2878 DNVPI------TRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSF-GDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ------GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPF--PARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLD--LHE-VAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKS 4695
            DNVPI        K     FL+SFLVDARGG+MRG RH G+RI+VPP  AS P RVTCR ++ D++ HPP L++GE LA RILEM P   KF  PV+LEVPHFASLR R+REIVILR D+G+ WKEH LE ++ AV + L  SF  ++    + L+  RI RILT++FPMYFA+VTR+RQE+  +G +GGVI SSV+ +VQA+FP+G+L K IKV +QA  +  E+V +L GNR+AVSPIVT+EPRRRKFHKPIT+ IPLPQ+ N+GM+ Q       E   LRLLCSI+GG+ PAQWEDITG+T L+     VSFTTTVSARFWLMDCQ   + A M  ++Y EAI +PYM KF +FA+ T   E  LR FC+TDDK DKTLE QE F+L A S +VEVL  +  +LE +GN++P+TK GDQL L F  F+ENRL F    R  D +   + G++ FM +P+          S    PQ+P+CTL I L                  + G+I+        +   +KD         +  + DL   +H+ V + +G+DWP L + L + +  I  ++  Y  +E K+   L  W    K  A  + LD+ALR+IGR+D+V+S
Sbjct:  989 DNVPIGHHVTQPSKLQHRTFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKI--------RSDALPPQQPICTLAISLP----------------EYTGEIK-------TAPPPKKDLTPFEQRYGSALEKDLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKKEDANQDNLDQALRQIGRDDIVRS 1579          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303121)

HSP 1 Score: 1525.76 bits (3949), Expect = 0.000e+0
Identity = 791/1574 (50.25%), Postives = 1062/1574 (67.47%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSI-----HEAFSNDHHQFWKDSTF----TKDQYIAQTKLGH--EYAVASP--VADWDYAP-------------------------DNVP-ITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEK---RIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ--GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSC 4698
            D   SFLRAAR+GN++++++ L N  DI T+NANGLNALH+ASK+G + +V  LL + A V+SATKKGNT+LHIA LAG+ +VV  L+EH A VNVQSQNGFTPLYMAAQENH  VV+LLL N A+Q+LAT+DGFTPLAVA+QQGH+KVVA+LLE+D+RG++RLPALHIAAKKDDVKAA LLL ND N D  S SGFTPLHIA+HYGN NIANLLI++G DVN+ AK+NI+PLHV+ KWG   +   L+EKG  +E KTRDGLTPLHCA RSG+E +   LL+ G+  SAKT+NGL  LHMA+QG+H++  ++L+ +   +++ T+DYLT LHVAAHCGHVR+A LL++   + NARALNGFTPLHIACKKNR+KVVELLL+ GASI ATTESGL+PLHVAAFMG  NI + L+Q+ A+P++ T+R ET LHLA RANQ ++I+ILL+NG+ VDARA+EQQTPLHIA+RLGN+DI+ +LLQH A  +  TKD Y+ LHIAAKE   + A VLIE GA L+  T+KGFT LH+ AKYG + +A LLLQ   D + QG+NG+TPLH+A HY++  + +LL+E  ASP  T+KNG+TPLHIAARKN ++IA  L+E  A  N+ES+ GFTPLHL SQEGH +++  LI+ +A  N  AKN L+ MHL AQED V VAE+L   G  ID  TKAGYTPLH A HFGQ NM+ FL+++  N++A T+ G T LH  AQQGH  ++  LL+ KA+ N +     T  H+AR+  Y+++ + L K +T          +   K  +  PE M E+ ++DSE++ GD ++              +   +G   ++             LP  Q DK+  +S ED++     +   + D  +   D +     T+D+ +   ++    EYA   P  + +   +P                         D  P + RK     FLVSFLVDARGG+MRG RH G+R+++P  +   PTRVTCR +K  R  HPPQL +GE LA R+LE+GP   KF  PV++EVPHFASLRG++REI+ILR DNGE W+EH+++ S++ + D L   F    E    L+E+    + R +T +FP YFA+V+R+RQE+  IG +GG++SS+V+ QVQAVFP+GAL K+IKVGLQA  +DP+L AKLLG  +AVSPIVT+EPRRRKFHK IT+++P P+A ++GMINQ  G    LRLLCSI+GG + AQWED+TGSTPL+ V  CVSFTTTVSARFWLMDC+N  +  +M  +LYKE I VP++ KFV+FAK  E  E  LR FC+TDD+ DKTLE  E +   A S +VEVL+ +  ++E AGN++PVTK GDQL++ F AF+ENRLPF  R+KD    + +G+  FM++P+  +G           PQ+P+C L I L         +   + AFS        +    LS+     +I            D+ + +++  +G DW  LA E+G+    I+++ ++  +   +    +I   +D  +    + L+ AL+ IGR+D++K C
Sbjct:   10 DGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL-KTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEEEGGDTNW-----------QLDAGYEYGFGPIY-------------LPYYQGDKH-YVSSEDNMLSDQPYRYLTVDEMKSLGDDSLPIDVTRDERMDSNRMTQSAEYASGVPPTIGEEVISPHKTQVYGSSPKATVDGVYIANGSGHDEPPHVGRKLSWKSFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCF--EPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHA-DIVGRTLFMKEPKVAKGEP---------PQQPICILNIVLPEAV-----IPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIG-----------DIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1528          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303115)

HSP 1 Score: 1525.76 bits (3949), Expect = 0.000e+0
Identity = 793/1574 (50.38%), Postives = 1062/1574 (67.47%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSI-----HEAFSNDHHQFWKDSTF----TKDQYIAQTKLGH--EYAV--------------------ASPVADWD-------YAPDNVP-ITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEK---RIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ--GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSC 4698
            D   SFLRAAR+GN++++++ L N  DI T+NANGLNALH+ASK+G + +V  LL + A V+SATKKGNT+LHIA LAG+ +VV  L+EH A VNVQSQNGFTPLYMAAQENH  VV+LLL N A+Q+LAT+DGFTPLAVA+QQGH+KVVA+LLE+D+RG++RLPALHIAAKKDDVKAA LLL ND N D  S SGFTPLHIA+HYGN NIANLLI++G DVN+ AK+NI+PLHV+ KWG   +   L+EKG  +E KTRDGLTPLHCA RSG+E +   LL+ G+  SAKT+NGL  LHMA+QG+H++  ++L+ +   +++ T+DYLT LHVAAHCGHVR+A LL++   + NARALNGFTPLHIACKKNR+KVVELLL+ GASI ATTESGL+PLHVAAFMG  NI + L+Q+ A+P++ T+R ET LHLA RANQ ++I+ILL+NG+ VDARA+EQQTPLHIA+RLGN+DI+ +LLQH A  +  TKD Y+ LHIAAKE   + A VLIE GA L+  T+KGFT LH+ AKYG + +A LLLQ   D + QG+NG+TPLH+A HY++  + +LL+E  ASP  T+KNG+TPLHIAARKN ++IA  L+E  A  N+ES+ GFTPLHL SQEGH +++  LI+ +A  N  AKN L+ MHL AQED V VAE+L   G  ID  TKAGYTPLH A HFGQ NM+ FL+++  N++A T+ G T LH  AQQGH  ++  LL+ KA+ N +     T  H+AR+  Y+++ + L K +T          +   K  +  PE M E+ ++DSE++ GD ++              +   +G   ++             LP  Q DK+  +S ED++     +   + D  +   D +     T+D+ +   ++    EYA                     +SP A  D          D  P + RK     FLVSFLVDARGG+MRG RH G+R+++P  +   PTRVTCR +K  R  HPPQL +GE LA R+LE+GP   KF  PV++EVPHFASLRG++REI+ILR DNGE W+EH+++ S++ + D L   F    E    L+E+    + R +T +FP YFA+V+R+RQE+  IG +GG++SS+V+ QVQAVFP+GAL K+IKVGLQA  +DP+L AKLLG  +AVSPIVT+EPRRRKFHK IT+++P P+A ++GMINQ  G    LRLLCSI+GG + AQWED+TGSTPL+ V  CVSFTTTVSARFWLMDC+N  +  +M  +LYKE I VP++ KFV+FAK  E  E  LR FC+TDD+ DKTLE  E +   A S +VEVL+ +  ++E AGN++PVTK GDQL++ F AF+ENRLPF  R+KD    + +G+  FM++P+  +G           PQ+P+C L I L         +   + AFS        +    LS+     +I            D+ + +++  +G DW  LA E+G+    I+++ ++  +   +    +I   +D  +    + L+ AL+ IGR+D++K C
Sbjct:  160 DGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL-KTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEEEGGDTNW-----------QLDAGYEYGFGPIY-------------LPYYQGDKH-YVSSEDNMLSDQPYRYLTVDEMKSLGDDSLPIDVTRDERMDSNRMTQSAEYASGVPPTIGEEVISPHKTQVYGSSPKATVDGVYIANGSGHDEPPHVGRKLSWKSFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCF--EPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHA-DIVGRTLFMKEPKVAKGEP---------PQQPICILNIVLPEAV-----IPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIG-----------DIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1678          

HSP 2 Score: 328.176 bits (840), Expect = 8.163e-90
Identity = 208/620 (33.55%), Postives = 336/620 (54.19%), Query Frame = 1
Query:  679 HQSAS-GFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLA-----------------------------VHYSS----MPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVL 2436
            HQSA  G T    AA  GN+      ++   D+N    N +  LH+++K G++ V   L+ +GA ++  T+ G T LH A  +G E +   LL+  ++ + +++NG T L+MA+Q +H    +LL++ G N +  T D  TPL VA   GH ++  +L+E     + R       LHIA KK+ VK   LLL    + + T++SG +PLH+A+  G+ NIA +LIQ GA+ N       + LH+A +  +  M+ +LL+ G  ++A+ ++  TPLH AAR G+  ++ +LL+  A  +  TK+  + LH+AA+ +HVDAAR+L+   A ++  T    TALH+AA  G V +A LLL    D+N +  NG TPLH+A                             +H ++    M + + L++  ASP   +  G TPLH+AAR N  +I   L+ N A  ++ +R   TPLH+ S+ G+  +   L+   A  +A  K++ +++H+AA+E +  VA VL+  G  +D+ TK G+TPLH    +G I +   L++   +++AQ   G T LH+A    + QV + LL+K A P+       T  H+A R++ ++I   L
Sbjct:  155 HQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTL 770          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303112)

HSP 1 Score: 1525.38 bits (3948), Expect = 0.000e+0
Identity = 791/1574 (50.25%), Postives = 1062/1574 (67.47%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSI-----HEAFSNDHHQFWKDSTF----TKDQYIAQTKLGH--EYAVASP--VADWDYAP-------------------------DNVP-ITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEK---RIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ--GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSC 4698
            D   SFLRAAR+GN++++++ L N  DI T+NANGLNALH+ASK+G + +V  LL + A V+SATKKGNT+LHIA LAG+ +VV  L+EH A VNVQSQNGFTPLYMAAQENH  VV+LLL N A+Q+LAT+DGFTPLAVA+QQGH+KVVA+LLE+D+RG++RLPALHIAAKKDDVKAA LLL ND N D  S SGFTPLHIA+HYGN NIANLLI++G DVN+ AK+NI+PLHV+ KWG   +   L+EKG  +E KTRDGLTPLHCA RSG+E +   LL+ G+  SAKT+NGL  LHMA+QG+H++  ++L+ +   +++ T+DYLT LHVAAHCGHVR+A LL++   + NARALNGFTPLHIACKKNR+KVVELLL+ GASI ATTESGL+PLHVAAFMG  NI + L+Q+ A+P++ T+R ET LHLA RANQ ++I+ILL+NG+ VDARA+EQQTPLHIA+RLGN+DI+ +LLQH A  +  TKD Y+ LHIAAKE   + A VLIE GA L+  T+KGFT LH+ AKYG + +A LLLQ   D + QG+NG+TPLH+A HY++  + +LL+E  ASP  T+KNG+TPLHIAARKN ++IA  L+E  A  N+ES+ GFTPLHL SQEGH +++  LI+ +A  N  AKN L+ MHL AQED V VAE+L   G  ID  TKAGYTPLH A HFGQ NM+ FL+++  N++A T+ G T LH  AQQGH  ++  LL+ KA+ N +     T  H+AR+  Y+++ + L K +T          +   K  +  PE M E+ ++DSE++ GD ++              +   +G   ++             LP  Q DK+  +S ED++     +   + D  +   D +     T+D+ +   ++    EYA   P  + +   +P                         D  P + RK     FLVSFLVDARGG+MRG RH G+R+++P  +   PTRVTCR +K  R  HPPQL +GE LA R+LE+GP   KF  PV++EVPHFASLRG++REI+ILR DNGE W+EH+++ S++ + D L   F    E    L+E+    + R +T +FP YFA+V+R+RQE+  IG +GG++SS+V+ QVQAVFP+GAL K+IKVGLQA  +DP+L AKLLG  +AVSPIVT+EPRRRKFHK IT+++P P+A ++GMINQ  G    LRLLCSI+GG + AQWED+TGSTPL+ V  CVSFTTTVSARFWLMDC+N  +  +M  +LYKE I VP++ KFV+FAK  E  E  LR FC+TDD+ DKTLE  E +   A S +VEVL+ +  ++E AGN++PVTK GDQL++ F AF+ENRLPF  R+KD    + +G+  FM++P+  +G           PQ+P+C L I L         +   + AFS        +    LS+     +I            D+ + +++  +G DW  LA E+G+    I+++ ++  +   +    +I   +D  +    + L+ AL+ IGR+D++K C
Sbjct:   17 DGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL-KTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEEEGGDTNW-----------QLDAGYEYGFGPIY-------------LPYYQGDKH-YVSSEDNMLSDQPYRYLTVDEMKSLGDDSLPIDVTRDERMDSNRMTQSAEYASGVPPTIGEEVISPHKTQVYGSSPKATVDGVYIANGSGHDEPPHVGRKLSWKSFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCF--EPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHA-DIVGRTLFMKEPKVAKGEP---------PQQPICILNIVLPEAV-----IPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIG-----------DIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1535          

HSP 2 Score: 273.478 bits (698), Expect = 3.958e-73
Identity = 186/590 (31.53%), Postives = 297/590 (50.34%), Query Frame = 1
Query:  844 ERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFL--LKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQ-----------------------------NGANPNLQTIRCETSLHLAT---------------------------------RANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLN 2421
            E L ++   L+    DG T    A R+G  N+   L  LK+  + +    NGL +LH+AS+  HI     L+  G  ++  T    T LH+A+  G   +  LL+E    +N ++ NGFTPL++A ++N   VV LLL  GA+    TE G +PL VA   GH  +  VL++                             N  NP++ +    T LH+A+                                 +  +  M+ +LL+ G  ++A+ ++  TPLH AAR G+  ++ +LL+  A  +  TK+  + LH+AA+ +HVDAAR+L+   A ++  T    TALH+AA  G V +A LLL    D+N +  NG TPLH+A   + + +  LL+   AS   T+++G TPLH+AA    + I   L+++ A+P+  +  G TPLHL ++     + + L+ + A  +A+A+   + +H+A++   V +  +LL  G ++D+ TK  YT LH A   GQ  +   LI++   ++A T  G T LHL A+ GH++V   LL K+AD + +    +T  HVA   HY N
Sbjct:    2 ETLKKRFPSLQSLGGDGNTSFLRAARAG--NLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA--CHYNN 587          

HSP 3 Score: 213.386 bits (542), Expect = 8.530e-55
Identity = 140/462 (30.30%), Postives = 232/462 (50.22%), Query Frame = 1
Query: 1237 VELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFT-----------------------------ALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLL-------------------AAGC------------EIDSKTKA--GYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVL 2436
            +E L K   S+++    G +    AA  G+    L  ++N  + N        +LHLA++     ++  LL+ G++VD+  K+  T LHIA+  G  +++K+LL+H A+ N  +++ ++ L++AA+E+H    R+L+  GA   L T  GFT                             ALHIAAK   V  ATLLL    + +V  ++G TPLH+A HY +  +  LLI+  A    ++K+  +PLH+AA+     +   L+E   N  +++R+G TPLH  ++ GH+++   L++  A  +AK KN L+ +H+AAQ + V  A +LL                   AA C              D+  +A  G+TPLH AC   ++ ++  L++H  +I+A T  G T LH+AA  G + ++I LL   A P++   +  T  H+A R +  +I  +L
Sbjct:    1 METLKKRFPSLQSLGGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRIL 462          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303124)

HSP 1 Score: 1524.99 bits (3947), Expect = 0.000e+0
Identity = 793/1574 (50.38%), Postives = 1062/1574 (67.47%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSI-----HEAFSNDHHQFWKDSTF----TKDQYIAQTKLGH--EYAV--------------------ASPVADWD-------YAPDNVP-ITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEK---RIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ--GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSC 4698
            D   SFLRAAR+GN++++++ L N  DI T+NANGLNALH+ASK+G + +V  LL + A V+SATKKGNT+LHIA LAG+ +VV  L+EH A VNVQSQNGFTPLYMAAQENH  VV+LLL N A+Q+LAT+DGFTPLAVA+QQGH+KVVA+LLE+D+RG++RLPALHIAAKKDDVKAA LLL ND N D  S SGFTPLHIA+HYGN NIANLLI++G DVN+ AK+NI+PLHV+ KWG   +   L+EKG  +E KTRDGLTPLHCA RSG+E +   LL+ G+  SAKT+NGL  LHMA+QG+H++  ++L+ +   +++ T+DYLT LHVAAHCGHVR+A LL++   + NARALNGFTPLHIACKKNR+KVVELLL+ GASI ATTESGL+PLHVAAFMG  NI + L+Q+ A+P++ T+R ET LHLA RANQ ++I+ILL+NG+ VDARA+EQQTPLHIA+RLGN+DI+ +LLQH A  +  TKD Y+ LHIAAKE   + A VLIE GA L+  T+KGFT LH+ AKYG + +A LLLQ   D + QG+NG+TPLH+A HY++  + +LL+E  ASP  T+KNG+TPLHIAARKN ++IA  L+E  A  N+ES+ GFTPLHL SQEGH +++  LI+ +A  N  AKN L+ MHL AQED V VAE+L   G  ID  TKAGYTPLH A HFGQ NM+ FL+++  N++A T+ G T LH  AQQGH  ++  LL+ KA+ N +     T  H+AR+  Y+++ + L K +T          +   K  +  PE M E+ ++DSE++ GD ++              +   +G   ++             LP  Q DK+  +S ED++     +   + D  +   D +     T+D+ +   ++    EYA                     +SP A  D          D  P + RK     FLVSFLVDARGG+MRG RH G+R+++P  +   PTRVTCR +K  R  HPPQL +GE LA R+LE+GP   KF  PV++EVPHFASLRG++REI+ILR DNGE W+EH+++ S++ + D L   F    E    L+E+    + R +T +FP YFA+V+R+RQE+  IG +GG++SS+V+ QVQAVFP+GAL K+IKVGLQA  +DP+L AKLLG  +AVSPIVT+EPRRRKFHK IT+++P P+A ++GMINQ  G    LRLLCSI+GG + AQWED+TGSTPL+ V  CVSFTTTVSARFWLMDC+N  +  +M  +LYKE I VP++ KFV+FAK  E  E  LR FC+TDD+ DKTLE  E +   A S +VEVL+ +  ++E AGN++PVTK GDQL++ F AF+ENRLPF  R+KD    + +G+  FM++P+  +G           PQ+P+C L I L         +   + AFS        +    LS+     +I            D+ + +++  +G DW  LA E+G+    I+++ ++  +   +    +I   +D  +    + L+ AL+ IGR+D++K C
Sbjct:  160 DGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL-KTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEEEGGDTNW-----------QLDAGYEYGFGPIY-------------LPYYQGDKH-YVSSEDNMLSDQPYRYLTVDEMKSLGDDSLPIDVTRDERMDSNRMTQSAEYASGVPPTIGEEVISPHKTQVYGSSPKATVDGVYIANGSGHDEPPHVGRKLSWKSFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCF--EPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHA-DIVGRTLFMKEPKVAKGEP---------PQQPICILNIVLPEAV-----IPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIG-----------DIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1678          

HSP 2 Score: 327.791 bits (839), Expect = 9.678e-90
Identity = 208/620 (33.55%), Postives = 336/620 (54.19%), Query Frame = 1
Query:  679 HQSAS-GFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLA-----------------------------VHYSS----MPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVL 2436
            HQSA  G T    AA  GN+      ++   D+N    N +  LH+++K G++ V   L+ +GA ++  T+ G T LH A  +G E +   LL+  ++ + +++NG T L+MA+Q +H    +LL++ G N +  T D  TPL VA   GH ++  +L+E     + R       LHIA KK+ VK   LLL    + + T++SG +PLH+A+  G+ NIA +LIQ GA+ N       + LH+A +  +  M+ +LL+ G  ++A+ ++  TPLH AAR G+  ++ +LL+  A  +  TK+  + LH+AA+ +HVDAAR+L+   A ++  T    TALH+AA  G V +A LLL    D+N +  NG TPLH+A                             +H ++    M + + L++  ASP   +  G TPLH+AAR N  +I   L+ N A  ++ +R   TPLH+ S+ G+  +   L+   A  +A  K++ +++H+AA+E +  VA VL+  G  +D+ TK G+TPLH    +G I +   L++   +++AQ   G T LH+A    + QV + LL+K A P+       T  H+A R++ ++I   L
Sbjct:  155 HQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTL 770          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303113)

HSP 1 Score: 1523.84 bits (3944), Expect = 0.000e+0
Identity = 793/1545 (51.33%), Postives = 1049/1545 (67.90%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYG------DPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKH--STLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDS-TFTKDQYIAQTKLGHEYAVASPVADWDYAPDNVP-ITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEK---RIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ--GELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSC 4698
            D   SFLRAAR+GN++++++ L N  DI T+NANGLNALH+ASK+G + +V  LL + A V+SATKKGNT+LHIA LAG+ +VV  L+EH A VNVQSQNGFTPLYMAAQENH  VV+LLL N A+Q+LAT+DGFTPLAVA+QQGH+KVVA+LLE+D+RG++RLPALHIAAKKDDVKAA LLL ND N D  S SGFTPLHIA+HYGN NIANLLI++G DVN+ AK+NI+PLHV+ KWG   +   L+EKG  +E KTRDGLTPLHCA RSG+E +   LL+ G+  SAKT+NGL  LHMA+QG+H++  ++L+ +   +++ T+DYLT LHVAAHCGHVR+A LL++   + NARALNGFTPLHIACKKNR+KVVELLL+ GASI ATTESGL+PLHVAAFMG  NI + L+Q+ A+P++ T+R ET LHLA RANQ ++I+ILL+NG+ VDARA+EQQTPLHIA+RLGN+DI+ +LLQH A  +  TKD Y+ LHIAAKE   + A VLIE GA L+  T+KGFT LH+ AKYG + +A LLLQ   D + QG+NG+TPLH+A HY++  + +LL+E  ASP  T+KNG+TPLHIAARKN ++IA  L+E  A  N+ES+ GFTPLHL SQEGH +++  LI+ +A  N  AKN L+ MHL AQED V VAE+L   G  ID  TKAGYTPLH A HFGQ NM+ FL+++  N++A T+ G T LH  AQQGH  ++  LL+ KA+ N +     T  H+AR+  Y+++ + L K +T          +   K  +  PE M E+ ++DSE++ G      D  Y  +    + S    S  +    +    +N   QS    S +P        TI GE    E  S    Q +  S   T D        GH               D  P + RK     FLVSFLVDARGG+MRG RH G+R+++P  +   PTRVTCR +K  R  HPPQL +GE LA R+LE+GP   KF  PV++EVPHFASLRG++REI+ILR DNGE W+EH+++ S++ + D L   F    E    L+E+    + R +T +FP YFA+V+R+RQE+  IG +GG++SS+V+ QVQAVFP+GAL K+IKVGLQA  +DP+L AKLLG  +AVSPIVT+EPRRRKFHK IT+++P P+A ++GMINQ  G    LRLLCSI+GG + AQWED+TGSTPL+ V  CVSFTTTVSARFWLMDC+N  +  +M  +LYKE I VP++ KFV+FAK  E  E  LR FC+TDD+ DKTLE  E +   A S +VEVL+ +  ++E AGN++PVTK GDQL++ F AF+ENRLPF  R+KD    + +G+  FM++P+  +G           PQ+P+C L I L         +   + AFS        +    LS+     +I            D+ + +++  +G DW  LA E+G+    I+++ ++  +   +    +I   +D  +    + L+ AL+ IGR+D++K C
Sbjct:   10 DGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL-KTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEEEGGEDNMLSDQPYRYLTVDEMKSLGDDSLPIDVTRDERMDSNRMTQSAEYASGVP-------PTI-GE----EVISPHKTQVYGSSPKATVDGVYIANGSGH---------------DEPPHVGRKLSWKSFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCF--EPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHA-DIVGRTLFMKEPKVAKGEP---------PQQPICILNIVLPEAV-----IPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIG-----------DIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1497          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 1446.8 bits (3744), Expect = 0.000e+0
Identity = 768/1636 (46.94%), Postives = 1060/1636 (64.79%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAP-DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANK---GMINQGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLIS-WSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEYEQRNQGETLPINTDQDKMEPFDIPDTDIVRESESMTTSDFDDHEEIQNKEITNV 4995
            K DS  SFLRAAR+GN+ K++++L  G DI T+N NGLNALH+A+KEG VD+V+ LL + + V+SATKKGNT+LHIA LAG+ DVV  L + GA +N QSQNGFTPLYMA+QENH++VV+ LL N  +Q++AT+DGFTPLA+ALQQGH +VV+ILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  +   L+++GAQ++ KTRDGLTPLHCA RSG++     LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNRVKV+ELL+K GA I+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ET+LH+A RA Q E+++ LL+NG++VDARA+E QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHIAA+E H+D   VL+EAGA   L T+KGFT LH+A+KYG + +A LLLQ     +  G+NGLTPLH+A HY +  + +LL++  ASP  T+KNGYTPLHIAA+KN +EIA  L++  A  N +++ G  P+HL SQEGH +MA  L+   A  N   K+ L+S+HLAAQEDKVGV E+L+  G  +D +TK GYTPL  ACH+G   M+ FL+K   ++N +T  G T LH AAQQG+  +I  LL   A PN       TA  +ARR  Y+++ + L+ V   +         V  K +L+ PE M E  V D  D+ GD   T      L + +       G ++L      G+     +L   +SD  S        H+++ + H+   +D  ++       + LG E    S    W+    DN+ ++  P  SGFLVSF+VDARGG+MRG RH GLR+++PP   SAPTRVTCR++K  R+   P + +G+GLA R++E+GP   +F  PV++E+PHFA+LRG++RE+VILR + GE+WKEH  E +++ +   L     +  +  E L++KRI RI+T +FP YFA+V+R++Q+ ++IG +GGV+SS+V+ +VQAVFPEGAL KRI+VGLQ   +  ++V  +LGN+   SPIVT+EPRRRKFHKPIT+TIP+P+++     G    GE   LRLLCSI+GGT PAQWEDITG+TPL+    CVSFTT VSARFWL+DC+   E       +Y+E I VPYM KFVIFAKT +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  +++  GN++P+TK G      F AFKENRL    +++D + E   G+++F ++PR          S +++    +C L I L          A+   AF       LD    P  E  +K+                 L  +A  +G  W  LA+EL  ++  IN++++E  N  +   H LI  W E     A+ N L + L +I R D+V         +  +  Q+   H        E +  +D    F  L ++ +    G    ++  + ++ P      D+   + S+     D  +E+ +K  ++V
Sbjct:   17 KSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTLRVVTEEIV---TTTTTVTEKHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRAEDLRE---LGDDSLPGQYLDGMNYLRFSLEGGRSD--SLDRSYTPTHQSYYSKHYGIMEDVIYSNQ----VSSLGRENEKDS----WETENLDNIALSSSPAHSGFLVSFMVDARGGAMRGCRHNGLRLIIPPRKCSAPTRVTCRLVKRHRLATMPPMVEGDGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVILRSETGESWKEHHCEYTEEELNQVL-NGMDERLDPPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPEVQAVFPEGALTKRIRVGLQTQPMSVDVVRNMLGNKATFSPIVTLEPRRRKFHKPITMTIPVPKSSADPALGSFGGGETPTLRLLCSITGGTTPAQWEDITGTTPLTFTNDCVSFTTNVSARFWLIDCRQVQESVNFATLMYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKMDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHVFSFYAFKENRLALFIKIRDNTQE-PCGRLSFTKEPR----------SFRTLSHGAVCNLNISLP---------AYSKAAF-------LDIAVDPQDEADRKES---------------RLAVIANHLGFSWSELARELEFSDVQINQIRNENPNSLQDQSHALIRLWKEREGKNASENSLMKTLTKINRMDIV-------HLIETKIIQSSQDHSSHTYAEIEQTISLDHSEGFSALQEDMDSPRSGRRADVSQRRSELVPVVASIEDLSLNASSLG----DSQKELPDKVTSSV 1580          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 1416.75 bits (3666), Expect = 0.000e+0
Identity = 721/1412 (51.06%), Postives = 967/1412 (68.48%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGR-NGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAP-DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVP---------------------------------HPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANK---GMINQGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRN 4224
            K DS  SFLRAAR+GN+ K++++L  G DI T+N NGLNALH+A+KEG VD+V+ LL + + V+SATKKGNT+LHIA LAG+ DVV  L + GA +N QSQNGFTPLYMA+QENH++VV+ LL N  +Q++AT+DGFTPLA+ALQQGH +VV+ILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  +   L+++GAQ++ KTRDGLTPLHCA RSG++     LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNRVKV+ELL+K GA I+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ET+LH+A RA Q E+++ LL+NG++VDARA+E QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHIAA+E H+D   VL+EAGA   L T+KGFT LH+A+KYG + +A LLLQ     +  G+ NGLTPLH+A HY +  + +LL++  ASP  T+KNGYTPLHIAA+KN +EIA  L++  A  N +++ G  P+HL SQEGH +MA  L+   A  N   K+ L+S+HLAAQEDKVGV E+L+  G  +D +TK GYTPL  ACH+G   M+ FL+K   ++N +T  G T LH AAQQG+  +I  LL   A PN   + N TA  +ARR  Y+++ + L+ V   +         V  K +L+ PE M E  V D  D+ GD   T      L + +       G ++L      G+     +L   +SD  S        H+++ + H+   +D           + LG E    S    W+    DN+ ++  P  SGFLVSF+VDARGG+MRG RH GLR+++PP   SAPTRVTCR++K  R+                                   PP LN+GE L  RIL++GP   KF  PV++E+PHFA+LRG++RE+VILR + GE+WKEH  E +++ +   L     +  +  E L++KRI RI+T +FP YFA+V+R++Q+ ++IG +GGV+SS+V+ +VQAVFPEGAL KRI+VGLQ   +  ++V  +LGN+   SPIVT+EPRRRKFHKPIT+TIP+P+++     G    GE   LRLLCSI+GGT PAQWEDITG+TPL+    CVSFTT VSARFWL+DC+   E       +Y+E I VPYM KFVIFAKT +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  +++  GN++P+TK G      F AFKENRL    +++D + E   G+++F ++PR+
Sbjct:   29 KSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKQNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITNGN-TALAIARRLGYISVVDTLRVVTEEIV---TTTTTVTEKHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRAEDLRE---LGDDSLPGQYLDGMNYLRFSLEGGRSD--SLDRSYTPTHQSYYSKHYGIMEDV----------SSLGRENEKDS----WETENLDNIALSSSPAHSGFLVSFMVDARGGAMRGCRHNGLRLIIPPRKCSAPTRVTCRLVKRHRLATMPPMVEGDGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVILRSETGESWKEHHCEYTEEELNQVL-NGMDERLDPPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPEVQAVFPEGALTKRIRVGLQTQPMSVDVVRNMLGNKATFSPIVTLEPRRRKFHKPITMTIPVPKSSADPALGSFGGGETPTLRLLCSITGGTTPAQWEDITGTTPLTFTNDCVSFTTNVSARFWLIDCRQVQESVNFATLMYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKMDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHVFSFYAFKENRLALFIKIRDNTQE-PCGRLSFTKEPRS 1413          

HSP 2 Score: 267.314 bits (682), Expect = 3.556e-71
Identity = 165/558 (29.57%), Postives = 287/558 (51.43%), Query Frame = 1
Query:  862 GAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHL---------------------------------AVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVL 2436
            G +   K  D  T    A R+G  +     LK G +     +NGL +LH+A++  H++  Q L+  G++++  T    T LH+A+  G   +  +L +    INA++ NGFTPL++A ++N + VV  LL+ G +    TE G +PL +A   GH  +  +L++N     ++      +LH+A R +  +   +LL+N    D ++K   TPLHIAA  GN+++  +LL   A  +   ++  + LH+A+K  + +   +L++ GA+++  TR G T LH AA+ G      LLL+ G     + +NGL+PLH+                                 A H     +T LL++ +A+P   + NG+TPLHIA +KN +++ + LI+  A   + + +G TP+H+ +  GH  +   L+ + A  +       +++H+AA+  ++ V   LL  G  +D++ +   TPLH A   G+  ++  L++H  + +A T  G T LH+AA++GHL V   LL+  A  ++   +  T  HVA +   L + ++L
Sbjct:   22 GRRRRPKKSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLL 575          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 1411.36 bits (3652), Expect = 0.000e+0
Identity = 744/1578 (47.15%), Postives = 1035/1578 (65.59%), Query Frame = 1
Query:   31 LDMTLKEDTDQNKDKSSDLS-SPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVH-----------GGNNLFNHTNSGVQ-SKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAPDNVPITR----KPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTN-LRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDT----IAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            +D+   ED  + K K+   S     K DS  S+LRAAR+GN++K++D+L  G DI   N NGLNALH+ASKEG V++V  LL   A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH++VV+ LL N++SQ++AT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD K+A LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV++K GN  + + L+++G+++E KT+DGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A ++++     NA+ALNGFTPLHIACKKNRVKV+ELLLK GAS++A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q ++++ LL+NG+ VD +AK+ QT LHIA+RLG ++I++ LLQ  A PN  T   Y+ LH++A+E H + A +L+E G+ L   T+KGFT LH+AAKYG++ +A LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN LEI   L+E  A  N+ +R G +PLHL +QEG   +   L+  +A+ N   KN L+ +HLAAQ+DK GV EVLL  G EID++TK+GYTPLH ACH+G + M  FL+++    NA+T  G T LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + L+     VT        +  K +++ PE M E    D  DD    D+           + M+               G ++L      G      S  P+  SD+++T++       +F+ D     +    TKD ++A T+   EY     +  + + PD V  +      PV SGFLVSF+VDARGGSMRGSRH G+RI+VPP    APTR+TCR+ K  R+ +PP + +GEGL  R++EMGP   +F  PV++E+PHF S+RG++RE+++LR DNGE WKEH  +     +   L     +  ++   L++KRI RI+T +FP YFA+V+R++QE   +G +GGV++S  +  V+A FP+GAL K+I+VGLQA  +  ++V  ++GNR + SPIVT+EPRRRKFHKPIT+TIP+P  + + + N  +GE    LRLLCSI+GGT+PAQWEDITG+TPLS V  CVSFTT VSARFWL DCQ   E   +  +LY+E I VPY+ KFV+FAK  ++ E  +RCFC+TDDK+DKTLE QE FE  A S ++E+L+ +    E  GNI P+ K G QL  +F AFKENRLPF  +++D   E   G+++F+R+P+  +G          +PQ  +C L   L       E     S+    N K   D +    S   +K +  +++ + +      ++DL +  VA  +G  W  LA+E+  + + IN +++E  N    +S  LL  W   +   AT + L   L ++ R D+V
Sbjct:   14 VDINALEDEKERKRKTRKHSRDQKKKSDSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRG----VTDENLTATPITEKHKINVPETMNE--FLDMSDDEAVKDHEAQTVGE-EGEDAMTGETEKYLRPQDLRELGDDSLPQEGYMGFSIGARSASPRISSDRSNTLN-----RSSFARDSMMIEEILAPTKDTHLAVTR---EYNNEC-MRRYSWTPDTVDQSHNTVCSPVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSIL-NGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEPAPCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQE-PCGRISFLREPKTAKG----------LPQSAICNLNFTLPTHRKEME-----SDPDDENDK---DRRHTFASLALRKRYSYLADPASSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAVLTKVNRMDIV 1555          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 1411.36 bits (3652), Expect = 0.000e+0
Identity = 744/1578 (47.15%), Postives = 1035/1578 (65.59%), Query Frame = 1
Query:   31 LDMTLKEDTDQNKDKSSDLS-SPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVH-----------GGNNLFNHTNSGVQ-SKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAPDNVPITR----KPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTN-LRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDT----IAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            +D+   ED  + K K+   S     K DS  S+LRAAR+GN++K++D+L  G DI   N NGLNALH+ASKEG V++V  LL   A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH++VV+ LL N++SQ++AT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD K+A LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV++K GN  + + L+++G+++E KT+DGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A ++++     NA+ALNGFTPLHIACKKNRVKV+ELLLK GAS++A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q ++++ LL+NG+ VD +AK+ QT LHIA+RLG ++I++ LLQ  A PN  T   Y+ LH++A+E H + A +L+E G+ L   T+KGFT LH+AAKYG++ +A LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN LEI   L+E  A  N+ +R G +PLHL +QEG   +   L+  +A+ N   KN L+ +HLAAQ+DK GV EVLL  G EID++TK+GYTPLH ACH+G + M  FL+++    NA+T  G T LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + L+     VT        +  K +++ PE M E    D  DD    D+           + M+               G ++L      G      S  P+  SD+++T++       +F+ D     +    TKD ++A T+   EY     +  + + PD V  +      PV SGFLVSF+VDARGGSMRGSRH G+RI+VPP    APTR+TCR+ K  R+ +PP + +GEGL  R++EMGP   +F  PV++E+PHF S+RG++RE+++LR DNGE WKEH  +     +   L     +  ++   L++KRI RI+T +FP YFA+V+R++QE   +G +GGV++S  +  V+A FP+GAL K+I+VGLQA  +  ++V  ++GNR + SPIVT+EPRRRKFHKPIT+TIP+P  + + + N  +GE    LRLLCSI+GGT+PAQWEDITG+TPLS V  CVSFTT VSARFWL DCQ   E   +  +LY+E I VPY+ KFV+FAK  ++ E  +RCFC+TDDK+DKTLE QE FE  A S ++E+L+ +    E  GNI P+ K G QL  +F AFKENRLPF  +++D   E   G+++F+R+P+  +G          +PQ  +C L   L       E     S+    N K   D +    S   +K +  +++ + +      ++DL +  VA  +G  W  LA+E+  + + IN +++E  N    +S  LL  W   +   AT + L   L ++ R D+V
Sbjct:   14 VDINALEDEKERKRKTRKHSRDQKKKSDSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRG----VTDENLTATPITEKHKINVPETMNE--FLDMSDDEAVKDHEAQTVGE-EGEDAMTGETEKYLRPQDLRELGDDSLPQEGYMGFSIGARSASPRISSDRSNTLN-----RSSFARDSMMIEEILAPTKDTHLAVTR---EYNNEC-MRRYSWTPDTVDQSHNTVCSPVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSIL-NGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEPAPCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQE-PCGRISFLREPKTAKG----------LPQSAICNLNFTLPTHRKEME-----SDPDDENDK---DRRHTFASLALRKRYSYLADPASSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAVLTKVNRMDIV 1555          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 1400.57 bits (3624), Expect = 0.000e+0
Identity = 739/1581 (46.74%), Postives = 1032/1581 (65.28%), Query Frame = 1
Query:   31 LDMTLKEDTDQNKDKSSDLS-SPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQT-----NFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKD-----QYIAQTKLGH-----EYAVASPVADWDYAPDNVPITR----KPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTN-LRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDT----IAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            +D+   ED  + K K+  LS     K DS  S+LRAAR+GN++K++D+L  G DI   N NGLNALH+ASKEG V++V  LL   A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH++VV+ LL N++SQ++AT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD K+A LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV++K GN  + + L+++G+++E KT+DGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A ++++     NA+ALNGFTPLHIACKKNRVKV+ELLLK GAS++A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q ++++ LL+NG+ VD +AK+ QT LHIA+RLG ++I++ LLQ  A PN  T   Y+ LH++A+E H + A +L+E G+ L   T+KGFT LH+AAKYG++ +A LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN LEI   L+E  A  N+ +R G +PLHL +QEG   +   L+  +A+ N   KN L+ +HLAAQ+DK GV EVLL  G EID++TK+GYTPLH ACH+G + M  FL+++    NA+T      +    +  +AQQGH  +I  LL   A PN       TA  +ARR  Y+++ + L+     VT        +  K +++ PE M E    D  DD    D+               +A+ G    +       +    +LP+ +     +I    +   +FS+D       S+F +D     + +A TK  H     EY     +  + + PD V  +      PV SGFLVSF+VDARGGSMRGSRH G+RI+VPP    APTR+TCR+ K  R+ +PP + +GEGL  R++EMGP   +F  PV++E+PHF S+RG++RE+++LR DNGE WKEH  +     +   L     +  ++   L++KRI RI+T +FP YFA+V+R++QE   +G +GGV++S  +  V+A FP+GAL K+I+VGLQA  +  ++V  ++GNR + SPIVT+EPRRRKFHKPIT+TIP+P  + + + N  +GE    LRLLCSI+GGT+PAQWEDITG+TPLS V  CVSFTT VSARFWL DCQ   E   +  +LY+E I VPY+ KFV+FAK  ++ E  +RCFC+TDDK+DKTLE QE FE  A S ++E+L+ +    E  GNI P+ K G QL  +F AFKENRLPF  +++D   E   G+++F+R+P+  +G          +PQ  +C L   L       E     S+    N K   D +    S   +K +  +++ + +      ++DL +  VA  +G  W  LA+E+  + + IN +++E  N    +S  LL  W   +   AT + L   L ++ R D+V
Sbjct:   14 VDINALEDEKERKRKTRKLSRDQKKKSDSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRG----VTDENLTATPITEKHKINVPETMNE--FLDMSDDEAVKDHEAQTVG-----EEGEDAMTGETEKYLRPQDLRELGDDSLPQ-EGYMGFSIGARSASLRSFSSDRSNTLNRSSFARDSMMIEEILAPTKDTHLAVTREYNNEC-MRRYSWTPDTVDQSHNTVCSPVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSIL-NGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEPAPCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQE-PCGRISFLREPKTAKG----------LPQSAICNLNFTLPTHRKEME-----SDPDDENDK---DRRHTFASLALRKRYSYLADPASSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAVLTKVNRMDIV 1561          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 1458.74 bits (3775), Expect = 0.000e+0
Identity = 753/1539 (48.93%), Postives = 1035/1539 (67.25%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTK------LGHEYAVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSS--DTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            D+  S+LRAARSGN++K +D+L NG DI   N NGLNALH+ASKEG V+IV  L+ + ADV+++TKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVVK LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV++K GN  + + L+++G++++ KTRDGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR+KV+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q E+++ LL+NG+ V+A+AK+ QTPLHI+ARLG  DI++ LL+  A P+  T   Y+ LH++++E H D A VL+E GA   + T+KGFT LH+AAKYGK+ +  LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ ++ G  P+HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL   G  ID  TK  YTPLH A H+G I M+ FL++H   +NA+T  G T LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + L KVVT  T      + V  K +++ PE M E  V D  DD G+ D  T           +            +T   + ++ ++L    SD++ T++       +F+ D     +    +KDQ+++ T+      L H    A  +       DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++  PP + +GEGLA R++EMGP   +F  PV++E+PHF S+R ++RE+++LR +NGE WKEH  +   + + + L     +  +++E L++KRI RI+T +FP YFA+V+R++QE + IG +GGV+ S+ + +VQA FPEGAL KRI+VGLQA  +  +LV K++GNR   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T +LRLLCSI+GGT+PAQWEDITG+TPL+ V  CVSFTT VSARFWL DC   PE   +  +LY+E I VPYM KFV+FAK  +  E  LRCFC+TDDK+DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F AFKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L       E     S+    N K++       L+   +  ++     S      ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   14 DTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL-KVVTEET--LTTVQLVTEKHKMNVPETMNE--VLDMSDDEGE-DAMTGDTDKYLGPQDLKELGDDSLPQEGYTGFSIGARSASLRSFSSDRSYTLN-----RSSFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTL-------DNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELL-NGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLPTQKKETE-----SDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIV 1517          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 1456.81 bits (3770), Expect = 0.000e+0
Identity = 753/1539 (48.93%), Postives = 1035/1539 (67.25%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTK------LGHEYAVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSS--DTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            D+  S+LRAARSGN++K +D+L NG DI   N NGLNALH+ASKEG V+IV  L+ + ADV+++TKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVVK LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV++K GN  + + L+++G++++ KTRDGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR+KV+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q E+++ LL+NG+ V+A+AK+ QTPLHI+ARLG  DI++ LL+  A P+  T   Y+ LH++++E H D A VL+E GA   + T+KGFT LH+AAKYGK+ +  LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ ++ G  P+HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL   G  ID  TK  YTPLH A H+G I M+ FL++H   +NA+T  G T LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + L KVVT  T      + V  K +++ PE M E  V D  DD G+ D  T           +            +T   + ++ ++L    SD++ T++       +F+ D     +    +KDQ+++ T+      L H    A  +       DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++  PP + +GEGLA R++EMGP   +F  PV++E+PHF S+R ++RE+++LR +NGE WKEH  +   + + + L     +  +++E L++KRI RI+T +FP YFA+V+R++QE + IG +GGV+ S+ + +VQA FPEGAL KRI+VGLQA  +  +LV K++GNR   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T +LRLLCSI+GGT+PAQWEDITG+TPL+ V  CVSFTT VSARFWL DC   PE   +  +LY+E I VPYM KFV+FAK  +  E  LRCFC+TDDK+DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F AFKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L       E     S+    N K++       L+   +  ++     S      ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   14 DTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL-KVVTEET--LTTVQLVTEKHKMNVPETMNE--VLDMSDDEGE-DAMTGDTDKYLGPQDLKELGDDSLPQEGYTGFSIGARSASLRSFSSDRSYTLN-----RSSFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTL-------DNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELL-NGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLPTQKKETE-----SDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIV 1517          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 1456.81 bits (3770), Expect = 0.000e+0
Identity = 753/1539 (48.93%), Postives = 1035/1539 (67.25%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTK------LGHEYAVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSS--DTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            D+  S+LRAARSGN++K +D+L NG DI   N NGLNALH+ASKEG V+IV  L+ + ADV+++TKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVVK LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV++K GN  + + L+++G++++ KTRDGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR+KV+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q E+++ LL+NG+ V+A+AK+ QTPLHI+ARLG  DI++ LL+  A P+  T   Y+ LH++++E H D A VL+E GA   + T+KGFT LH+AAKYGK+ +  LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ ++ G  P+HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL   G  ID  TK  YTPLH A H+G I M+ FL++H   +NA+T  G T LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + L KVVT  T      + V  K +++ PE M E  V D  DD G+ D  T           +            +T   + ++ ++L    SD++ T++       +F+ D     +    +KDQ+++ T+      L H    A  +       DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++  PP + +GEGLA R++EMGP   +F  PV++E+PHF S+R ++RE+++LR +NGE WKEH  +   + + + L     +  +++E L++KRI RI+T +FP YFA+V+R++QE + IG +GGV+ S+ + +VQA FPEGAL KRI+VGLQA  +  +LV K++GNR   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T +LRLLCSI+GGT+PAQWEDITG+TPL+ V  CVSFTT VSARFWL DC   PE   +  +LY+E I VPYM KFV+FAK  +  E  LRCFC+TDDK+DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F AFKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L       E     S+    N K++       L+   +  ++     S      ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   14 DTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL-KVVTEET--LTTVQLVTEKHKMNVPETMNE--VLDMSDDEGE-DAMTGDTDKYLGPQDLKELGDDSLPQEGYTGFSIGARSASLRSFSSDRSYTLN-----RSSFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTL-------DNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELL-NGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLPTQKKETE-----SDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIV 1517          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 1452.96 bits (3760), Expect = 0.000e+0
Identity = 758/1561 (48.56%), Postives = 1041/1561 (66.69%), Query Frame = 1
Query:   76 SSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTK------LGHEYAVASPVADWDYAPDNVPITRKPVTSG-----------FLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSS--DTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            SS  +SP  K D+  S+LRAARSGN++K +D+L NG DI   N NGLNALH+ASKEG V+IV  L+ + ADV+++TKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVVK LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV++K GN  + + L+++G++++ KTRDGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR+KV+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q E+++ LL+NG+ V+A+AK+ QTPLHI+ARLG  DI++ LL+  A P+  T   Y+ LH++++E H D A VL+E GA   + T+KGFT LH+AAKYGK+ +  LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ ++ G  P+HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL   G  ID  TK  YTPLH A H+G I M+ FL++H   +NA+T  G T LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + L KVVT  T      + V  K +++ PE M E  V D  DD G+ D  T           +            +T   + ++ ++L    SD++ T++       +F+ D     +    +KDQ+++ T+      L H    A  +       DNV +   PV SG           FLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++  PP + +GEGLA R++EMGP   +F  PV++E+PHF S+R ++RE+++LR +NGE WKEH  +   + + + L     +  +++E L++KRI RI+T +FP YFA+V+R++QE + IG +GGV+ S+ + +VQA FPEGAL KRI+VGLQA  +  +LV K++GNR   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T +LRLLCSI+GGT+PAQWEDITG+TPL+ V  CVSFTT VSARFWL DC   PE   +  +LY+E I VPYM KFV+FAK  +  E  LRCFC+TDDK+DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F AFKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L       E     S+    N K++       L+   +  ++     S      ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   16 SSPRNSP--KSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL-KVVTEET--LTTVQLVTEKHKMNVPETMNE--VLDMSDDEGE-DAMTGDTDKYLGPQDLKELGDDSLPQEGYTGFSIGARSASLRSFSSDRSYTLN-----RSSFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTL-------DNVNLVSSPVHSGYVSPLPQYDASFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELL-NGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLPTQKKETE-----SDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIV 1539          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 1452.19 bits (3758), Expect = 0.000e+0
Identity = 757/1572 (48.16%), Postives = 1043/1572 (66.35%), Query Frame = 1
Query:   43 LKEDTDQNKDKSSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTK------LGHEYAVASPVADWDYAPDNVPITRKPVTSG-----------FLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSS--DTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            + E+T +   K +       K D+  S+LRAARSGN++K +D+L NG DI   N NGLNALH+ASKEG V+IV  L+ + ADV+++TKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVVK LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV++K GN  + + L+++G++++ KTRDGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR+KV+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q E+++ LL+NG+ V+A+AK+ QTPLHI+ARLG  DI++ LL+  A P+  T   Y+ LH++++E H D A VL+E GA   + T+KGFT LH+AAKYGK+ +  LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ ++ G  P+HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL   G  ID  TK  YTPLH A H+G I M+ FL++H   +NA+T  G T LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + L KVVT  T      + V  K +++ PE M E  V D  DD G+ D  T           +            +T   + ++ ++L    SD++ T++       +F+ D     +    +KDQ+++ T+      L H    A  +       DNV +   PV SG           FLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++  PP + +GEGLA R++EMGP   +F  PV++E+PHF S+R ++RE+++LR +NGE WKEH  +   + + + L     +  +++E L++KRI RI+T +FP YFA+V+R++QE + IG +GGV+ S+ + +VQA FPEGAL KRI+VGLQA  +  +LV K++GNR   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T +LRLLCSI+GGT+PAQWEDITG+TPL+ V  CVSFTT VSARFWL DC   PE   +  +LY+E I VPYM KFV+FAK  +  E  LRCFC+TDDK+DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F AFKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L       E     S+    N K++       L+   +  ++     S      ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:    1 MSEETKEKAAKPAHRKRKGKKSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL-KVVTEET--LTTVQLVTEKHKMNVPETMNE--VLDMSDDEGE-DAMTGDTDKYLGPQDLKELGDDSLPQEGYTGFSIGARSASLRSFSSDRSYTLN-----RSSFARDSMMIEELLAPSKDQHLSLTRDFDSDSLRHYSWAADTL-------DNVNLVSSPVHSGYVSPLPQYDASFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELL-NGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLPTQKKETE-----SDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIV 1537          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 1456.04 bits (3768), Expect = 0.000e+0
Identity = 742/1536 (48.31%), Postives = 1044/1536 (67.97%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAP---DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEE-EKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            K D+  S+LRAAR+G+++K +D++ NG D+   N NGLNALH+ASKEG V++V  LL + A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ R   V+F A+N+ITPLHV++K GN  + + L+++GA+++ KTRDGLTPLHC  RSG+E +   LL   +   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR++V+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L+ +GA+PN   +R ET+LH+A R+ Q E+++ L+++G+ V+A+AK+ QTPLHI+ARLG  DI++ LLQ  A+PN  T   Y+ LH+AA+E H D A  L++ GA L +TT+KGFT LH+AAKYGK+ +A+LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ +R G   +HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL+  G  +D++TK GYTPLH  CH+G I ++ FL++H+  +NA+T  G T+LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + LK     VT        +  K +++ PE M E  V D  DD G+ D  T           +            +    + ++ ++L    SD++ T++       +++ D     +    +K+Q++  T+   E+   S +  + +A    DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++ +PP + +GEGLA R++EMGP   +F  PV++E+PHF S+RG++RE+++LR +NGE WKEH  ++ ++ + + L     +  ++ E L  KRI RI+T +FP YFA+V+R++QE + IG +GG++SS+ +  VQA FPEGAL KRI+VGLQA  +  E V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T NLRLLCSI+GGT+PAQWEDITG+TPL+ +K CVSFTT VSARFWL DC    E   +  +LY+E I VPYM KFV+FAKT +  E  LRCFC+TDD++DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F +FKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L    H     A   ++F+    + L  +   L+E +        +      ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   21 KSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK----VVTEEIMTTTTITEKHKMNVPETMNE--VLDMSDDEGE-DAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLN-----RSSYARDSMMIEELLVPSKEQHLTFTR---EFDSDS-LRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELL-NGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLP--AHKKAEKADRRQSFA---SLALRKRYSYLTEPSM-------SPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1516          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 1455.27 bits (3766), Expect = 0.000e+0
Identity = 748/1537 (48.67%), Postives = 1042/1537 (67.79%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQ-SKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAP---DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEE-EKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            K D+  S+LRAAR+G+++K +D++ NG D+   N NGLNALH+ASKEG V++V  LL + A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ R   V+F A+N+ITPLHV++K GN  + + L+++GA+++ KTRDGLTPLHC  RSG+E +   LL   +   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR++V+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L+ +GA+PN   +R ET+LH+A R+ Q E+++ L+++G+ V+A+AK+ QTPLHI+ARLG  DI++ LLQ  A+PN  T   Y+ LH+AA+E H D A  L++ GA L +TT+KGFT LH+AAKYGK+ +A+LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ +R G   +HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL+  G  +D++TK GYTPLH  CH+G I ++ FL++H+  +NA+T  G T+LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + LK     VT        +  K +++ PE M E  V D  DD G+ D  T           +     G ++L      G      S  PK  SD++ T++       +++ D     +    +K+Q++  T+   E+   S +  + +A    DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++ +PP + +GEGLA R++EMGP   +F  PV++E+PHF S+RG++RE+++LR +NGE WKEH  ++ ++ + + L     +  ++ E L  KRI RI+T +FP YFA+V+R++QE + IG +GG++SS+ +  VQA FPEGAL KRI+VGLQA  +  E V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T NLRLLCSI+GGT+PAQWEDITG+TPL+ +K CVSFTT VSARFWL DC    E   +  +LY+E I VPYM KFV+FAKT +  E  LRCFC+TDD++DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F +FKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L    H     A   ++F+    + L    RP S                  ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   21 KSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK----VVTEEIMTTTTITEKHKMNVPETMNE--VLDMSDDEGE-DAITGDTDKYLGPQDLKEL--GDDSLPAEGYVGFSLGARSASPKISSDRSYTLN-----RSSYARDSMMIEELLVPSKEQHLTFTR---EFDSDS-LRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELL-NGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLP--AHKKAEKADRRQSFA---SLAL----RPQS---------------PCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1503          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 1454.5 bits (3764), Expect = 0.000e+0
Identity = 742/1536 (48.31%), Postives = 1044/1536 (67.97%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAP---DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEE-EKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            K D+  S+LRAAR+G+++K +D++ NG D+   N NGLNALH+ASKEG V++V  LL + A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ R   V+F A+N+ITPLHV++K GN  + + L+++GA+++ KTRDGLTPLHC  RSG+E +   LL   +   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR++V+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L+ +GA+PN   +R ET+LH+A R+ Q E+++ L+++G+ V+A+AK+ QTPLHI+ARLG  DI++ LLQ  A+PN  T   Y+ LH+AA+E H D A  L++ GA L +TT+KGFT LH+AAKYGK+ +A+LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ +R G   +HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL+  G  +D++TK GYTPLH  CH+G I ++ FL++H+  +NA+T  G T+LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + LK     VT        +  K +++ PE M E  V D  DD G+ D  T           +            +    + ++ ++L    SD++ T++       +++ D     +    +K+Q++  T+   E+   S +  + +A    DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++ +PP + +GEGLA R++EMGP   +F  PV++E+PHF S+RG++RE+++LR +NGE WKEH  ++ ++ + + L     +  ++ E L  KRI RI+T +FP YFA+V+R++QE + IG +GG++SS+ +  VQA FPEGAL KRI+VGLQA  +  E V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T NLRLLCSI+GGT+PAQWEDITG+TPL+ +K CVSFTT VSARFWL DC    E   +  +LY+E I VPYM KFV+FAKT +  E  LRCFC+TDD++DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F +FKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L    H     A   ++F+    + L  +   L+E +        +      ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   21 KSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK----VVTEEIMTTTTITEKHKMNVPETMNE--VLDMSDDEGE-DAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLN-----RSSYARDSMMIEELLVPSKEQHLTFTR---EFDSDS-LRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELL-NGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLP--AHKKAEKADRRQSFA---SLALRKRYSYLTEPSM-------SPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1516          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 1453.73 bits (3762), Expect = 0.000e+0
Identity = 745/1548 (48.13%), Postives = 1048/1548 (67.70%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDP-DYTTIP-ASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKL----------GHEYAVASPVADWDYAP---DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEE-EKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            K D+  S+LRAAR+G+++K +D++ NG D+   N NGLNALH+ASKEG V++V  LL + A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ R   V+F A+N+ITPLHV++K GN  + + L+++GA+++ KTRDGLTPLHC  RSG+E +   LL   +   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR++V+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L+ +GA+PN   +R ET+LH+A R+ Q E+++ L+++G+ V+A+AK+ QTPLHI+ARLG  DI++ LLQ  A+PN  T   Y+ LH+AA+E H D A  L++ GA L +TT+KGFT LH+AAKYGK+ +A+LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ +R G   +HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL+  G  +D++TK GYTPLH  CH+G I ++ FL++H+  +NA+T  G T+LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + LK     VT        +  K +++ PE M E  V D  DD GD   +  IP    +  ++   +A+ G  + +       +    +LP ++     ++    +   +FS+D       S++ +D  + +  L            E+   S +  + +A    DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++ +PP + +GEGLA R++EMGP   +F  PV++E+PHF S+RG++RE+++LR +NGE WKEH  ++ ++ + + L     +  ++ E L  KRI RI+T +FP YFA+V+R++QE + IG +GG++SS+ +  VQA FPEGAL KRI+VGLQA  +  E V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T NLRLLCSI+GGT+PAQWEDITG+TPL+ +K CVSFTT VSARFWL DC    E   +  +LY+E I VPYM KFV+FAKT +  E  LRCFC+TDD++DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F +FKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L    H     A   ++F+    + L  +   L+E +        +      ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   21 KSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK----VVTEEIMTTTTITEKHKMNVPETMNE--VLDMSDDEGDKCTWFKIPKVQEVLVKS--EDAITGDTDKYLGPQDLKELGDDSLP-AEGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDS-LRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELL-NGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLP--AHKKAEKADRRQSFA---SLALRKRYSYLTEPSM-------SPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1534          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 1453.73 bits (3762), Expect = 0.000e+0
Identity = 748/1537 (48.67%), Postives = 1042/1537 (67.79%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQ-SKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAP---DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEE-EKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            K D+  S+LRAAR+G+++K +D++ NG D+   N NGLNALH+ASKEG V++V  LL + A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ R   V+F A+N+ITPLHV++K GN  + + L+++GA+++ KTRDGLTPLHC  RSG+E +   LL   +   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR++V+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L+ +GA+PN   +R ET+LH+A R+ Q E+++ L+++G+ V+A+AK+ QTPLHI+ARLG  DI++ LLQ  A+PN  T   Y+ LH+AA+E H D A  L++ GA L +TT+KGFT LH+AAKYGK+ +A+LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ +R G   +HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL+  G  +D++TK GYTPLH  CH+G I ++ FL++H+  +NA+T  G T+LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + LK     VT        +  K +++ PE M E  V D  DD G+ D  T           +     G ++L      G      S  PK  SD++ T++       +++ D     +    +K+Q++  T+   E+   S +  + +A    DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++ +PP + +GEGLA R++EMGP   +F  PV++E+PHF S+RG++RE+++LR +NGE WKEH  ++ ++ + + L     +  ++ E L  KRI RI+T +FP YFA+V+R++QE + IG +GG++SS+ +  VQA FPEGAL KRI+VGLQA  +  E V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T NLRLLCSI+GGT+PAQWEDITG+TPL+ +K CVSFTT VSARFWL DC    E   +  +LY+E I VPYM KFV+FAKT +  E  LRCFC+TDD++DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F +FKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L    H     A   ++F+    + L    RP S                  ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   21 KSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK----VVTEEIMTTTTITEKHKMNVPETMNE--VLDMSDDEGE-DAITGDTDKYLGPQDLKEL--GDDSLPAEGYVGFSLGARSASPKISSDRSYTLN-----RSSYARDSMMIEELLVPSKEQHLTFTR---EFDSDS-LRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELL-NGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLP--AHKKAEKADRRQSFA---SLAL----RPQS---------------PCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1503          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 1454.88 bits (3765), Expect = 0.000e+0
Identity = 738/1423 (51.86%), Postives = 994/1423 (69.85%), Query Frame = 1
Query:   34 DMTLKEDTDQNKDKSSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSA--------SGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTM--------SNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQ----TKLGHEYAVASPVADWDYAP-DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQG 4233
            D   K D+ +  + SS       K DS  SFLRAAR+GN+ K++++L  G DI T N NGLNALH+A+KEG V +V+ LL + + V+SATKKGNT+LHIA LAG+ +VV  L++ GA +N QSQNGFTPLYMAAQENH++VVK LL N A+Q+ AT+DGFTPLAVALQQGH + VAILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS         SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  + + L+++G Q++ KTRDGLTPLHCA RSG++ +   LL+  +   A+T+NGL+ LHMA+QGDH+EC + L+ Y   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNR+KV+ELL+K GASI+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ET+LH+A RA Q E+++ LL+NG+LVDARA+E+QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHI+A+E  VD A VL+EAGA   L T+KGFT LH+AAKYG + +A LLLQ    ++  G+NGLTPLH+A HY +  + +LL+E  ASP  T+KNGYTPLHIAA+KN ++IA  L+   A  N+ ++ G TPLHL SQEGH  M   L+D  A+ +   K+ L+S+HLAAQEDKV VA++L   G + D+ TK GYTPL  ACH+G + M+ FL+K   N+NA+T  G T LH AAQQGH  +I  LL   A PN   +   TA  +A+R  Y+++ + LK V   VT        +  K +L+ PE M E  V D  D+ GD   T      L   +          S+    G N   ++  G +S   +L    SD++ T+S            H  + +DS    D  +      + L  E    S    W     DNV ++  P+ SGFLVSF+VDARGG+MRG RH GLRI++PP   +APTRVTCR++K  R+   P + +GEGLA R++E+GP   +F  PV++E+PHFA+LRG++RE+V+LR +NG++WKEH  + ++  + + L     +  ++ E L++KRI RI+T +FP YFA+V+R++Q+ ++IG +GGV+SS+V+SQVQAVFPEGAL KRI+VGLQA  +  ELV K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P+A++  M+N   G+   LRLLCSI+GGT PAQWEDITG+TPL+ V +CVSFTT VSARFWL+DC+   E      ++Y+E I VPYM KFV+FAK+ +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  +++  GN++P+TK G      F AFKENRLP   +++D + +   G+++FM++P++ +G
Sbjct:    5 DAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVT---TTTTTITEKHKLNVPETMTE--VLDVSDEEGDDTVTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--DSLRSFSSDRSHTLS------------HASYLRDSAMIDDTVVIPSHQVSALAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILN-GMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRD-TTQEPCGRLSFMKEPKSTRG 1406          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 1445.25 bits (3740), Expect = 0.000e+0
Identity = 745/1569 (47.48%), Postives = 1049/1569 (66.86%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDD----------YGDPDYTT------------IP-ASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKL----------GHEYAVASPVADWDYAP---DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEE-EKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            K D+  S+LRAAR+G+++K +D++ NG D+   N NGLNALH+ASKEG V++V  LL + A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ R   V+F A+N+ITPLHV++K GN  + + L+++GA+++ KTRDGLTPLHC  RSG+E +   LL   +   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR++V+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L+ +GA+PN   +R ET+LH+A R+ Q E+++ L+++G+ V+A+AK+ QTPLHI+ARLG  DI++ LLQ  A+PN  T   Y+ LH+AA+E H D A  L++ GA L +TT+KGFT LH+AAKYGK+ +A+LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ +R G   +HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL+  G  +D++TK GYTPLH  CH+G I ++ FL++H+  +NA+T  G T+LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + LK     VT        +  K +++ PE M E  V D  DD            D +Y +            IP    +  ++   +A+ G  + +       +    +LP ++     ++    +   +FS+D       S++ +D  + +  L            E+   S +  + +A    DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++ +PP + +GEGLA R++EMGP   +F  PV++E+PHF S+RG++RE+++LR +NGE WKEH  ++ ++ + + L     +  ++ E L  KRI RI+T +FP YFA+V+R++QE + IG +GG++SS+ +  VQA FPEGAL KRI+VGLQA  +  E V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T NLRLLCSI+GGT+PAQWEDITG+TPL+ +K CVSFTT VSARFWL DC    E   +  +LY+E I VPYM KFV+FAKT +  E  LRCFC+TDD++DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F +FKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L    H     A   ++F+    + L  +   L+E +        +      ++D+ +  VA  +G  W  LA+EL  + + IN+++ E  N    +S  LL  W   +   AT + L   L +I R D+V
Sbjct:   21 KSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK----VVTEEIMTTTTITEKHKMNVPETMNE--VLDMSDDEVRKASAPEKLSDGEYISDGEEGDKCTWFKIPKVQEVLVKS--EDAITGDTDKYLGPQDLKELGDDSLP-AEGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDS-LRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELL-NGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITLP--AHKKAEKADRRQSFA---SLALRKRYSYLTEPSM-------SPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1555          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 1441.79 bits (3731), Expect = 0.000e+0
Identity = 740/1456 (50.82%), Postives = 993/1456 (68.20%), Query Frame = 1
Query:   34 DMTLKEDTDQNKDKSSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSA--------SGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTM--------SNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQ----TKLGHEYAVASPVADWDYAP-DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPH---------------------------------PPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQG 4233
            D   K D+ +  + SS       K DS  SFLRAAR+GN+ K++++L  G DI T N NGLNALH+A+KEG V +V+ LL + + V+SATKKGNT+LHIA LAG+ +VV  L++ GA +N QSQNGFTPLYMAAQENH++VVK LL N A+Q+ AT+DGFTPLAVALQQGH + VAILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS         SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  + + L+++G Q++ KTRDGLTPLHCA RSG++ +   LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNR+KV+ELL+K GASI+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ET+LH+A RA Q E+++ LL+NG+LVDARA+E+QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHI+A+E  VD A VL+EAGA   L T+KGFT LH+AAKYG + +A LLLQ    ++  G+NGLTPLH+A HY +  + +LL+E  ASP  T+KNGYTPLHIAA+KN ++IA  L+   A  N  ++ G TPLHL SQEGH  M   L+D  A+ +   K+ L+S+HLAAQEDKV VA++L   G + D+ TK GYTPL  ACH+G + M+ FL+K   N+NA+T  G T LH AAQQGH  +I  LL   A PN   +   TA  +A+R  Y+++ + LK V   VT        +  K +L+ PE M E  V D  D+ GD   T      L   +          S+    G N   ++  G +S   +L    SD++ T+S            H  + +DS    D  +      + L  E    S    W     DNV ++  P+ SGFLVSF+VDARGG+MRG RH GLRI++PP   +APTRVTCR++K  R+                                   PP LN+GE L  RIL++GP   KF  PV++E+PHFA+LRG++RE+V+LR +NG++WKEH  + ++  + + L     +  ++ E L++KRI RI+T +FP YFA+V+R++Q+ ++IG +GGV+SS+V+ QVQAVFPEGAL KRI+VGLQA  +  ELV K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P+A++  M+N   G+   LRLLCSI+GGT PAQWEDITG+TPL+ V +CVSFTT VSARFWL+DC+   E      ++Y+E I VPYM KFV+FAK+ +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  +++  GN++P+TK G      F AFKENRLP   +++D + +   G+++FM++P++ +G
Sbjct:    5 DAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTT---TTTITEKHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRS--DSLRSFSSDRSHTLS------------HASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILN-GMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRD-TTQEPCGRLSFMKEPKSTRG 1439          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 1432.93 bits (3708), Expect = 0.000e+0
Identity = 716/1417 (50.53%), Postives = 990/1417 (69.87%), Query Frame = 1
Query:  121 SFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNT-MSNAVHGGNNLFNHTNS--GVQS----KHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKD-----QYIAQTKLGH-----EYAVASPVADWDYAP---DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKL 4302
            S+LRAAR+G+++K +D++ NG DI   N NGLNALH+ASKEG V++V  LL + A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVVK LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ R   V+F A+N+ITPLHV++K GN  + + L+++GA+++ KTRDGLTPLHC  RSG+E +   LL   +   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR+KV+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L+ +GA+PN   +R ET+LH+A R+ Q E+++ L+++G+ V+A+AK+ QTPLHI+ARLG  DI++ LLQ  A+PN  T   Y+ LH++A+E H D A  L++ GA L +TT+KGFT LH+AAKYGK+ +A LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ +R G   +HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL+  G  +D++TK GYTPLH  CH+G I ++ FL++H+  +NA+T  G T LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + LK     VT        V  K +++ PE M E  V D  DD    +     A  + S    +S+   G + +   T+   G Q        +LP ++     ++    +   +FS+D       S++ +D     + +  +K  H     E+   S +  + +A    DNV +   P+ SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++ +PP + +GEGLA R++EMGP   +F  PV++E+PHF S+RG++RE+++LR +NGE WKEH  ++ ++ + + L     +  ++ E L +KRI RI+T +FP YFA+V+R++QE + IG +GG++SS+ +  VQA FPEGAL KRI+VGLQA  +  E+V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T NLRLLCSI+GGT+PAQWEDITG+TPL+ +K CVSFTT VSARFWL DC    E   +  +LY+E I VPYM KFV+FAK  +  E  LRCFC+TDDK+DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F +FKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L
Sbjct:   44 SYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK----IVTEETMTTTTVTEKHKMNVPETMNE--VLDMSDD----EVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLP-AEGYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDS-LRHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLN-GMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITL 1436          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 1419.06 bits (3672), Expect = 0.000e+0
Identity = 718/1454 (49.38%), Postives = 1003/1454 (68.98%), Query Frame = 1
Query:   31 LDMTLKEDTDQNKDKSSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSA--------SGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNS--GVQS----KHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKD-----QYIAQTKLGH-----EYAVASPVADWDYAP---DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELT-NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKL 4302
            L++  +E+T++ K           K D+  S+LRAAR+G+++K +D++ NG D+   N NGLNALH+ASKEG V++V  LL + A+V++ATKKGNT+LHIA LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL N ASQ+LAT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S         SGFTPLHIAAHYGN+N+A LL+ R   V+F A+N+ITPLHV++K GN  + + L+++GA+++ KTRDGLTPLHC  RSG+E +   LL   +   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A +L++     NA+ALNGFTPLHIACKKNR++V+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L+ +GA+PN   +R ET+LH+A R+ Q E+++ L+++G+ V+A+AK+ QTPLHI+ARLG  DI++ LLQ  A+PN  T   Y+ LH++A+E H D A  L++ GA L +TT+KGFT LH+AAKYGK+ +A+LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN ++IA  L+E  A+ N+ +R G   +HL +QEGH  M   L+   A+ N   K+ L+ +HLAAQED+V VAEVL+  G  +D++TK GYTPLH  CH+G I ++ FL++H+  +NA+T  G T LH AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + LK     VT        +  K +++ PE M E  V D  DD  +    + P   L     +S+   G + +   T+   G Q        +LP ++     ++    +   +FS+D       S++ +D     + +  +K  H     E+   S +  + +A    DNV +   PV SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++ +PP + +GEGLA R++EMGP   +F  PV++E+PHF S+RG++RE+++LR +NGE WKEH  ++ ++ + + L     +  ++ E L  KRI RI+T +FP YFA+V+R++QE + IG +GG++SS+ +  VQA FPEGAL KRI+VGLQA  +  E V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T +LRLLCSI+GGT+PAQWEDITG+TPL+ +K CVSFTT VSARFWL DC    E   +  +LY+E I VPYM KFV+FAKT +  E  LRCFC+TDD++DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL  +F +FKENRLPF  +++D S E   G+++F+++P+  +G          +PQ  +C L I L
Sbjct:   14 LEINAEEETEKKKKHRKRSRDRKKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK----VVTEEIMTTTTITEKHKMNVPETMNE--VLDMSDD--EVGKASAPEK-LSDGEYISDGEEGEDAITGDTDKYLGPQDLKELGDDSLP-AEGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLPFTREFDSDS-LRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLSELLN-GMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKVRDTSQE-PCGRLSFLKEPKTTKG----------LPQTAVCNLNITL 1444          
BLAST of Ankyrin vs. TrEMBL
Match: A0A4Z2CVV7 (Ankyrin-2 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_007018 PE=4 SV=1)

HSP 1 Score: 1849.33 bits (4789), Expect = 0.000e+0
Identity = 941/1719 (54.74%), Postives = 1203/1719 (69.98%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFL-DNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIE---NQANPNS------ESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRW--------------------------XXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAV------------------HGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFS--NDHHQFWKDSTF---TKDQYIAQTKLGHEYAVA-----------SPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQG-------ELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDP----RNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEH---------------------------------MAHISEAFSHNGKI----ELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNF-----INKLQSEYINEEE--------------------------------------------KSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQM 4758
            K D GQ FLRAAR+GN+QKI+  + ++  D+ T NANGLNALH+ASKEG  D+V+ L+ + A  N+ATKKGNT+LHIA LAG+ +VV  L+E GA+VNVQ+QNGFTPLYMAAQENH+EVV+LLL N A+  L TDDGFTPLAVALQQGH++VVA+LLE+DSRG++ LPALHIA+KKDD+KAANLLL +D NVDHQSASGFTPLHIAAHYGNVN+  LLI RG ++NFQAKNNITPLHV++KWGN  V ERL+  GA+L+C+TRDGLTPLHCA RSG++ +   LL +G+N SAKTR+GL SLHMA+QGDH++  +LL+ +G   +D T+DYLT LHVAAHCG+VR+A LL+E AC++NARALNGFTPLHIAC+KN++K+VELLLK    I+ATTESGL+PLHVA FMG+ NI ++L+Q+GAN N  T+RCETSLHLATRA Q ++ ++LL+NG+ VD +A+  QTPLHIA+R+GN++++ +LL+H AN  + TKD Y+ LH+AAK +H +   +L++ GA+LE+ T+ GFT LH+A K+  +  A  LL  G + N  GRNGLTPLHLA HY S+PM  LL+E +ASP   +KNG+ PLHIAA K+LL+I   LIE   +Q N N+      +SRNGFTPLHL  Q+G++KM K LIDS ++ NA AKN L++MHLAAQED V  AE+L AAG E+D KTKAGYTPLHTACHFGQ+NM+ FL+    ++NA T  GS +LHLAAQQGH  VI  LL+  A+PN+RN    T AHVAR QHYLNIFE L++V TC+  W                          +++      +  L+ P++M +NP+TD+E++  +PD+T +P+SPLFSR     ++                      N  +  N G +S      K   DK S +SGEDSIHE  +  N H   W+D      T++  + +T++  ++A             S + +WD+ PDNVPI+R+PV SGFLVSFLVDARGGSMRGSRH GLRILVPPSAASAPTR+TCRM++ +R   PPQLND EGLACRI+E+GPHPC+FNSPVLLE+PHFA+LRGR RE+V+LR DN E W+EHSLE +DQAV  A+G SF +  ET E L+EKRI+RILTN+FP Y A+V+R+RQE S++G+DGGV+SS+V+ QVQAVFPEGALQKRI+VGLQA  I PELV +L GNR+ VSPIVT+EPRRRKFHKPIT+TIPLP+A  +GM+N          + +LRLLCSI+GGT PAQWEDITGSTPLS+VK CVSFTTTVSARFWLMDC    E AE+   LY EA LVPYMGKFV+F K  + +E L+RCFC+TDDK+DKTLECQEGFEL AASPEVEV++ R  WLE AGN++PV K+ +QLRLHFNAF+ENRL FP R+KD   E ++GK+AFMR+P    R+  G +   Y   +  QKPLCTLE++LS+ N                                      M  +S  F +  K       + +    S +   +W + S +SD IA+S +DL  VA E+GSDWP L + L   +N      +N+L + +INE E                                            ++L +L++W E+N   ATGNELD ALRRIGREDV+KSCM+  + V + DE  +A  Q+
Sbjct:   21 KSDIGQHFLRAARAGNIQKIVVLINEHNADVHTCNANGLNALHLASKEGHADVVRELIERGAKPNTATKKGNTALHIASLAGQFEVVKLLLEAGAEVNVQAQNGFTPLYMAAQENHLEVVRLLLANGANPGLTTDDGFTPLAVALQQGHDRVVALLLESDSRGKVCLPALHIASKKDDIKAANLLLNSDVNVDHQSASGFTPLHIAAHYGNVNMTELLISRGANINFQAKNNITPLHVASKWGNQGVAERLITAGAELDCRTRDGLTPLHCAARSGHDTVVHLLLSAGANISAKTRSGLNSLHMAAQGDHVDTARLLLQHGAQPDDPTIDYLTALHVAAHCGNVRVAKLLLERACDVNARALNGFTPLHIACQKNKIKIVELLLKYNCLIQATTESGLTPLHVACFMGYLNIVVLLLQHGANANAPTVRCETSLHLATRAGQTDVARLLLRNGAQVDVKARGNQTPLHIASRMGNLELVILLLEHAANVQSSTKDTYTPLHLAAKGNHKEICELLLKNGAELEVATKSGFTPLHLAVKHSHLETARYLLLSGANMNAVGRNGLTPLHLATHYGSLPMVELLLEHKASPISQAKNGFIPLHIAAEKHLLDIGRLLIEATGDQNNNNASDCCSIQSRNGFTPLHLACQDGNEKMTKLLIDSGSEVNALAKNGLTAMHLAAQEDSVKAAELLFAAGSELDVKTKAGYTPLHTACHFGQVNMVRFLVGKGADVNAVTCMGSNALHLAAQQGHSTVIYVLLESGANPNMRNKYGWTPAHVARHQHYLNIFEALRQVTTCIESWEHENTEDFPINASDLASSGSDYTSMSKQQHVSSTNRHGLEHPDMMRDNPITDTEEECMEPDFTIMPSSPLFSRAQSRQSLAQQLHMQHHQQQQAYHQYKSDYNKHSDENYGHRSGGGNHVKMALDKMSNVSGEDSIHEGTNTENAHAVNWRDGHMNNGTREVGLCETRISRDFAELGMAGASSLTGFSGLVEWDFTPDNVPISRRPVASGFLVSFLVDARGGSMRGSRHPGLRILVPPSAASAPTRITCRMLRPERTARPPQLNDCEGLACRIIELGPHPCRFNSPVLLEIPHFAALRGRQRELVVLRSDNAETWREHSLEATDQAVQSAVGQSF-NALETMEELREKRIIRILTNDFPQYMAVVSRIRQESSLVGSDGGVLSSTVVPQVQAVFPEGALQKRIRVGLQAQPIAPELVTRLFGNRVTVSPIVTLEPRRRKFHKPITLTIPLPKAIVRGMLNPSASDLKSQNVPSLRLLCSITGGTAPAQWEDITGSTPLSKVKDCVSFTTTVSARFWLMDCLTVHEAAELASMLYAEATLVPYMGKFVVFTKRLDTDEALVRCFCVTDDKVDKTLECQEGFELCAASPEVEVIESRPAWLEAAGNLLPVAKISEQLRLHFNAFRENRLAFPVRVKDVQQE-AIGKLAFMREPRQPIRDGDGDSQYIYHEITPSQKPLCTLEVRLSSDNGMGGGTGGQQGLDLSLIGLENHPEFLDQLNETSAAELTMGSLSCVFPYPAKRVNEQVFNGQNNDESNKPAGNWAS-SYTSDVIARSQIDLIHVASEIGSDWPKLIEVLLPQSNLKSSCTVNQLVN-WINESEPKWQMERNRLAVEMGKITGEEEGGNVAGSFGGPISVHELRTIQDQALAVLLAWREENGDSATGNELDHALRRIGREDVIKSCMREIRYVLDADEHAKATRQI 1735          
BLAST of Ankyrin vs. TrEMBL
Match: A0A4Z2CW11 (Ankyrin-2 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007018 PE=4 SV=1)

HSP 1 Score: 1848.94 bits (4788), Expect = 0.000e+0
Identity = 940/1717 (54.75%), Postives = 1202/1717 (70.01%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFL-DNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIE---NQANPNS------ESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRW--------------------------XXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAV------------------HGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFS--NDHHQFWKDSTF---TKDQYIAQTKLGHEYAVA-----------SPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQG-------ELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDP----RNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEH---------------------------------MAHISEAFSHNGKI----ELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNF-----INKLQSEYINEEE--------------------------------------------KSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQM 4758
            D GQ FLRAAR+GN+QKI+  + ++  D+ T NANGLNALH+ASKEG  D+V+ L+ + A  N+ATKKGNT+LHIA LAG+ +VV  L+E GA+VNVQ+QNGFTPLYMAAQENH+EVV+LLL N A+  L TDDGFTPLAVALQQGH++VVA+LLE+DSRG++ LPALHIA+KKDD+KAANLLL +D NVDHQSASGFTPLHIAAHYGNVN+  LLI RG ++NFQAKNNITPLHV++KWGN  V ERL+  GA+L+C+TRDGLTPLHCA RSG++ +   LL +G+N SAKTR+GL SLHMA+QGDH++  +LL+ +G   +D T+DYLT LHVAAHCG+VR+A LL+E AC++NARALNGFTPLHIAC+KN++K+VELLLK    I+ATTESGL+PLHVA FMG+ NI ++L+Q+GAN N  T+RCETSLHLATRA Q ++ ++LL+NG+ VD +A+  QTPLHIA+R+GN++++ +LL+H AN  + TKD Y+ LH+AAK +H +   +L++ GA+LE+ T+ GFT LH+A K+  +  A  LL  G + N  GRNGLTPLHLA HY S+PM  LL+E +ASP   +KNG+ PLHIAA K+LL+I   LIE   +Q N N+      +SRNGFTPLHL  Q+G++KM K LIDS ++ NA AKN L++MHLAAQED V  AE+L AAG E+D KTKAGYTPLHTACHFGQ+NM+ FL+    ++NA T  GS +LHLAAQQGH  VI  LL+  A+PN+RN    T AHVAR QHYLNIFE L++V TC+  W                          +++      +  L+ P++M +NP+TD+E++  +PD+T +P+SPLFSR     ++                      N  +  N G +S      K   DK S +SGEDSIHE  +  N H   W+D      T++  + +T++  ++A             S + +WD+ PDNVPI+R+PV SGFLVSFLVDARGGSMRGSRH GLRILVPPSAASAPTR+TCRM++ +R   PPQLND EGLACRI+E+GPHPC+FNSPVLLE+PHFA+LRGR RE+V+LR DN E W+EHSLE +DQAV  A+G SF +  ET E L+EKRI+RILTN+FP Y A+V+R+RQE S++G+DGGV+SS+V+ QVQAVFPEGALQKRI+VGLQA  I PELV +L GNR+ VSPIVT+EPRRRKFHKPIT+TIPLP+A  +GM+N          + +LRLLCSI+GGT PAQWEDITGSTPLS+VK CVSFTTTVSARFWLMDC    E AE+   LY EA LVPYMGKFV+F K  + +E L+RCFC+TDDK+DKTLECQEGFEL AASPEVEV++ R  WLE AGN++PV K+ +QLRLHFNAF+ENRL FP R+KD   E ++GK+AFMR+P    R+  G +   Y   +  QKPLCTLE++LS+ N                                      M  +S  F +  K       + +    S +   +W + S +SD IA+S +DL  VA E+GSDWP L + L   +N      +N+L + +INE E                                            ++L +L++W E+N   ATGNELD ALRRIGREDV+KSCM+  + V + DE  +A  Q+
Sbjct:    3 DIGQHFLRAARAGNIQKIVVLINEHNADVHTCNANGLNALHLASKEGHADVVRELIERGAKPNTATKKGNTALHIASLAGQFEVVKLLLEAGAEVNVQAQNGFTPLYMAAQENHLEVVRLLLANGANPGLTTDDGFTPLAVALQQGHDRVVALLLESDSRGKVCLPALHIASKKDDIKAANLLLNSDVNVDHQSASGFTPLHIAAHYGNVNMTELLISRGANINFQAKNNITPLHVASKWGNQGVAERLITAGAELDCRTRDGLTPLHCAARSGHDTVVHLLLSAGANISAKTRSGLNSLHMAAQGDHVDTARLLLQHGAQPDDPTIDYLTALHVAAHCGNVRVAKLLLERACDVNARALNGFTPLHIACQKNKIKIVELLLKYNCLIQATTESGLTPLHVACFMGYLNIVVLLLQHGANANAPTVRCETSLHLATRAGQTDVARLLLRNGAQVDVKARGNQTPLHIASRMGNLELVILLLEHAANVQSSTKDTYTPLHLAAKGNHKEICELLLKNGAELEVATKSGFTPLHLAVKHSHLETARYLLLSGANMNAVGRNGLTPLHLATHYGSLPMVELLLEHKASPISQAKNGFIPLHIAAEKHLLDIGRLLIEATGDQNNNNASDCCSIQSRNGFTPLHLACQDGNEKMTKLLIDSGSEVNALAKNGLTAMHLAAQEDSVKAAELLFAAGSELDVKTKAGYTPLHTACHFGQVNMVRFLVGKGADVNAVTCMGSNALHLAAQQGHSTVIYVLLESGANPNMRNKYGWTPAHVARHQHYLNIFEALRQVTTCIESWEHENTEDFPINASDLASSGSDYTSMSKQQHVSSTNRHGLEHPDMMRDNPITDTEEECMEPDFTIMPSSPLFSRAQSRQSLAQQLHMQHHQQQQAYHQYKSDYNKHSDENYGHRSGGGNHVKMALDKMSNVSGEDSIHEGTNTENAHAVNWRDGHMNNGTREVGLCETRISRDFAELGMAGASSLTGFSGLVEWDFTPDNVPISRRPVASGFLVSFLVDARGGSMRGSRHPGLRILVPPSAASAPTRITCRMLRPERTARPPQLNDCEGLACRIIELGPHPCRFNSPVLLEIPHFAALRGRQRELVVLRSDNAETWREHSLEATDQAVQSAVGQSF-NALETMEELREKRIIRILTNDFPQYMAVVSRIRQESSLVGSDGGVLSSTVVPQVQAVFPEGALQKRIRVGLQAQPIAPELVTRLFGNRVTVSPIVTLEPRRRKFHKPITLTIPLPKAIVRGMLNPSASDLKSQNVPSLRLLCSITGGTAPAQWEDITGSTPLSKVKDCVSFTTTVSARFWLMDCLTVHEAAELASMLYAEATLVPYMGKFVVFTKRLDTDEALVRCFCVTDDKVDKTLECQEGFELCAASPEVEVIESRPAWLEAAGNLLPVAKISEQLRLHFNAFRENRLAFPVRVKDVQQE-AIGKLAFMREPRQPIRDGDGDSQYIYHEITPSQKPLCTLEVRLSSDNGMGGGTGGQQGLDLSLIGLENHPEFLDQLNETSAAELTMGSLSCVFPYPAKRVNEQVFNGQNNDESNKPAGNWAS-SYTSDVIARSQIDLIHVASEIGSDWPKLIEVLLPQSNLKSSCTVNQLVN-WINESEPKWQMERNRLAVEMGKITGEEEGGNVAGSFGGPISVHELRTIQDQALAVLLAWREENGDSATGNELDHALRRIGREDVIKSCMREIRYVLDADEHAKATRQI 1715          
BLAST of Ankyrin vs. TrEMBL
Match: A0A4S2L9R7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008901 PE=4 SV=1)

HSP 1 Score: 1841.24 bits (4768), Expect = 0.000e+0
Identity = 939/1661 (56.53%), Postives = 1181/1661 (71.10%), Query Frame = 1
Query:   76 SSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGG-DIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANP---NSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXV-VFKMELDR----------------PEVMGENPVTDSEDDYGDPDYTTIPASPLFSR-------NTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASP------VADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQG-------ELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQS--VPQKPLCTLEIKLSNL------NHSCEHMAHISEAFSHNGKIELDSKGRPL------SEEAQKD----------WINISNSSDTIAKSDLDLHEVAQEVGSDWPSLA------KELG-----------MTNNFINKLQ------------------SEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQM 4758
            S + +S   K D GQ+FLRAAR+GN+ K++D L+    DI + N NGLNALH+ASKEG V++V+ LL++ AD N ATKKGNT+LHIA LAG+ +VV  L++  A VN Q+QNGFTPLYMAAQENH+EVVKLLL   A+  L TDDGFTPLAVALQQGH+++VA+LLENDSRG++ LPALHIAAKKDDVKAANLLL +D NVDHQSASGFT LHIAAHYGNVN+  LLI RG ++NFQAKNNITPLHV+ KWGN  V ERL+  GA+L+C+TRDGLTPLHCA RSG++ +   LL S +  +AKT++GL +LHM +QGDH++  ++L+  G  L++ T+DYLT LHVA+HCG+V+MA LL+E  C++NARALNGFTPLHIAC+KNR+K+VELLLK    +EATTESGL+P+HVA+FMGH +I ++L+Q+GANPN  TIR ET+LHLATRA Q E+ ++LL+NG+LVD RA+  QT LHIAAR+GN++++ +LL+H A+    TKD Y+ LH+AAK ++ D  ++L+ +GA+LE  TR GFT LH+A K+  +  A LLL  G D N  GRNGLTPLHLA HY S+ +   L+E +A P   +KNG+TPLHIAA K  + IA  L+ N       N ESRNGFTPLHL  Q+G   M K L+ S A  N++AKN L+ MHLAAQED    A +L  AG E+D+KTKAGYTPLHTACHFGQ NM+ FL+    ++NAQT  GS +LHLAAQQGH +V+  LL+  A+PN+RN  N T AHVARRQHYLNIFEVL++V TCV  WE E+E +    MELD                 P+VMG++P TD+E++  +PDYT +P+SPLFSR       N  S   HG +  F   + G         +S  DK ST+SGEDSIHE    ++    +     ++Q    T++  E+A   P        DWD+ PDNVPI RKP+TSGFLVSFLVDARGGSMRGSRH GLRILVPPSAASAPTR+TCRM++ +R   PPQLND EGLACRI+E+GPHPC FN+PVLLE+PHFASLRGR RE+V+LR DN E W+EHSLE +DQAV  ALG +F D+ ET E L+EKRI+RILTN+FP Y A+V+RLRQE ++IG+DGGV+SS+V+ QVQAVFPEGALQKRI+VGLQAH I  ++V++LLGNR+AVSPIVT+EPRRRKFHKPIT+TIPLP+ A +GMIN             LRLLCSI+GGT PAQWEDITGSTPLS+VK CVSFTTTVSARFWLMDCQ   +  EM G LY+EA LVPYMGKFV+F K  + EE L+RCFC+TDDK+DKTLECQEGFE+ AASPEVEV++ R  WLE AGN+ PV K G+QL LHFNAF+ENRL FP R++D   E + GK+AFMR+PR+         S +S   PQ+P+CTLE+ L ++      N +   M  +S +   N       +  P        + A  D          W  +  +SD IA+S LDL  VA EVG+DWP L         LG           +T N  +  +                  +E   + +++L +L++W E    +ATGNEL++ALR IGR DVVKSCM++ Q V EEDE   A  ++
Sbjct:    7 SMESASYTKKSDCGQNFLRAARAGNLSKVLDLLNKSAVDIHSCNTNGLNALHLASKEGHVEVVRELLSRGADPNRATKKGNTALHIASLAGQFEVVKMLLDACASVNTQAQNGFTPLYMAAQENHLEVVKLLLSKEANPALTTDDGFTPLAVALQQGHDRIVALLLENDSRGKVCLPALHIAAKKDDVKAANLLLNSDVNVDHQSASGFTALHIAAHYGNVNMTELLIARGANINFQAKNNITPLHVACKWGNHGVAERLIAAGAELDCRTRDGLTPLHCAARSGHDTVVHLLLSSNATVNAKTKSGLNALHMTAQGDHVDAARILLQRGLPLDEVTIDYLTALHVASHCGNVQMAKLLLERGCDVNARALNGFTPLHIACQKNRIKIVELLLKFNCMLEATTESGLTPVHVASFMGHISIVVLLLQHGANPNAPTIRSETALHLATRAGQTEVARLLLRNGALVDGRARGHQTALHIAARMGNVELVTVLLEHSAHVQAATKDTYTPLHLAAKGNYTDVCQMLLNSGAQLETITRSGFTPLHLAIKHSSLETARLLLSHGADVNSSGRNGLTPLHLATHYGSLVLVQDLLEHRADPLAQAKNGFTPLHIAAGKRFINIAKLLLTNVDRAKACNMESRNGFTPLHLACQDGSVAMTKLLLASGAQVNSRAKNGLTPMHLAAQEDSHEAAILLYDAGSELDAKTKAGYTPLHTACHFGQANMVRFLLGKRVDVNAQTCMGSNALHLAAQQGHAKVVYILLESGANPNMRNKYNWTPAHVARRQHYLNIFEVLRQVTTCVESWEAEDEIMGSPTMELDSGKGQLQAPGSRHLLELPDVMGDHPATDTEEECIEPDYTIVPSSPLFSRSAGLTQTNRYSQGSHGSHLAFRPAHHGTNG----FSRSALDKMSTMSGEDSIHEHPPVENGPHGRMVNGLREQNWCVTEISREFAELGPGTTPDVTNDWDFIPDNVPIARKPITSGFLVSFLVDARGGSMRGSRHPGLRILVPPSAASAPTRITCRMLRPERTTRPPQLNDSEGLACRIIELGPHPCSFNTPVLLEIPHFASLRGRQRELVVLRSDNAETWREHSLEATDQAVQSALGQNF-DSLETMEELREKRIIRILTNDFPQYLAVVSRLRQETALIGSDGGVLSSTVVPQVQAVFPEGALQKRIRVGLQAHPIPADMVSRLLGNRVAVSPIVTLEPRRRKFHKPITLTIPLPKTALRGMINPSGGDPKSQNAPTLRLLCSITGGTLPAQWEDITGSTPLSKVKDCVSFTTTVSARFWLMDCQPVHDSTEMAGHLYREASLVPYMGKFVVFTKRLDSEEALIRCFCVTDDKVDKTLECQEGFEVCAASPEVEVVEGRPAWLEAAGNLHPVAKSGEQLNLHFNAFRENRLAFPVRVRDLQSEPT-GKLAFMREPRSSAAGNVASESARSDATPQRPICTLEVNLGSVHASRAANSTMADMGLLSLSDQLNTSAAASMQSIPCVFPQFHPDVAGADEHGAFVGDSRWAAVY-ASDIIARSQLDLLHVASEVGADWPKLVGVLLPESRLGPSCTVEQLVDWITQNEAHWQEARVAAGGDGTDGFGGVTAAELRTDRDQALAVLLAWKEQRGDLATGNELEKALRAIGRTDVVKSCMRDIQCVMEEDEHREATKRI 1660          
BLAST of Ankyrin vs. TrEMBL
Match: A0A5K4ERA4 (Putative ankyrin 2,3/unc44 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1828.91 bits (4736), Expect = 0.000e+0
Identity = 940/1734 (54.21%), Postives = 1205/1734 (69.49%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFL-DNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNS---------------------ESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRW-----------------------------XXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAV--------------------HGGNNLFN--HTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFS--NDHHQFWKDSTF---TKDQYIAQTKLGHEYA----VASP-------VADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQG-------ELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDP----RNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNH-SCEH----------------------------MAHISEAFSHNGKIELDSK---GRPLSEEAQKDWINISN--SSDTIAKSDLDLHEVAQEVGSDWPSLAKEL------------GMTNNFINKLQSEY--------------------------------INE----EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQM 4758
            K D GQ FLRAAR+GN+QK++  + ++  D+   NANGLNALH+ASKEG  ++V+ L+ + A  N+ATKKGNT+LHIA LAG+ +VV  L+E GA+VN+Q+QNGFTPLYMAAQENH+EVV+LLL N A+  L TDDGFTPLAVALQQGH++VVA+LLE+DSRG+I LPALHIA+KKDD+KAANLLL +D NVDHQSASGFTPLHIAAHYGNVN+  LLI RG ++NFQAKNNITPLH ++KWGN  V ERL+  GA+L+C+TRDGLTPLHCA RSG++ +   LL +G+N SAKTR+GL SLHMA+QGDH++  +LL+ +G  ++D T+DYLT LHVAAHCG+VR+A LL+E  C++NARALNGFTPLHIAC+KNR+K+VELLLK    I+ATTESGL+PLHVA FMGH NI ++L+Q+GAN N  T+RCETSLHLATRA Q ++ ++LL+NG+ VD +A+  QTPLHIA+R+GN++++ +LL+H AN    TKD Y+ LH+AAK +H +   +L++ GA LE+TT+ GFT LH+A K+  +  A  LL  G D N  GRNGLTPLHLA HY  +PM  LL+E +ASP   +KNG+ PLHIAA K+L++I   LIE   + N+                     +SRNGFTPLHL  Q+G++KM K LIDS +  NA AKN L++MHLAAQED V  AE+L  AG E+D KTKAGYTPLHTACHFGQ+NM+ FL+    ++NA T  GS +LHLAAQQGH  VI  LL+  A+PN+RN    T AHVAR QHYLNIFE L++V TCV  W                               ++     ++ L+ P++M +NP+TD+E++  +PD+T +P+SPLFSR     ++                    H  +N  +    + G +S      K   DK S +SGEDSIHE  +  N H   W++      T++  +++ ++  +YA      +P       + +WD+ PDNVPI RKP+ SGFLVSFLVDARGGSMRGSRH GLRILVPPSAASAPTR+TCRM++ +R   PPQLND EGLACRI+E+GPHPC+FNSPVLLE+PHFASLRGR RE+V+LR DN E W+EHSLE +DQAV  A+G SF D  ET E L+EKRI+RILTN+FP Y A+V+R+RQE S++G+DGGV+SS+V+ QVQAVFPEGALQKRI+VGLQA  I PELV +L GNR+ VSPIVT+EPRRRKFHKPIT+TIPLP+A  +GM+N          + +LRLLCSI+GGT PAQWEDITGSTPLS+VK CVSFTTTVSARFWLMDC    E AE    LY EA LVPYMGKFV+F K  + +E L+RCFC+TDDK+DKTLECQEGFEL AASPEVE+++ R  WLETAGN++PV KL +QLRLHFNAF ENRL FP R+KD   E  +GK+AFMR+P    R+  G +   Y   +  QKPLCTLEI+LS+ N  + +H                            M  +S  F +  +I  D +   G+  + E  K   N+++  +SD IA+S +DL +VA E+GSDWP L + L                N+IN+ + ++                                +NE    ++++L +L++W E+N   ATGNELD ALRRIGREDV+KSCM++ + V + DE  +A  Q+
Sbjct:    4 KSDIGQHFLRAARAGNIQKVLLLINEHNADVHACNANGLNALHLASKEGHAEVVRELIERGAKPNTATKKGNTALHIASLAGQFEVVKLLLEAGAEVNIQAQNGFTPLYMAAQENHLEVVRLLLSNGANPGLTTDDGFTPLAVALQQGHDRVVALLLESDSRGKICLPALHIASKKDDIKAANLLLNSDVNVDHQSASGFTPLHIAAHYGNVNMTELLISRGANINFQAKNNITPLHAASKWGNQGVAERLITAGAELDCRTRDGLTPLHCAARSGHDTVVQLLLSAGANISAKTRSGLNSLHMAAQGDHVDTARLLLQHGAQIDDPTIDYLTALHVAAHCGNVRVAKLLLERGCDVNARALNGFTPLHIACQKNRIKIVELLLKYNCLIQATTESGLTPLHVACFMGHLNIVVLLLQHGANANAPTVRCETSLHLATRAGQTDVARLLLRNGAQVDVKARGNQTPLHIASRIGNLELVTLLLEHAANVQCSTKDTYTPLHLAAKGNHKEICEMLLKNGADLEITTKSGFTPLHLAVKHSHLETAKYLLLSGADMNAVGRNGLTPLHLATHYGCLPMVQLLLEHKASPVSQAKNGFIPLHIAAEKHLVDIGKLLIEATVDSNNKNKKNTNANGGYGVDGGCCSIQSRNGFTPLHLACQDGNEKMTKLLIDSGSKVNALAKNGLTAMHLAAQEDSVKAAELLFNAGSELDLKTKAGYTPLHTACHFGQVNMVRFLLGKGADVNAITCMGSNALHLAAQQGHSTVIYILLESGANPNMRNKYGWTPAHVARHQHYLNIFEALRQVTTCVESWEHENTDELPMNAELASSISSGPEYHNSSLSRQQHISANRLGLEHPDMMRDNPITDTEEECIEPDFTIMPSSPLFSRAQSRQSLSQQMHIQPQQQYVQHHPQSHHKSDNKHSDEQQHHGHRSGGVNHVKIAPDKLSNVSGEDSIHEGTTAENAHALNWRNGHLNYGTREVGLSENRISRDYAELAMAGAPSLTGFSGLVEWDFTPDNVPIPRKPIASGFLVSFLVDARGGSMRGSRHPGLRILVPPSAASAPTRITCRMLRPERTARPPQLNDCEGLACRIIELGPHPCRFNSPVLLEIPHFASLRGRQRELVVLRSDNAEIWREHSLEATDQAVQSAVGQSF-DTLETLEELREKRIIRILTNDFPQYMAVVSRIRQESSLVGSDGGVLSSTVVPQVQAVFPEGALQKRIRVGLQAQPIAPELVTRLFGNRVTVSPIVTLEPRRRKFHKPITLTIPLPKAVVRGMLNPSVNDLKSQNVPSLRLLCSITGGTAPAQWEDITGSTPLSKVKDCVSFTTTVSARFWLMDCSAVHEAAEYASMLYAEATLVPYMGKFVVFTKRLDMDEALVRCFCVTDDKVDKTLECQEGFELCAASPEVEIIESRPVWLETAGNLLPVAKLSEQLRLHFNAFHENRLAFPVRVKDLQQE-VIGKLAFMREPRQPIRDGDGDSQYIYHEIAPIQKPLCTLEIRLSSDNGVNGQHGHDLSLIGLENHPEFLDQLNETSAAELTMGSLSCVFPYPKRIINDEQIVNGQ--NNEVNKPSGNLASTYTSDVIARSQIDLLQVASEIGSDWPKLIEFLLPQSHLNSSCTVNQLVNWINESEPKWQIERNRLAMEMGKITGENDGGDVAGSFGGPISVNELRTIQDQALAVLLAWREENGDSATGNELDYALRRIGREDVIKSCMRDIRYVLDADEHAKATRQI 1733          

HSP 2 Score: 177.178 bits (448), Expect = 2.136e-40
Identity = 112/347 (32.28%), Postives = 191/347 (55.04%), Query Frame = 1
Query: 1369 NLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKA---DPNIRNSQNMTAAHVA 2400
            NL++   +  L  A   N ++++ ++ ++ + V A        LH+A++ G+ ++++ L++  A PN  TK   + LHIA+     +  ++L+EAGA++ +  + GFT L++AA+   + +  LLL  G +  +   +G TPL +A+      +  LL+E  +      K     LHIA++K+ ++ A+ L+ +  N + +S +GFTPLH+ +  G+  M + LI   A+ N +AKN ++ +H A++    GVAE L+ AG E+D +T+ G TPLH A   G   ++  L+    NI+A+T  G  SLH+AAQ  H+     LL   A   DP I     +TA HVA
Sbjct:    2 NLKSDIGQHFLRAARAGNIQKVLLLINEHNADVHACNANGLNALHLASKEGHAEVVRELIERGAKPNTATKKGNTALHIASLAGQFEVVKLLLEAGAEVNIQAQNGFTPLYMAAQENHLEVVRLLLSNGANPGLTTDDGFTPLAVALQQGHDRVVALLLESDSR----GKICLPALHIASKKDDIKAANLLLNSDVNVDHQSASGFTPLHIAAHYGNVNMTELLISRGANINFQAKNNITPLHAASKWGNQGVAERLITAGAELDCRTRDGLTPLHCAARSGHDTVVQLLLSAGANISAKTRSGLNSLHMAAQGDHVDTARLLLQHGAQIDDPTI---DYLTALHVA 341          
BLAST of Ankyrin vs. TrEMBL
Match: A0A4E0RF10 (Ankyrin-2 OS=Fasciola hepatica OX=6192 GN=D915_002954 PE=4 SV=1)

HSP 1 Score: 1828.53 bits (4735), Expect = 0.000e+0
Identity = 942/1670 (56.41%), Postives = 1203/1670 (72.04%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIID-FLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVV-----------------------FKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHE----------AFSNDHHQFWKDSTFTKDQYIAQTKLGHEY-----AVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQ---GELT-----NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKL---------SNLNHSCEHMAHISEAFSHNGKIELDS-------KGRPL-SEEA---------------QKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKEL-------------------------------GMTNNFINKLQ-SEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTE 4779
            K D+ Q+FLRAAR+GN+ K++D F     DI + NANGLNALH+ASKEG  +IV+ LL++  D N ATKKGNT+LHIA LAG+ +VV  L++ GA+VNVQ+QNGFTPLYMAAQENH+EVVKLLL + ++  L TDDGFTPLAVALQQGH+++VA+LLENDSRG++ LPALHIAAKKDDVKAANLLL +D NVDHQSASGFTPLHIAAHYGNVN+ +LLI RG ++NFQAKNNITPLHV+ KWGN  V ERL+  GA+L+C+TRDGLTPLHCA RSG++ +   LL + +N+SAKTR+GL +LHMA+QGDH++  +LL+  G  L+DTT+DYLTPLHVAAHCG++++A +L+E  C++NARALNGFTPLHIAC+KNR+K+VELLLK G  +EATTESGL+PLHVA+FMGH +I ++L+Q+GANPN  TIR ET+LHLA R+ Q E+ ++LL+NG+ VDARA+  QT LHIA+R+G+ D++ +LL H AN +  TKD Y+ LH+AAK +H +  R+LI+AGA+LE  T+ GFT LH+AAK+  V    LL++ G + N  GRNGLTPLHLA HY S+ +  +L+E +A+P   +KNGYTPLHIAA + LL++A  +I   A   +ESRNGFT LHL SQ+G  +M K L+ + A  NA+AKN L+ MHLAAQED +  AE+L AAG E+D++TKAGYTPLHTACHFGQ+NMI FL+    ++NA T  GS +LHLAAQQGH +VI  LL+  A+PN+RN    T  HVARRQHYLNIFEVL++V TCV  WE ++EE++                        ++ L++P+VMG++ VTD+E++  +PDYT IPASPLFSR+  S    G +++ + +       +  +     DK ST+SGEDSIH+          A   DH +        ++   + T++ H++      V +   DWD+ PDNVPI RKPVTSGFLVSFLVDARGGSMRGSRH GLR+LVPPSAASAPTR+TCRM++ +R   PPQLND EGLACRI+E+GPHPC FN+PV+LE+PHFASLRGR RE+V+LR DN E W+EHSLE +DQAV   LG SF D  ET E L+EKRI+RILTNEFP Y A+V+R+RQE ++IG+DGGV+SS+V+ QVQAVFPEGALQKRI+VGLQAH I  E+V  +LGNR+A SPIVT+EPRRRKFHKPIT+TIPLP++A KGM+N    G+L      +LRLLCSI+GGT PAQWEDITGSTPLS+VK CVSFTTTVSARFWL+DCQ   E  E+ G+LY+EA LVPYMGKFV+F K  + +E L+RCFC+TDDK+DKTLECQEGFE+ AASPEVEV++ R  WLE AGN++PV K  +QLRLHFNAF ENRL FP RL+D   E S GK+AFMR+PR   G      S  + PQ+P+CTLE+ L         +N       +A ++E    +    L S        GR L SE+A               +  W ++  ++D IA+S LDL +VA E+GSDWP L   L                               G  +  +  +  SE   E +++L +L++W E     ATGNELDR+LR IGR DVVKSCM + + VTE  E + A  ++  +G  E
Sbjct:   21 KSDASQNFLRAARAGNLSKLLDLFTRFNVDIHSCNANGLNALHLASKEGHTEIVRELLSRGTDPNRATKKGNTALHIASLAGQFEVVKMLLDTGAQVNVQAQNGFTPLYMAAQENHLEVVKLLLAHQSNPALTTDDGFTPLAVALQQGHDRIVALLLENDSRGKVCLPALHIAAKKDDVKAANLLLNSDVNVDHQSASGFTPLHIAAHYGNVNMTDLLISRGANINFQAKNNITPLHVACKWGNHGVAERLIAAGAELDCRTRDGLTPLHCAARSGHDTVVQLLLGANANYSAKTRSGLNALHMAAQGDHVDSVRLLLQSGLPLDDTTIDYLTPLHVAAHCGNLQVAKVLLERGCDVNARALNGFTPLHIACQKNRIKIVELLLKHGCMLEATTESGLTPLHVASFMGHLSIIVLLLQHGANPNAPTIRSETALHLAARSGQMEVARLLLRNGAQVDARARGNQTALHIASRVGSTDLVGLLLDHSANVHAATKDTYTPLHLAAKANHTEICRLLIQAGAQLETVTKSGFTPLHLAAKHTHVDTVQLLIERGANVNATGRNGLTPLHLATHYGSLVLVRVLLEHKANPLAQAKNGYTPLHIAAERRLLDVAKLVI--AAGCETESRNGFTALHLASQDGSPEMVKLLLAAGARVNARAKNGLTPMHLAAQEDSLAAAELLCAAGSELDARTKAGYTPLHTACHFGQVNMIRFLLGKGVDVNATTCMGSNALHLAAQQGHSKVIYILLESGANPNMRNKNGWTPGHVARRQHYLNIFEVLRQVTTCVESWEADDEELLEPKITDSDLGRPMLDGTTKFAPGTRIFLEQPDVMGDHAVTDTEEECLEPDYTVIPASPLFSRSASSGQA-GLSHMVDASGFIGTRVNGRMKSGGVDKMSTVSGEDSIHDDAAATAAAVAAAVGDHGRV----NGIREPAWSSTRIRHDFTELGSGVLASSQDWDFTPDNVPIARKPVTSGFLVSFLVDARGGSMRGSRHPGLRVLVPPSAASAPTRITCRMLRPERTTRPPQLNDSEGLACRIIELGPHPCTFNTPVILEIPHFASLRGRQRELVVLRSDNAETWREHSLEATDQAVQSTLGQSF-DQLETLEELREKRIIRILTNEFPQYLAVVSRMRQETALIGSDGGVLSSTVVPQVQAVFPEGALQKRIRVGLQAHPIPTEMVTHVLGNRVAASPIVTLEPRRRKFHKPITLTIPLPRSAMKGMLNPAGVGDLKAQTAPSLRLLCSITGGTLPAQWEDITGSTPLSKVKDCVSFTTTVSARFWLIDCQAVHESTELAGQLYREASLVPYMGKFVVFTKRLDTDEALIRCFCVTDDKVDKTLECQEGFEVCAASPEVEVVEGRPAWLEAAGNLLPVAKSDEQLRLHFNAFHENRLAFPVRLRDMQQEAS-GKLAFMREPRQLGG-----DSVNTEPQRPICTLEVHLGPEQGGIRAANSITVDPALASLAEQHQKSTGASLHSIPCVFPIPGRKLVSEDADYQNGYEDGVDVLGPEGRWASVY-AADVIARSQLDLLQVAAEIGSDWPRLVGVLIPESGLNATCTVGQLVEWIAQNDPRWQETRGGDASTGLGAISVSELRTERDRALAVLLAWREQRGEQATGNELDRSLRAIGRMDVVKSCMLDIRCVTEPAEHDEAIRRIDEQGYGE 1675          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 1404.04 bits (3633), Expect = 0.000e+0
Identity = 743/1529 (48.59%), Postives = 1022/1529 (66.84%), Query Frame = 1
Query:  151 VQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKD-----QYIAQTKLGHEYAVASPVAD------WDY-APDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTN-LRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            ++K +D+L +G DI   N NGLNALH+ASKEG V++V  L+   A V++ATKKGNT+LHIA LAG+ DVV  L+ +GA VN QSQNGFTPLYMAAQENH++VV+ LL N +SQ++AT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F+A+N+ITPLHV++K GN  + + L+E+GA+++ KT+DGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+++   ++D T DYLT LHVAAHCGH ++A ++++     NA+ALNGFTPLHIACKKNR+KV+ELLLK GASI+A TESGL+P+HVAAFMGH NI   L+ +GA+PN   +R ET+LH+A RA Q E++K L++NG+ VDA++K+ QTPLHI++RLG  +II+ LLQH A P++ T   Y+ LH+AA+E H D A +L++ GA L +TT+KGFT LH+AAKYGK+ +A LLLQ     +  G++GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN +EIA  L+E  A+ N+ +R G +PLHL SQEG+  M   L+  +A  N   K+ L+ +HLAAQED+V VAEVL+  G  +D +TK GYTPLH ACH+G + M++FL+K+   +NA+T         AAQQGH  +I  LL   A PN       TA  +ARR  Y+++ + L+ V             V  K +++ PE M E  V D  DD G+                  +A+ G  + +       +    +LP+ +     +I    +   +FS+D       S+FT+D     + +A TK  H  A     AD      W     DNV +   P+ SGFLVSF+VDARGGSMRGSRH G+RI++PP   +APTR+TCR++K  ++  PP + +GEGLA R++E+GP    F  PV++E+PHF S+RG++RE++ILR +NGE WKEH  +   +A ++ L     +  E+ E L++KRI RI+T +FP YFA+V+R++QE + +G +GGV+SS  +  VQA FPEGAL K+I+VGLQA  +  E V K+LGNR   SPIVT+EPRRRKFHKPIT+TIP+P  + +G+ N  +G+ T  LRLLCSI+GGT+PAQWEDITG+TPL+ V  CVSFTT VSARFWL DC   P+   +  +LY+E I VPYM KFV+FAK  +  E  LRCFC+TDDK+DKTLE QE FE  A S ++EVL+ +  +++  GN+ P+TK G QL L+F AFKENRLPF  +++D S E   G+++F+R+ +  +G          +PQ  +C L I L  L  + +      E       + L  +   L+E          +      ++DL +  VA  +G  W  LA+E+  + + IN ++ E  N    +S  LL  W   +   AT + L  AL +I R D+V
Sbjct:    1 LEKALDYLKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKV------TAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTLRVVTEETL----TTLTVTEKHKMNVPETMNE--VLDMSDDEGE------------------DAMTGDTDKYLGPQDLRELGDDSLPQ-EGYVGFSIGARTASLRSFSSDRSNTLNRSSFTRDSMMIEEILAPTKDTHLAAAKDFDADSLRRYSWTGDTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLASPPPMVEGEGLASRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIILRSENGETWKEHQYDCRTEA-LNELLNGMDEELESLEELEKKRICRIITKDFPQYFAVVSRIKQESNQMGPEGGVLSSMTVPHVQASFPEGALTKKIRVGLQAQPVPDETVKKILGNRATFSPIVTVEPRRRKFHKPITMTIPVPPLSGEGVTNGYKGDSTPCLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLADCHQIPDTVGLATQLYRELICVPYMAKFVVFAKMNDPVESNLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLTPLTKAGQQLLLNFYAFKENRLPFCVKIRDNSQE-PCGRLSFLRELKTSKG----------IPQTAVCNLNITLPALKKTEK-----PERRHTFASLALRKRYSYLTEPGM-------SPQSPCERTDLRMAIVADHLGLSWTELAREMDFSVDEINHIRVENPNSLTTQSFMLLKKWVNRDGKNATTDVLTAALTKINRMDIV 1474          

HSP 2 Score: 321.627 bits (823), Expect = 2.362e-88
Identity = 197/607 (32.45%), Postives = 331/607 (54.53%), Query Frame = 1
Query:  133 AARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLEN----DSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKL 1941
            AAR  + +     L N  +    + +G   LHIA+  G +++  +LL + A V+   +   T LH+A   G  ++V  L+E GA+++ ++++G TPL+  A+  H +VV++LL   A     T +G +PL +A Q  H   V +LL +    D      L ALH+AA     K A +++   AN + ++ +GFTPLHIA     + +  LL++ G  +    ++ +TP+HV+   G+  +  +L+  GA        G T LH A R+G   +  +L+++G+   AK+++  T LH++S+    E  Q L+ +G   + TT    TPLH+AA  GH  +A++L++    +      GFTPLH+A K  +++V  LLL+  A  +A+ +SGL+PLHVAA   +  +AL+L+  GA+P+       T LH+A + NQ E+   LL+ G+  +A  ++  +PLH+A++ GN+D++ +L+   A  N   K   + LH+AA+ED V+ A VL+  GA ++  T+ G+T LH+A  YG V +   LL+    + V  +  +T    A       +  LL++  A+P + + NG T L IA R   + + D L
Sbjct:  156 AARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLK--NQAKVNAKTKVT----AAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 1387.86 bits (3591), Expect = 0.000e+0
Identity = 738/1581 (46.68%), Postives = 1026/1581 (64.90%), Query Frame = 1
Query:   43 LKEDTDQNKDKSSDLSSPVTKM-DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGE---------------NPVTDSEDDYGDP-DYTTIPASPLFSRNTMSNAVHGGNNL----FNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTN-LRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRP---LSEEAQKDWINISNSSDT----IAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            L++D DQ + K+   S    K  DS  S+LRAAR+GN++K +D+L  G DI   N NGLNALH+ASKEG V++V  LL   A V++ATKKGNT+LHIA LAG+ DVV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL + ASQ++AT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD K+A LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV+ K GN  + + L+++GA+++ KT+DGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A ++++     NA+ALNGFTPLHIACKKNRVKV+ELLLK GAS++A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q ++++ LL+NG+ VD +AK+ QT LHIA+RLG  +I+++LLQ  A  +  T   Y+ LH+A +E H + A +L+E GA L   T+KGFT LH+AAKYG++  A LLLQ     +  G+ GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN LEI   L+E  A  N+ +R G +PLHL +QEG   +   L+   A+ N   KN L+ +HLAAQED+VGVAEVLL  G E+D+ TK GYTPLH ACH+G + M+ FL+++   IN++T  G T LH AAQQGH  +I  LL  +A  N       TA  +ARR  Y+++ + L+ +             V  K +L+ PE M E               + +T   + Y  P D   +    L     M  ++ G  ++    F+   S  Q++ S +  S   +      +D+ H + S + ++  +  ++T D       + H +   S                 P+ SGFLVSF+VDARGGSMRGSRH G+RI++PP    APTR+TCR+ K  R+ +PP + +GEGL  R++E+GP    F  PV++E+PHF S+RG++RE+++LR DNG+ WKEH  +   + ++ AL     +  ++   L++KRI RI+T +FP YFA+V+R++QE   +G +GGV++S  +  V+A FP GAL K+I+VGLQA  +  E+V  ++GNR + SPIVT+EPRRRKFHKPIT+TIP+P  A +   N  +G+    LRLLCSI+GGT+PAQWEDITG+TPLS V  CVSFTT VSARFWL DCQ   E   +   LY+E I VPY+ KFV+FAK T+  E  LRCFC+TDDK+DKTLE QE FE  A S ++E+L+ +  +++  GN+ P +K   QL   F AFKENRLPF  +++D   E + G+++F+R+P++ +G          +P   +C L   L           H  E  S +   E D+K R     S   +K +  +++ S +      ++DL +  VA  +G  W  LA+E+  + + IN +++E  N    +S  LL  W   +   AT + L   L ++ R D+V
Sbjct:   19 LEDDKDQRRRKNRKHSREQKKKSDSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGL---TDENLTATPPVSEKHKLNVPETMNEFLDMSDDEDREREREDAMTGETEKYLRPQDLKELGDDSLPQEGYMGFSI-GARSVSMRSFSSDRSNTQNRTSCVRDSMVIEEVIAPTKDT-HLSVSREQNESLRRYSWTPDT------MDHSHNTVS----------------SPIHSGFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEHHYDCRGEDLL-ALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDPAPCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQE-ACGRLSFLREPKSSKG----------LPHSAICNLNFTLPT---------HRKEMES-DPDDENDNKDRRHTFASFALRKRYSYLTDPSSSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAGLTKVNRMDIV 1550          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 1385.55 bits (3585), Expect = 0.000e+0
Identity = 736/1561 (47.15%), Postives = 1016/1561 (65.09%), Query Frame = 1
Query:  112 SGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSA--------SGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYT---TIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKD-----QYIAQTKLGHEYAVA----SPVADWDYAPDNVP----ITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTN-LRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRP---LSEEAQKDWINISNSSDT----IAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            S  S+LRAAR+GN++K +D+L  G DI   N NGLNALH+ASKEG V++V  LL   A V++ATKKGNT+LHIA LAG+ DVV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL + ASQ++AT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD K+A LLL ND N D +S         SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV+ K GN  + + L+++GA+++ KT+DGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A ++++     NA+ALNGFTPLHIACKKNRVKV+ELLLK GAS++A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q ++++ LL+NG+ VD +AK+ QT LHIA+RLG  +I+++LLQ  A  +  T   Y+ LH+A +E H + A +L+E GA L   T+KGFT LH+AAKYG++  A LLLQ     +  G+ GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN LEI   L+E  A  N+ +R G +PLHL +QEG   +   L+   A+ N   KN L+ +HLAAQED+VGVAEVLL  G E+D+ TK GYTPLH ACH+G + M+ FL+++   IN++T  G T LH AAQQGH  +I  LL  +A  N       TA  +ARR  Y+++ + L+ +             V  K +L+ PE M E    D  DD   PD        A PL       +A+ G    +       +    +LP+ +     +I        +FS+D       ++  +D     + IA TK  H  +V+      +  + + PD +         P+ SGFLVSF+VDARGGSMRGSRH G+RI++PP    APTR+TCR+ K  R+ +PP + +GEGL  R++E+GP    F  PV++E+PHF S+RG++RE+++LR DNG+ WKEH  +   + ++ AL     +  ++   L++KRI RI+T +FP YFA+V+R++QE   +G +GGV++S  +  V+A FP GAL K+I+VGLQA  +  E+V  ++GNR + SPIVT+EPRRRKFHKPIT+TIP+P  A +   N  +G+    LRLLCSI+GGT+PAQWEDITG+TPLS V  CVSFTT VSARFWL DCQ   E   +   LY+E I VPY+ KFV+FAK T+  E  LRCFC+TDDK+DKTLE QE FE  A S ++E+L+ +  +++  GN+ P +K   QL   F AFKENRLPF  +++D   E + G+++F+R+P++ +G          +P   +C L   L           H  E  S +   E D+K R     S   +K +  +++ S +      ++DL +  VA  +G  W  LA+E+  + + IN +++E  N    +S  LL  W   +   AT + L   L ++ R D+V
Sbjct:    7 SNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGL---TDENLTATPPVSEKHKLNVPETMNE--FLDMSDDEVQPDLIGQDLCSAQPL-----CEDAMTGETEKYLRPQDLKELGDDSLPQ-EGYMGFSIGARSVSMRSFSSDRSNTQNRTSCVRDSMVIEEVIAPTKDTH-LSVSREQNESLRRYSWTPDTMDHSHNTVSSPIHSGFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEHHYDCRGEDLL-ALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDPAPCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQE-ACGRLSFLREPKSSKG----------LPHSAICNLNFTLPT---------HRKEMES-DPDDENDNKDRRHTFASFALRKRYSYLTDPSSSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAGLTKVNRMDIV 1533          

HSP 2 Score: 172.94 bits (437), Expect = 1.193e-42
Identity = 114/390 (29.23%), Postives = 188/390 (48.21%), Query Frame = 1
Query: 1384 RCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTP-----------------------------LHLAVHYSSMPMTVLL--------IEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKK 2442
            R   S   A RA   E     LK G  ++   +     LH+A++ G+++++  LL+  A+ +  TK   + LHIA+     D  R L+  GA +   ++ GFT L++AA+   + +   LL+ G   ++   +G TP                             LH+A          LL        +E +   +  + +G+TPLHIAA    + +A  L+   A  +  +RN  TPLH+ ++ G+  M K L+D  A  +AK K+ L+ +H  A+     V E+LL  G  I SKTK G +PLH A     +N +  L++H+  ++  TN   T+LH+AA  GH +V   ++DKKA+PN +     T  H+A +++ + + E+L K
Sbjct:    6 RSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLK 395          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 1345.1 bits (3480), Expect = 0.000e+0
Identity = 690/1410 (48.94%), Postives = 949/1410 (67.30%), Query Frame = 1
Query:  154 QKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSA--------SGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVM----------GENPVTDSEDDYGDP-DYTTIPASPLFSRNTMSNAVHGGNNL----FNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEY-AVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTN-LRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKL 4302
            +K +D+L  G DI   N NGLNALH+ASKEG V++V  LL   A V++ATKKGNT+LHIA LAG+ DVV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL + ASQ++AT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD K+A LLL ND N D +S         SGFTPLHIAAHYGN+N+A LL+ RG  V+F A+N+ITPLHV+ K GN  + + L+++GA+++ KT+DGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A ++++     NA+ALNGFTPLHIACKKNRVKV+ELLLK GAS++A TESGL+P+HVAAFMGH NI   L  +GA+PN   +R ET+LH+A RA Q ++++ LL+NG+ VD +AK+ QT LHIA+RLG  +I+++LLQ  A  +  T   Y+ LH+A +E H + A +L+E GA L   T+KGFT LH+AAKYG++  A LLLQ     +  G+ GLTPLH+A HY +  + +LL++  ASP   +KNGYTPLHIAA+KN LEI   L+E  A  N+ +R G +PLHL +QEG   +   L+   A+ N   KN L+ +HLAAQED+VGVAEVLL  G E+D+ TK GYTPLH ACH+G + M+ FL+++   IN++T  G T LH AAQQGH  +I  LL  +A  N       TA  +ARR  Y+++ + L+ +             V  K +L+ PE M          GE+ +T   + Y  P D   +    L     M  ++ G  ++    F+   S  Q++ S +  S   +      +D+ H + S + ++  +  ++T D       + H +  V+SP+     +P  +P       S FLVSF+VDARGGSMRGSRH G+RI++PP    APTR+TCR+ K  R+ +PP + +GEGL  R++E+GP    F  PV++E+PHF S+RG++RE+++LR DNG+ WKEH  +   + ++ AL     +  ++   L++KRI RI+T +FP YFA+V+R++QE   +G +GGV++S  +  V+A FP GAL K+I+VGLQA  +  E+V  ++GNR + SPIVT+EPRRRKFHKPIT+TIP+P  A +   N  +G+    LRLLCSI+GGT+PAQWEDITG+TPLS V  CVSFTT VSARFWL DCQ   E   +   LY+E I VPY+ KFV+FAK T+  E  LRCFC+TDDK+DKTLE QE FE  A S ++E+L+ +  +++  GN+ P +K   QL   F AFKENRLPF  +++D   E + G+++F+R+P++ +G          +P   +C L   L
Sbjct:    1 EKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGL---TDENLTATPPVSEKHKLNVPETMNEFLDMSDDEGEDAMTGETEKYLRPQDLKELGDDSLPQEGYMGFSI-GARSVSMRSFSSDRSNTQNRTSCVRDSMVIEEVIAPTKDT-HLSVSREQNESLRRYSWTPDT------MDHSHNTVSSPIHSGPSSP--LPQ----YDSRFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEHHYDCRGEDLL-ALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDPAPCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQE-ACGRLSFLREPKSSKG----------LPHSAICNLNFTL 1381          

HSP 2 Score: 326.25 bits (835), Expect = 3.225e-89
Identity = 202/583 (34.65%), Postives = 314/583 (53.86%), Query Frame = 1
Query:  133 AARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIR----LPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIAN---------------------------------LLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNV 1770
            AA  GN+      L+ G  +     N +  LH+A+K G  ++VK+LL + A +++ TK G T LH    +G   VV  L++ GA +  +++NG +PL+MA Q +H+  V+LLL +       T+D  T L VA   GH KV  ++++  +    +       LHIA KK+ VK   LLL + A++   + SG TP+H+AA  G+ NI                                    L++ G  V+ +AK++ T LH++++ G   + + L++KGA     T  G TPLH AVR G++   + LL+ G++ SA T+ G T LH+A++   IE  +LL+      +      LTPLHVAAH  + R+A LL++     +A A NG+TPLHIA KKN++++   LL+ GA   A T  G+SPLH+AA  G  ++  +L+   AN N+      T LHLA + ++  + ++LL +G+ VDA  K   TPLH+A   GN+ ++  LL++QA  N+ TK  Y+ LH AA++ H     +L++  A     T  G TAL IA + G +++   L  L TD N+
Sbjct:  196 AAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGL-TDENL 777          

HSP 3 Score: 261.536 bits (667), Expect = 2.177e-69
Identity = 148/425 (34.82%), Postives = 251/425 (59.06%), Query Frame = 1
Query:   88 SSPVTKMDSGQSFLRAARSGNVQKIIDFL-DNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLEN----DSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVL 1347
            ++P  K  +G + L  A   N  K+++ L  +G  +     +GL  +H+A+  G  +IVK L    A  N+   +G T+LH+A  AG+ DVV +L+++GAKV++++++  T L++A++    E+V+LLL   A  + AT  G+TPL +A+++GH++  ++LLE+     +  +     LH+AAK   ++AA LLL   A  D    +G TPLH+AAHY N  +A LL++ G   +  AKN  TPLH++ K   L +   L+E GA+    TR G++PLH A + G  ++ + LL   +N +   +NGLT LH+A+Q D +   ++L+N+G  ++  T    TPLHVA H G+++M + L+E   +IN++  +G+TPLH A ++    ++ +LL+  AS    T +G + L +A  +G+ ++   L
Sbjct:  345 ANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 769          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 1255.74 bits (3248), Expect = 0.000e+0
Identity = 651/1361 (47.83%), Postives = 893/1361 (65.61%), Query Frame = 1
Query:  157 KIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAK-----NLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLP-KSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGE--LTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLR-LHFNAFKENRLPFPARLKDPSLENSLGKVAFMR 4212
            K +D + NG  I TAN NGLN LH+ASKEG V +V  LL    D+ + TKKGNT+LHIA LAG+  VV  L+ +GA VN QSQ GF+PLYMAAQENH+EVVK LL N A+Q+L T+DGFTPLAVALQQGHE VVA+L+   ++G++RLPALHIAA+ DD + A +LL ND N D  S +GFTPLHIAAHY N+++A LL+ RG +VNF  KN ITPLH++ + GN+ +   L+++GAQ++ +T+D LTPLHCA R+G+  +   LL  G+   AKT+NGL+ +HMA+QGDH++C + L+ Y   ++D TLD+LTPLHVAAHCGH RMA +L++   + NARALNGFTPLHIACKKN ++ ++LLLK  AS+EA TESGL+PLHVAAFMGH NI   L+Q GA+PN   ++ ET LH+A RA   E+ + LL+N + VDA+AK+ QTPLH AAR+G+ +++K+LL+H+ANP++ T   ++ LHIAA+E H    R+L++  A+    T+KGFT LH+A KYGKV +A LLL+ G + N  G+NGLTPLH+AVH++++ +  LL+    SP  T++NGYTPLHIAA++N LE+A  L++  AN NSES  G TPLHL +QEG   M   LI  + + N   K       L+ +HL AQE  VG+A++L+  G  + S ++ GYT LH ACH+G I M+ FL++   ++N +T  G T LH AAQQGH  ++  LL   A PN   +   +   +A+R  Y+++ +VLK V          EE +  K  +  PE + E  + D  +D G P    IP  P  S  T                      H+ +P   + D++S I                    +T T D               SPVA              P+ +GFLVSF+VDARGGSMRGSRH GLR+++PP   +APTR+TCR++K  ++  PP L +GEGLA RI+ +GP   +F  PV++E+PHFASL   DRE+V+LR +NG  WKEH     D+ V++ +     ++ E+ E L++KRI RI++ +FP+YFA+V+R++QE  +IG +GG + S ++ QVQA+FPE A+ KR+++GLQA  I  EL+ + LGN+   SP+VT+EPRRRKFH+PI + IPLP +  +   + GE   T+LRLLCS+ GGT PAQWEDITG+T L     C +FTT VSARFWL DC    E       LY+E + VPYM KFV+FAK  E  E  LRC+C+TDDK+DKTLE  E F   A S ++EV++     LE +GN++PV K   Q R   F AF++NRLP   +++D S +++ G ++F+R
Sbjct:    2 KALDHIKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVT---------EESMSAKHRMSFPETVDE--ILDVSEDEGGPYSPAIPRIPCVSPET----------------------HTPVPLPKEYDEDSLIPSS----------------PATETSDN-------------VSPVAS-------------PIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCRLVKPQKLTTPPPLVEGEGLASRIISLGPSSMQFLGPVIVEIPHFASLGRGDRELVVLRSENGSVWKEHRNRYGDE-VLETILNGMDEDLESQEELEKKRIRRIISTDFPLYFAVVSRVQQESDLIGPEGGQLISKLVPQVQAIFPETAVTKRVRLGLQAQPIPDELLTRQLGNQATFSPVVTVEPRRRKFHRPIGLRIPLPPSWRESQRDAGEGDTTSLRLLCSVIGGTAPAQWEDITGTTKLMYSNNCANFTTNVSARFWLADCPRTAEAVTFANLLYRELMAVPYMAKFVVFAKMNEAREGRLRCYCMTDDKMDKTLELHENFSEVARSRDIEVMEGMPLHLECSGNLVPVRKATQQPRTFSFQAFRDNRLPVSVKVRD-SNKDATGFLSFLR 1285          

HSP 2 Score: 321.242 bits (822), Expect = 4.288e-89
Identity = 204/612 (33.33%), Postives = 327/612 (53.43%), Query Frame = 1
Query:  133 AARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILL----ENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTK-----DNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKL 1941
            AAR+ + +     L N  +    +  G   LHIA+    + + ++LL + A+VN   K G T LHIA   G V +V  L++ GA+++ ++++  TPL+ AA+  HV V+++LL   A     T +G +P+ +A Q  H   V  LL    E D      L  LH+AA     + A +LL   A  + ++ +GFTPLHIA    ++   +LL++    +    ++ +TPLHV+   G+L + + L+++GA          TPLH A R+G+  +  FLL++ +   AK ++  T LH A++  H E  +LL+ +  N +  T    TPLH+AA  GH     +L++   +       GFTPLH+ACK  +V V ELLL+ GA+  A  ++GL+PLHVA    + ++  +L+  G +P+       T LH+A + NQ E+   LL+ G+  ++ + +  TPLH+AA+ G  D++ +L+  Q N N   K        + LH+ A+E HV  A +L++ GA +   +R G+TALH+A  YG + +   LLQ     N + R G TPLH A       +  LL++  A P + + NG +PL IA R   + + D L
Sbjct:  155 AARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 3 Score: 288.5 bits (737), Expect = 1.236e-78
Identity = 185/533 (34.71%), Postives = 296/533 (55.53%), Query Frame = 1
Query:  133 AARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLE-----NDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIE-----ATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALH 1701
            AAR+G+V+ I   LD G  I     NGL+ +H+A++   +D V+ LL  NA+++  T    T LH+A   G   +   L++ GAK N ++ NGFTPL++A ++NH+  + LLL +SAS    T+ G TPL VA   GH  +V  LL+     N S  ++  P LH+AA+    + A  LL N A VD ++    TPLH AA  G+  +  LL+E   + +       TPLH++ + G+   T  L++  AQ    T+ G TPLH A + G  ++   LL+ G+N +A  +NGLT LH+A   ++++  +LL++ G + + T  +  TPLH+AA    + +A+ L++C    N+ +L G TPLH+A ++ R  +V LL+    ++       T  + L+PLH+ A  GH  IA +L++ GA+    +    T+LH+A      +M+K LL+  + V+ + +   TPLH AA+ G+ DI+ +LL+H A PN +T +  S L IA +  ++    V       L+L T +  +A H
Sbjct:  254 AARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETP-LHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDV-------LKLVTEESMSAKH 778          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 861.292 bits (2224), Expect = 0.000e+0
Identity = 449/824 (54.49%), Postives = 594/824 (72.09%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQ--LGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVL----KKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYG 2562
            D+  SFLRAAR+GN+++++D L  G DI T N NGLNALH+ASKEG VD+V  LL + A++++ATK GNT+LHIA LAG+ D+V  L+E GA +N QSQNGFTPLYMAAQENH+E+VK LL N A+Q++AT+DGFTPLAVALQQGHE+VV +LLE+D++G++RLPALHIAA+KDD  AA LLL ++ N D  S SGFTPLHIAAHYGN+N+A LL+  G  V+F A+N ITPLHV+ K GN  + + L+++GA+++ KTRDGLTPLHCA RSG+E +   LL+  +   AKT+NGL+ LHMA+QG+H+ C QLL+     ++D TLDYLTPLHVAAHCGH R+A LL++   E NARALNGFTPLHIACKKNR+KV+ELLLK GASI  TTESGL+P+HVA+FMGH N+  +L+QNGA+ N   +R ET LH+A+RA Q E++K LL++G+ V  +A+E QTPLHIA+RLG  +I+++LLQ  ++PN  T    + L+ A++E H D A +L+E GA +   T+KGFT LHIA+KYG++ +ATLLL+     D  V G+NGLTPLH+A HY    + +LL++  ASP  T+KNGYTPLHIAA+KN LE+   L+E  A  N  ++ G  PLHL +QEGH  M   L+   A  +   K  L++MHLAAQEDKV VAE+L     ++++ TK  YTPLH A H+G I M+ FL+++   +NA+T  G T LH AAQQGH  V+ ALL  +A PN   +   TA  +ARR  Y+++ + L    ++ VT V         V+ K +L+ PE M  N   D  DD G
Sbjct:   10 DAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILTEEPVTGVN-------TVIEKHKLNVPETM--NDALDLSDDEG 824          

HSP 2 Score: 168.318 bits (425), Expect = 1.410e-42
Identity = 108/330 (32.73%), Postives = 173/330 (52.42%), Query Frame = 1
Query:   88 SSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLL--LNSASQTLATDDGFTPLAVALQQGHEKVVAILLEND----SRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINY 1059
            SS  T +        A+R+G ++ +   L +G  +          LHIAS+ G  +IV++LL + +D N+ T  G+T L+ A   G  DV + L+E+GA ++  ++ GFTPL++A++   +EV  LLL    SA   +A  +G TPL VA    H+KV  +LL+      S  +     LHIAAKK+ ++   +LL   A  +  +  G  PLH+AA  G+ ++  LL+ R   ++   K  +T +H++ +   + V E L +  A +   T+   TPLH A   G   +  FLL++ +  +AKTRNG T LH A+Q  H      L+ +
Sbjct:  428 SSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQH 757          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 858.596 bits (2217), Expect = 0.000e+0
Identity = 448/839 (53.40%), Postives = 600/839 (71.51%), Query Frame = 1
Query:   85 LSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVD--------HQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVL----KKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGD 2565
            L + + K D+  SFLRAAR+GN+++++D L  G DI T N NGLNALH+ASKEG VD+V  LL + A++++ATK GNT+LHIA LAG+ D+V  L+E GA +N QSQNGFTPLYMAAQENH+E+VK LL N A+Q++AT+DGFTPLAVALQQGHE+VV +LLE+D++G++RLPALHIAA+KDD  AA LLL ++ N D          + SGFTPLHIAAHYGN+N+A LL+  G  V+F A+N ITPLHV+ K GN  + + L+++GA+++ KTRDGLTPLHCA RSG+E +   LL+  +   AKT+NGL+ LHMA+QG+H+ C QLL+     ++D TLDYLTPLHVAAHCGH R+A LL++   E NARALNGFTPLHIACKKNR+KV+ELLLK GASI  TTESGL+P+HVA+FMGH N+  +L+QNGA+ N   +R ET LH+A+RA Q E++K LL++G+ V  +A+E QTPLHIA+RLG  +I+++LLQ  ++PN  T    + L+ A++E H D A +L+E GA +   T+KGFT LHIA+KYG++ +ATLLL+    ++ +G+NGLTPLH+A HY    + +LL++  ASP  T+KNGYTPLHIAA+KN LE+   L+E  A  N  ++ G  PLHL +QEGH  M   L+   A  +   K  L++MHLAAQEDKV VAE+L     ++++ TK  YTPLH A H+G I M+ FL+++   +NA+T  G T LH AAQQGH  V+ ALL  +A PN   +   TA  +ARR  Y+++ + L    ++ VT V         V+ K +L+ PE M  N   D  DD G+
Sbjct:    1 LETLLDKSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILTEEPVTGVN-------TVIEKHKLNVPETM--NDALDLSDDEGE 830          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 392/837 (46.83%), Postives = 532/837 (63.56%), Query Frame = 1
Query:  886 RDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTM--------SNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAP----DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPH---------------------------------PPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQ 3261
            +DGLTPLHCA RSG+E +   LL+ G+   AKT+NGL+ LHMA+QGDH+EC Q+L+ Y   ++D TLDYLT LHVAAHCGH R A +L++     N RALNGFTPLHIACKKNR++V+ELLLK GASIEA TESGL+P+HV+AFMG+ NI L+L+Q GA+PN   +R ET+LH+A RA Q E+++ LL+NG+ VDA+A+E+QTPLHIAARLG ++I+++LLQH A+P+  T + Y+ LH+AA+E H D   +L+E GA L +TT+KGFT LH+A+KYGK+ +A+LLLQ     +  G+NGLTPLH+A HY +  + +LL++  ASP  T+KNGYTPLHIAA+K+ LEIA  L+E  A  N+ +R G  PLHL +QEGH  +A  L+   AD N   K+ LS +HLAAQEDKV VAE+L+  G  +++ TK GYTPL  ACH+G I M+ FL++H  ++N++T  G T LH AAQQGH  ++  LL   A PN       TA  +ARR  Y+++ + L KVVT  T           ++ +  PE M E  V +  DD G+   T      L + +          S+    G+  ++       ++  +L    SD++ ++       EA   +  +F   +T T  Q  A  +   E  V      W  AP    DNV ++  P+ SGFLVSF+VDARGGSMRG RH GLRI++PP    APTRVTCR++K  R+                                   PP LNDGE L  RIL++GP    F  PV++E+PHFASLRG++RE+V+LR +NGE W+EH  E S++
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL-KVVTEETITSTTVSNPSSRVNV--PETMTE--VLEVSDDEGEDTMTGDGMEYLRAEDLRELGDDSLPSSHFLEGSTGYSMGFGNWATRSGSLRSFSSDRSYSLGRGPYSREATLIE--EFTAATTIT--QLAAPKEEEEEKGVGGMPTSW--APIEILDNVALSSSPIHSGFLVSFMVDARGGSMRGCRHHGLRIVIPPRKCMAPTRVTCRLVKRHRLAALPPVLEGEGLASRVVEVGPSGGQFLGKLHLPNTPPPLNDGESLVSRILQLGPPGTTFLGPVIVEIPHFASLRGKERELVVLRSENGETWREHQSECSEE 829          

HSP 2 Score: 307.375 bits (786), Expect = 1.668e-85
Identity = 182/509 (35.76%), Postives = 287/509 (56.39%), Query Frame = 1
Query:  505 DGFTPLAVALQQGHEKVVAILLENDS----RGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGH 2019
            DG TPL  A + GHE+VV ILLE  +    + +  L  LH+A + D V+   +L+   A VD  +    T LH+AAH G+   A +L+++G + N +A N  TPLH++ K   + V E L++ GA +E  T  GLTP+H +   G  NI   LL+ G++ +A    G T+LHMA++    E  + L+  G  ++    +  TPLH+AA  G + +  LL++     +A   NG+TPLH+A ++    V  +LL+ GAS+  TT+ G +PLHVA+  G   +A +L+Q  A+P+       T LH+A+  + +++  +LL  G+   A AK   TPLHIAA+   ++I   LL++ A  N +T+   + LH+ A+E H D A +L+   A +   T+ G + LH+AA+  KV +A +L++ G   N   + G TPL +A HY ++ M   L++  A     +KNGYTPLH AA++    I + L++  A PN  + NG T L +  + G+
Sbjct:    5 DGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGY 513          

HSP 3 Score: 303.523 bits (776), Expect = 3.084e-84
Identity = 185/517 (35.78%), Postives = 287/517 (55.51%), Query Frame = 1
Query:  403 QNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLEN----DSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKL 1941
            Q+G TPL+ AA+  H +VV++LL   A     T +G +PL +A Q  H + V +L++     D      L ALH+AA     + A +LL   AN + ++ +GFTPLHIA     + +  LL++ G  +    ++ +TP+HVS   GNL +   L++ GA        G T LH A R+G   +   LL++G+   AK R   T LH+A++   +E  QLL+ +  + +  T +  TPLHVAA  GH  +  +L+E    +      GFTPLH+A K  +++V  LLL+  AS +A  ++GL+PLHVA+   +  +AL+L+  GA+P+       T LH+A + +Q E+   LL+ G+  +A  ++   PLH+ A+ G+ D+  +LL   A+ N+ TK   S LH+AA+ED V+ A +L++ GA +  TT+ G+T L +A  YG + +   LLQ G D N + +NG TPLH A       +  LL++  A P   + NG T L IA R   + + D L
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 4 Score: 300.442 bits (768), Expect = 2.942e-83
Identity = 172/512 (33.59%), Postives = 293/512 (57.23%), Query Frame = 1
Query:  694 GFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMI 2229
            G TPLH AA  G+  +  +L+E+G  +  + KN ++PLH++T+  ++   + L++  A ++  T D LT LH A   G+      LL  G+N + +  NG T LH+A + + I   +LL+ YG ++   T   LTP+HV+A  G++ +  +L++     NA  + G T LH+A +  + +VV  LL+ GA ++A      +PLH+AA +G   I  +L+Q+ A+P+  T    T LH+A R   E++  ILL++G+ +    K+  TPLH+A++ G +++  +LLQ  A+P+   K+  + LH+A+  D+   A +L++ GA    T + G+T LHIAAK  ++ +AT LL+ G ++N   R G+ PLHL        +  LL+   A     +K+G +PLH+AA+++ + +A+ L+++ A+ N+ ++ G+TPL +    G+ KM  FL+   AD N+K KN  + +H AAQ+    +  +LL  G   +  T  G T L  A   G I+++
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVV 517          

HSP 5 Score: 286.574 bits (732), Expect = 6.802e-79
Identity = 185/516 (35.85%), Postives = 284/516 (55.04%), Query Frame = 1
Query:  133 AARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDS-------RGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDH---VDAARVLIE 1650
            AARSG+ Q +   L+ G  I     NGL+ LH+A++   V+ V++L+   A V+  T    T+LH+A   G       L++ GA  NV++ NGFTPL++A ++N + V++LLL   AS    T+ G TP+ V+   G+  +V ILL+  +       RG     ALH+AA+    +    LL N A VD ++    TPLHIAA  G + I  LL++     +    N  TPLHV+ + G+  VT  L+E GA L   T+ G TPLH A + G   + + LL+  ++  A  +NGLT LH+AS  D+ +   LL++ G + + T  +  TPLH+AA    + +A  L+E   E NA    G  PLH+  ++    V  LLL   A +   T+SGLSPLH+AA     N+A +L+++GA+ N  T    T L +A      +M+  LL++G+ V+++ K   TPLH AA+ G+  I+ +LL+  A PN++T +  + L IA +  +   VD  +V+ E
Sbjct:   13 AARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGET---ALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTE 525          

HSP 6 Score: 285.419 bits (729), Expect = 1.586e-78
Identity = 175/516 (33.91%), Postives = 295/516 (57.17%), Query Frame = 1
Query:  208 NGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLEN----DSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLL 1743
            +GL  LH A++ G   +V+ILL + A + + TK G + LH+A     V+ V  L+++ A V+  + +  T L++AA   H    K+LL   A+  +   +GFTPL +A ++   +V+ +LL+     ++     L  +H++A   ++    +LL   A+ +  +  G T LH+AA  G   +   L+  G  V+ +A+   TPLH++ + G L + + L++  A  +  T +G TPLH A R G+E++TA LL+ G++ +  T+ G T LH+AS+   +E   LL+    + +    + LTPLHVA+H  + ++A LL++     +A A NG+TPLHIA KK+++++   LL+ GA   A T  G++PLH+ A  GH ++A +L+   A+ N  T    + LHLA + ++  + +IL+K+G+ V+A  K   TPL +A   GNI ++  LLQH A+ N+ TK+ Y+ LH AA++ H     +L++ GA+    T  G TAL IA + G +++   L
Sbjct:    5 DGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 7 Score: 216.853 bits (551), Expect = 6.329e-57
Identity = 102/203 (50.25%), Postives = 138/203 (67.98%), Query Frame = 1
Query: 3694 LCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKL 4302
            L +++GGT PAQWEDITG+TPL+  KQCVSFTT VSARFWL+DC+   E      ++Y+E + VPYM KFV+FAKT +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  ++E  GN++P+TK G Q  L F AF+ENRLPF  +++D S + + G++ FM+D +  +G          +PQ  +C L I L
Sbjct:  959 LMTLTGGTAPAQWEDITGTTPLTFTKQCVSFTTNVSARFWLIDCRQTHEAVNFTTQMYRELVCVPYMAKFVVFAKTHDPVEARLRCFCMTDDKVDKTLEQQENFSEMARSRDVEVLEGKPIYVECFGNLVPLTKAGQQHALSFYAFRENRLPFMVKIRD-SNQEACGRLCFMKDAKTARG----------LPQAAVCNLNIML 1150          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 334/709 (47.11%), Postives = 460/709 (64.88%), Query Frame = 1
Query: 1171 NARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTM--------SNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAP----DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQ 3261
            N RALNGFTPLHIACKKNR++V+ELLLK GASIEA TESGL+P+HV+AFMG+ NI L+L+Q GA+PN   +R ET+LH+A RA Q E+++ LL+NG+ VDA+A+E+QTPLHIAARLG ++I+++LLQH A+P+  T + Y+ LH+AA+E H D   +L+E GA L +TT+KGFT LH+A+KYGK+ +A+LLLQ     +  G+NGLTPLH+A HY +  + +LL++  ASP  T+KNGYTPLHIAA+K+ LEIA  L+E  A  N+ +R G  PLHL +QEGH  +A  L+   AD N   K+ LS +HLAAQEDKV VAE+L+  G  +++ TK GYTPL  ACH+G I M+ FL++H  ++N++T  G T LH AAQQGH  ++  LL   A PN       TA  +ARR  Y+++ + LK     VT        V      + PE M E  V +  DD G+   T      L + +          S+    G+  ++       ++  +L    SD++ ++       EA   +  +F   +T T  Q  A  +   E  V      W  AP    DNV ++  P+ SGFLVSF+VDARGGSMRG RH GLRI++PP    APTRVTCR++K  R+   P + +GEGLA R++E+GP   +F  PV++E+PHFASLRG++RE+V+LR +NGE W+EH  E S++
Sbjct:    9 NVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLK----VVTEETITSTTVSNPSSRNVPETMTE--VLEVSDDEGEDTMTGDGMEYLRAEDLRELGDDSLPSSHFLEGSTGYSMGFGNWATRSGSLRSFSSDRSYSLGRGPYSREATLIE--EFTAATTIT--QLAAPKEEEEEKGVGGMPTSW--APIEILDNVALSSSPIHSGFLVSFMVDARGGSMRGCRHHGLRIVIPPRKCMAPTRVTCRLVKRHRLAALPPVLEGEGLASRVVEVGPSGGQFLGPVIVEIPHFASLRGKERELVVLRSENGETWREHQSECSEE 705          

HSP 2 Score: 259.225 bits (661), Expect = 4.125e-71
Identity = 150/421 (35.63%), Postives = 253/421 (60.10%), Query Frame = 1
Query:   88 SSPVTKMDSGQSFLRAARSGNVQKIIDFL-DNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIR----LPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNI 1335
            ++P  +  +G + L  A   N  ++++ L   G  I     +GL  +H+++  G ++IV ILL   A  N+   +G T+LH+A  AG+ +VV  L+ +GA+V+ +++   TPL++AA+   +E+V+LLL + AS   AT +G+TPL VA ++GHE V AILLE+ +   +        LH+A+K   ++ A+LLL   A+ D    +G TPLH+A+HY N  +A LL+++G   +  AKN  TPLH++ K   L +   L+E GA+    TR G+ PLH   + G+ ++ + LL   ++ +  T++GL+ LH+A+Q D +   ++L+ +G ++N TT    TPL VA H G+++M N L++   ++N++  NG+TPLH A ++    +V LLLKCGA     T +G + L +A  +G+ ++
Sbjct:    6 ANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISV 426          

HSP 3 Score: 255.373 bits (651), Expect = 7.544e-70
Identity = 155/455 (34.07%), Postives = 252/455 (55.38%), Query Frame = 1
Query:  751 LIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFL-------IDSEADANAKAKNLLSSM 2094
            L+++G + N +A N  TPLH++ K   + V E L++ GA +E  T  GLTP+H +   G  NI   LL+ G++ +A    G T+LHMA++    E  + L+  G  ++    +  TPLH+AA  G + +  LL++     +A   NG+TPLH+A ++    V  +LL+ GAS+  TT+ G +PLHVA+  G   +A +L+Q  A+P+       T LH+A+  + +++  +LL  G+   A AK   TPLHIAA+   ++I   LL++ A  N +T+   + LH+ A+E H D A +L+   A +   T+ G + LH+AA+  KV +A +L++ G   N   + G TPL +A HY ++ M   L++  A     +KNGYTPLH AA++    I + L++  A PN  + NG T L +  + G+  +   L       I S   +N  ++N+  +M
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNPSSRNVPETM 455          

HSP 4 Score: 250.366 bits (638), Expect = 2.813e-68
Identity = 145/427 (33.96%), Postives = 246/427 (57.61%), Query Frame = 1
Query:  949 LLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMI 2229
            LL  G+N + +  NG T LH+A + + I   +LL+ YG ++   T   LTP+HV+A  G++ +  +L++     NA  + G T LH+A +  + +VV  LL+ GA ++A      +PLH+AA +G   I  +L+Q+ A+P+  T    T LH+A R   E++  ILL++G+ +    K+  TPLH+A++ G +++  +LLQ  A+P+   K+  + LH+A+  D+   A +L++ GA    T + G+T LHIAAK  ++ +AT LL+ G ++N   R G+ PLHL        +  LL+   A     +K+G +PLH+AA+++ + +A+ L+++ A+ N+ ++ G+TPL +    G+ KM  FL+   AD N+K KN  + +H AAQ+    +  +LL  G   +  T  G T L  A   G I+++
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVV 427          

HSP 5 Score: 245.358 bits (625), Expect = 1.137e-66
Identity = 159/438 (36.30%), Postives = 244/438 (55.71%), Query Frame = 1
Query:  367 LIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDS-------RGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDH---VDAARVLIE 1650
            L++ GA  NV++ NGFTPL++A ++N + V++LLL   AS    T+ G TP+ V+   G+  +V ILL+  +       RG     ALH+AA+    +    LL N A VD ++    TPLHIAA  G + I  LL++     +    N  TPLHV+ + G+  VT  L+E GA L   T+ G TPLH A + G   + + LL+  ++  A  +NGLT LH+AS  D+ +   LL++ G + + T  +  TPLH+AA    + +A  L+E   E NA    G  PLH+  ++    V  LLL   A +   T+SGLSPLH+AA     N+A +L+++GA+ N  T    T L +A      +M+  LL++G+ V+++ K   TPLH AA+ G+  I+ +LL+  A PN++T +  + L IA +  +   VD  +V+ E
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGET---ALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTE 435          

HSP 6 Score: 245.358 bits (625), Expect = 1.289e-66
Identity = 147/430 (34.19%), Postives = 240/430 (55.81%), Query Frame = 1
Query:  268 LLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLEN----DSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKIL 1545
            LL K A+ N     G T LHIAC   ++ V+  L+++GA +   +++G TP++++A   ++ +V +LL   AS       G T L +A + G  +VV  LL N    D++ R     LHIAA+   ++   LLL + A+ D  +++G+TPLH+AA  G+ ++  +L+E G  +    K   TPLHV++K+G + V   L+++ A  +   ++GLTPLH A     + +   LL  G++  A  +NG T LH+A++ D +E    L+ YG   N  T   + PLH+ A  GH  +A+LL+    ++N    +G +PLH+A ++++V V E+L+K GA + ATT+ G +PL VA   G+  +   L+Q+GA+ N +T    T LH A +     ++ +LLK G+  +       T L IA RLG I ++  L
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 7 Score: 221.861 bits (564), Expect = 4.084e-59
Identity = 142/400 (35.50%), Postives = 219/400 (54.75%), Query Frame = 1
Query:  607 LHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLA 1806
            LHIA KK+ ++   LLL   A+++  + SG TP+H++A  GN+NI  +L++ G   N       T LH++ + G   V   L+  GAQ++ K R+  TPLH A R G   I   LL+  ++  A T NG T LH+A++  H +   +L+ +G +L  TT    TPLHVA+  G + +A+LL++     +A   NG TPLH+A   +  KV  LLL  GAS  AT ++G +PLH+AA      IA  L++ GA  N  T +    LHL  +    ++  +LL   + V+   K   +PLH+AA+   +++ +IL++H A+ N  TK  Y+ L +A    ++     L++ GA +   T+ G+T LH AA+ G   +  LLL+ G   N    NG T L +A
Sbjct:   19 LHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIA 418          

HSP 8 Score: 216.468 bits (550), Expect = 2.306e-57
Identity = 102/203 (50.25%), Postives = 138/203 (67.98%), Query Frame = 1
Query: 3694 LCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKL 4302
            L +++GGT PAQWEDITG+TPL+  KQCVSFTT VSARFWL+DC+   E      ++Y+E + VPYM KFV+FAKT +  E  LRCFC+TDDK+DKTLE QE F   A S +VEVL+ +  ++E  GN++P+TK G Q  L F AF+ENRLPF  +++D S + + G++ FM+D +  +G          +PQ  +C L I L
Sbjct:  835 LMTLTGGTAPAQWEDITGTTPLTFTKQCVSFTTNVSARFWLIDCRQTHEAVNFTTQMYRELVCVPYMAKFVVFAKTHDPVEARLRCFCMTDDKVDKTLEQQENFSEMARSRDVEVLEGKPIYVECFGNLVPLTKAGQQHALSFYAFRENRLPFMVKIRD-SNQEACGRLCFMKDAKTARG----------LPQAAVCNLNIML 1026          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006531.1 (pep scaffold:Pmarinus_7.0:GL477280:1359:33855:1 gene:ENSPMAG00000005898.1 transcript:ENSPMAT00000006531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 413.69 bits (1062), Expect = 2.305e-117
Identity = 209/426 (49.06%), Postives = 289/426 (67.84%), Query Frame = 1
Query: 3064 PPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQ-------AANKGMINQGELT------NLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKL 4302
            PP LN+GE L  R+L++GP    F  PVL+E+PHFASLRGR+RE+V+LR  +G+ WKEH  +  +  + D L     +  ++ E L+ KRI RI+T +FP YFA+V+R+RQE  ++G +GGV+S +V+  V+A FP+GAL KRIKVGLQAH +  ++V K+LGN+ A SPIVT+EPRRRKFHKPIT+TIP+PQ       A+    +N    T       LRLLCSI+GG +PA WEDITG+TPL+     VSFTT VSARFWL+ C+  PE   +  +LY+EA  VPY+  FV+F+K  E  E  LRCFC+TDD++DKTLE QE F   A S +VEV++ +  ++E  GN++P+TK G Q   +F AFKENRLPF  +++D + E   G++ FM+DP+  +G          +PQ+ +C+L I +
Sbjct:    8 PPPLNEGESLVSRLLQLGPEGTSFIGPVLVEIPHFASLRGRERELVVLRSGDGKTWKEHQNDCKNDDLNDVL-NGMDEELDSLEELERKRICRIVTRDFPQYFAVVSRVRQESEVVGPEGGVLSCTVVPDVRASFPQGALTKRIKVGLQAHPVPEDMVRKVLGNKAAFSPIVTVEPRRRKFHKPITMTIPVPQSTSAITAASADTRVNGFSETVPDTPPPLRLLCSITGGISPAHWEDITGTTPLTITTSTVSFTTNVSARFWLLYCRQPPEAVNLANRLYQEATCVPYLATFVVFSKAVEAVESRLRCFCMTDDRVDKTLEQQENFTEVARSRDVEVMEGKPIYVECFGNLVPLTKSGQQHSFNFYAFKENRLPFYVKVRDVTQE-PCGRLCFMKDPKTTRG----------LPQQAICSLNITI 421          

HSP 2 Score: 49.6766 bits (117), Expect = 8.284e-6
Identity = 29/79 (36.71%), Postives = 44/79 (55.70%), Query Frame = 1
Query: 4456 KSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEY-INEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            ++ L L E+A  +G  WP LA+EL    + IN+++ E  I+  E+   LL  W+  +   AT  +L  AL RI R D+V
Sbjct: 3079 RTSLRLSEIAGHLGISWPELARELSFHEDQINRIRMENPISVAEQGHELLRQWTAHDGPAATVEKLKVALARIHRLDIV 3157          
BLAST of Ankyrin vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 82.0333 bits (201), Expect = 6.923e-16
Identity = 88/321 (27.41%), Postives = 137/321 (42.68%), Query Frame = 1
Query:  202 NANGLNALHIASKEGLVDIVKILLTKNA-DVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGF--TPLYMAAQENHVEVVKLLLLNSASQTLATDDG---FTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKK---------DDVKAANLLLTND----------------------ANVDHQ------------SASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTP-LHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMA 1014
            ++ G   L IA  +G  D+VK ++ +   D+N     GNT+LH A L G +++V  LIE+GA VN++S   F  TPL  A+   H++VVK LL N A  T+    G   F  +    +   E+   IL E   R       L IAAKK         D  K  N   T D                      +N+D +            S +G   L  A+  G++      +E GG ++ ++         S K G+  +T   +  G  +   +RD  T  L  AV  G+      LL++G++ + + + G T+L+ A
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFESVDDESEFDDEEDQKILREIKKR-------LSIAAKKWTNRAGIHNDKSKNGNNAHTIDQPPFDNTTKAKNEKAADSPSMASNIDEKAPEEEFYWTDVTSRAGKEKLFKASKEGHLPYVGTYVENGGKIDLRS------FFESVKCGHEDITSIFLAFGFPVNQTSRDNKTSALMVAVGRGHLGTVKLLLEAGADPTKRDKKGRTALYYA 634          

HSP 2 Score: 60.4622 bits (145), Expect = 2.800e-9
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = 1
Query: 2125 VAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQT--NFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTA 2388
            V +++   G +I+ +  AG T LH A   G I ++  LI++  ++N ++   FG T L  A+  GHL V+  LL   ADP IRN++ +TA
Sbjct:  346 VKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTA 435          

HSP 3 Score: 56.9954 bits (136), Expect = 2.983e-8
Identity = 36/98 (36.73%), Postives = 55/98 (56.12%), Query Frame = 1
Query: 1177 RALNGFTPLHIACKKNRVKVVELLLKCGA-SIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRC--ETSLHLATRANQEEMIKILLKNGS 1461
            R   G T L IAC K +  VV+ +++ G   I     +G + LH AA  GH  I  +LI+NGA+ N+++I    +T L  A+     +++K LLKNG+
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGA 423          

HSP 4 Score: 52.373 bits (124), Expect = 6.513e-7
Identity = 77/310 (24.84%), Postives = 121/310 (39.03%), Query Frame = 1
Query: 1591 STLHIAAKEDHVDAARVLIEAGA-KLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRN--GLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLH----------------IAARKNLLEIADKLIENQAN-PNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCE-IDSKTKAGYTPL------------------HTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVAR 2403
            + L IA  +   D  + +IE G   +      G TALH AA  G + +  LL++ G D N++     G TPL  A     + +   L++  A P   +  G T                   +   K  L IA K   N+A   N +S+NG    H   Q   D   K   +  AD+ + A N+       A E++    +V   AG E +   +K G+ P                      C    I  I+       N  ++ N  +++L +A  +GHL  +  LL+  ADP  R+ +  TA + A+
Sbjct:  332 TRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFESVDDESEFDDEEDQKILREIKKRLSIAAKKWTNRAGIHNDKSKNG-NNAHTIDQPPFDNTTKAKNEKAADSPSMASNI----DEKAPEEEFYWTDVTSRAGKEKLFKASKEGHLPYVGTYVENGGKIDLRSFFESVKCGHEDITSIFLAFGFPVNQTSRDN-KTSALMVAVGRGHLGTVKLLLEAGADPTKRDKKGRTALYYAK 635          

HSP 5 Score: 51.2174 bits (121), Expect = 1.856e-6
Identity = 25/65 (38.46%), Postives = 41/65 (63.08%), Query Frame = 1
Query: 2176 AGYTPLHTACHFGQINMIYFLIKHN-CNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIR 2367
             G T L  AC  G+ +++  +I+    +IN Q N G+T+LH AA QGH++++  L++  AD NI+
Sbjct:  329 GGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIK 393          
BLAST of Ankyrin vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 72.7886 bits (177), Expect = 1.910e-14
Identity = 62/222 (27.93%), Postives = 94/222 (42.34%), Query Frame = 1
Query: 1198 PLHIACKKNRV-KVVELLLKCGASIEATTESGLSPLHVA-AFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANP--NNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDS-NVQGRNGLTPLHLAVHYSSMPMTVLLIE 1848
            PLH AC +N   KV ELL    + +    + G  PLH + +F  H   + +L +                               ++N +L D       TP HIA  +GN++++K L      P  N +T    + LH+A  +   + ++ LIE GA + +  +     LH AA  G + L  LL  LG  + N Q + G TPL  A+        VLL+E
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSK-------------------------------MENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 2 Score: 71.633 bits (174), Expect = 4.425e-14
Identity = 54/181 (29.83%), Postives = 90/181 (49.72%), Query Frame = 1
Query: 1186 NGFTPLHIACKKNRVKVVELLLKCGASI---EATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCE--TSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQ-HQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEA-GAKLELTTRKGFTALHIA 1707
            +G  PLH +      ++   LL    ++   +   +SG +P H+A  +G+  +   L      P+L  I  +  T LHLA      E+ + L++NG+ V  + K  Q PLH AA +G++ +I++L    ++  N   K  ++ L  A  E H DAA +L+E  GA+ +L   KG  A  +A
Sbjct:   35 DGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVA 215          

HSP 3 Score: 64.6994 bits (156), Expect = 1.184e-11
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 1
Query:  208 NGLNALHIASKEGLVDIVKILLTK--NADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLL-LNSASQTLATDDGFTPLAVALQQGHEKVVAILLE 573
            +G    HIA   G +++VK L  +    D+N  T +G T LH+A      +V  FLIE+GA V ++ +    PL+ AA    +++++LL  L  ++       G+TPL  AL +GH     +L+E
Sbjct:   71 SGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 4 Score: 58.151 bits (139), Expect = 1.858e-9
Identity = 49/195 (25.13%), Postives = 84/195 (43.08%), Query Frame = 1
Query: 1864 FKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESR---NGFTPLHLCSQEGHDKMAKFLIDS--EADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIK-HNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKK-ADPNIRNSQNMTAAHVARRQHYLNIF 2427
             +  ++G  PLH +      EI   L+    N N +     +G+TP H+    G+ ++ K L D   + D N      ++ +HLA  +    V++ L+  G  +  K K    PLH A   G + +I  L       +N Q   G T L  A  +GH    + L++K  A+ ++ +++   A  VA  +     F
Sbjct:   30 LQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFF 224          

HSP 5 Score: 53.5286 bits (127), Expect = 6.202e-8
Identity = 59/233 (25.32%), Postives = 91/233 (39.06%), Query Frame = 1
Query:  313 NTSLHIACLAGKVDVVNFLIEHGAKVNVQ-SQNGFTPLYMAAQENHVEVVKLLLLNSASQTL---ATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKG-AQLECKTRDGLTPLHCAVRSGYENITAFLL-KSGSNHSAKTRNG 993
            N  LH AC+  +   V  L+     + +Q  Q+G  PL+ +      E+   LL    +  L     D G+TP  +A   G+ +VV  L +                K D  K  N               G T LH+A       ++  LIE G  V  + K N  PLH +   G+L + E L   G + +  + + G TPL  A+  G+ +    L+ K G+ +      G
Sbjct:    3 NYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDR-------------PLKPDLNKITN--------------QGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKG 208          

HSP 6 Score: 50.8322 bits (120), Expect = 5.087e-7
Identity = 40/158 (25.32%), Postives = 75/158 (47.47%), Query Frame = 1
Query:  607 LHIAAKKDDV-KAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVN---FQAKNNITPLHVSTKWGNLAVTERLVEKGAQ--LECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYG 1062
            LH A  +++  K   LL +  + +  +   G  PLH +  +    I + L+ +  +VN   +   +  TP H++   GNL V + L ++  +  L   T  G+T LH AV   +  ++ FL+++G++   K +     LH A+    ++  +LL   G
Sbjct:    6 LHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLG 163          
BLAST of Ankyrin vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 73.9442 bits (180), Expect = 1.816e-13
Identity = 80/260 (30.77%), Postives = 119/260 (45.77%), Query Frame = 1
Query:   58 DQNKDKSSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVK-----ILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQN-GFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLEN------------DSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQ 783
            D  +D S   S+ +T + S    L+A RSGN ++  +   N  D A  +   L   H A + G +  VK      LL  N D +S      T LH A +  ++ VV+FL+  GA VN ++     TPL+ AA+  +V +V  LL + A  T+  D GF  L +++   +  +V  +L N            D +GR  L  L  A + D +  A  LL   A++      GFTPLH     G  ++   LI+ G D  FQ
Sbjct:   27 DSQEDISLGDSNEITSLAS----LKAIRSGNEEESGNEQVNHNDEAEEDPL-LTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHI--TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSL--LWAAYQGDSLTVAE-LLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF-FQ 275          

HSP 2 Score: 69.707 bits (169), Expect = 3.113e-12
Identity = 55/181 (30.39%), Postives = 82/181 (45.30%), Query Frame = 1
Query: 1393 TSLHLATRANQEEMIKILLKNGSLVDARAKE-QQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVD-AARVLIEAGAK--LELTTR--KGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKN 1917
            T LH A+  N+  ++  L+  G+ V+ARA     TPLH AAR G + I+  LL+H A+P       ++ LH++    ++     VL    +K  L++  R  KG T+L  AA  G       LL+ G    +    G TPLH         +   LI+  A  F+ +  G     IA   N
Sbjct:  111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMN 291          

HSP 3 Score: 66.6254 bits (161), Expect = 2.769e-11
Identity = 57/193 (29.53%), Postives = 84/193 (43.52%), Query Frame = 1
Query:  796 ITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGL---TPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGAN 1365
            IT LH ++    L+V + LV +GA  +   R G    TPLH A R GY  I  FLLK G++ +     G   LH++    +I    +L+ Y                         + N++ +   +I+ R   G T L  A  +     V  LLK GASI+     G +PLH     G  ++   LIQ+GA+
Sbjct:  110 ITGLHWASINNRLSVVDFLVSQGA--DVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNI----MLVLY------------------------VLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGAD 272          

HSP 4 Score: 62.003 bits (149), Expect = 7.175e-10
Identity = 52/185 (28.11%), Postives = 82/185 (44.32%), Query Frame = 1
Query: 1105 HVAAHCGHVRMANLLIECACEINARA--LNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRC-----ETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAAR 1638
            H A+    + + + L+    ++NARA  L+  TPLH A +   V +V+ LLK GA    T + G + LH++    +  + L ++ N  +  L  I C      TSL  A        +  LLK G+ +     E  TPLH     G   ++K L+Q  A+    T        IA + + V + R
Sbjct:  114 HWASINNRLSVVDFLVSQGADVNARAGALHA-TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLR 297          

HSP 5 Score: 58.151 bits (139), Expect = 1.214e-8
Identity = 44/152 (28.95%), Postives = 68/152 (44.74%), Query Frame = 1
Query: 1888 TPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLL-----------SSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQ 2310
            TPLH AAR   + I D L+++ A+P      GF  LHL     +  +  +++      N  +K LL           S +  A Q D + VAE LL  G  I      G+TPLH     GQ +++ +LI+   +   +T+ G     +A + 
Sbjct:  145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVL-----FNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAE-LLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEM 290          

HSP 6 Score: 55.8398 bits (133), Expect = 6.300e-8
Identity = 43/139 (30.94%), Postives = 63/139 (45.32%), Query Frame = 1
Query:  133 AARSGNVQKIIDFL-DNGGDIATANANGLNALHIASKEGLVDIVKILLTKNA-----DVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVA 531
            AAR G V  I+DFL  +G D    +  G N LH++     + +V  +L         D++    KG TSL  A   G    V  L++ GA + +    GFTPL+    +    V+K L+ + A     TD G    A+A
Sbjct:  150 AARYGYVY-IVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIA 287          

HSP 7 Score: 50.8322 bits (120), Expect = 2.224e-6
Identity = 32/136 (23.53%), Postives = 67/136 (49.26%), Query Frame = 1
Query: 1951 QANPNSESRNG--FTPLHLCSQEGHDKMAKFLIDS---EADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGY-TPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALL 2340
            Q N N E+      T  H   Q G     K +I     E + +  +   ++ +H A+  +++ V + L++ G +++++  A + TPLH A  +G + ++ FL+KH  +     + G   LHL+    ++ +++ +L
Sbjct:   61 QVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVL 196          
BLAST of Ankyrin vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 59.6918 bits (143), Expect = 2.463e-9
Identity = 48/181 (26.52%), Postives = 79/181 (43.65%), Query Frame = 1
Query: 1279 TESGLSPLHVAAFMGHTNIALVLIQNGANPN--LQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGT---DSNVQGRNGLTPLHLA 1806
            +E+G S LH A++ G   I + LIQ G + +  ++T +  T +HLA     E+ + +LL            QQ P  I                    N+  ++  + +HIA   D+     +LI  GA L +    G T LH+  +YG ++   +LL  G    D NV+ +    P+ +A
Sbjct:   37 SENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLL------------QQFPRFI--------------------NHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVA 185          

HSP 2 Score: 55.8398 bits (133), Expect = 3.509e-8
Identity = 41/147 (27.89%), Postives = 73/147 (49.66%), Query Frame = 1
Query:  145 GNVQKIIDFLDNGGDIATA--NANGLNALHIASKEGLVDIVKILLTKNADVNSATK--KGNTSLHIACLAGKVDVVNFLIEHGAK-VNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILL 570
            GN+  +   L    D+ T   + NG ++LH AS  G   I   L+    D +   K  KGNT +H+A + G    ++ L++   + +N + +NG  P+++A   ++ + + LL+   A   +   +G TPL V L+ G    + +LL
Sbjct:   16 GNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLL 162          

HSP 3 Score: 55.4546 bits (132), Expect = 5.801e-8
Identity = 54/225 (24.00%), Postives = 97/225 (43.11%), Query Frame = 1
Query:  304 KKGNTSLHIACLAGKVDVVNFLIEHGAKV--NVQSQNGFTPLYMAAQENHVEVVKLL--LLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKG-AQLECKTRD--GLTPLHCAVRSGYENITAFLLK 957
            K+ +  L  A + G + +V  L+     +  N+ S+NG++ L+ A+      +   L  L +   + + T  G T + +AL +GHE+ + +LL+   R                             ++H+  +G  P+HIA         +LLI  G D+     N  TPLHV  ++G+++  + L+ +G   L+   RD     P+  A      NI + +LK
Sbjct:    3 KEPSVRLREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRF----------------------------INHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNIYSKVLK 199          

HSP 4 Score: 53.9138 bits (128), Expect = 1.742e-7
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  982 TRNGLTSLHMAS-QGDHIECGQLL-INYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACE-INARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNG 1359
            + NG +SLH AS  G ++ C  L+ + +  +    T    T +H+A   GH +  +LL++     IN R  NG  P+HIAC  +  + + LL+  GA +     +G +PLHV    G  +   +L+  G
Sbjct:   37 SENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEG 165          

HSP 5 Score: 52.373 bits (124), Expect = 4.472e-7
Identity = 37/129 (28.68%), Postives = 64/129 (49.61%), Query Frame = 1
Query: 1669 LTTRKGFTALHIAAKYGKVALATLLLQLGTDSN--VQGRNGLTPLHLAVHYS-SMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLID 2046
            + +  G+++LH A+ +G+  +   L+QLG D +  ++   G T +HLA+       + +LL +F        +NG  P+HIA   +  +    LI   A+      NG TPLH+C + G     K L++
Sbjct:   35 IDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLN 163          
BLAST of Ankyrin vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 59.6918 bits (143), Expect = 3.600e-9
Identity = 53/188 (28.19%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  826 GNLAVTERLVEKGA-QLECKTRDGLTPLHCAVRSGYENITAFLLKSGSN-HSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECA------CEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGAN 1365
            G+L V + +VE GA  +     D L+ LH A  +   ++  FLL  G+N + A    G T+LH A++  +I    LL+ +G +        L  +H + +  ++ +   ++          +I+++  N  TPL  A  +     VELLLK G+++  T   G + LH A   G   +   LI +GAN
Sbjct:   61 GDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGAN 248          

HSP 2 Score: 56.6102 bits (135), Expect = 3.448e-8
Identity = 53/198 (26.77%), Postives = 92/198 (46.46%), Query Frame = 1
Query:  124 FLRAARSGNVQKIIDFLDNGG-DIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGN-TSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATD------DGFTPLAVALQQGHEKVVAILLE-------NDSRGRIRLPALHIAAKKDDVKAANLLLTNDAN 672
            F+ AA+ G+++ + D +++G  DI     + L+ LH A       + K LL + A+ N A   G  T+LH A   G + +V+ L++HGA   ++ + G   ++ +   +++ +V  +L    +     D      +  TPL  A  QG    V +LL+        D+RG     ALH A    D +    L+ + AN
Sbjct:   54 FIEAAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRG---FNALHCALVGGDQRVICDLILSGAN 248          

HSP 3 Score: 54.299 bits (129), Expect = 1.837e-7
Identity = 58/216 (26.85%), Postives = 84/216 (38.89%), Query Frame = 1
Query:  469 LLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDS----RGRI-RLPALHIAAKKDDVKAANLLLTNDANVDHQSA-SGFTPLHIAAHYGNVNIANLLIERGGD-------------------------------------VNFQAK--NNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAK 981
            LL   S T    D F   A   + G  KVV  ++E+ +      RI  L  LH A   +    A  LL   AN +  +   G T LH AA YGN+ I +LL++ G D                                     V+  +K  NN TPL  +   G+    E L++ G+ +      G   LHCA+  G + +   L+ SG+N   +
Sbjct:   40 LLGDGSNTEYVVDIFIEAA---KDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYER 252          

HSP 4 Score: 53.5286 bits (127), Expect = 2.832e-7
Identity = 51/181 (28.18%), Postives = 85/181 (46.96%), Query Frame = 1
Query: 1507 AARLGNIDIIKILLQHQA-NPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKL-ELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEF------QASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDK 2025
            AA+ G++ ++K +++  A + NN   D  S LH A   +    A+ L+  GA   +     G TALH AA+YG + +  LLL+ G D  ++   GL  +H +V+ S++ + V ++ F               N  TPL  AA +      + L++  +        GF  LH C+  G D+
Sbjct:   57 AAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALH-CALVGGDQ 236          

HSP 5 Score: 53.5286 bits (127), Expect = 3.135e-7
Identity = 50/186 (26.88%), Postives = 77/186 (41.40%), Query Frame = 1
Query: 1894 LHIAARKNLLEIADKLIENQANPNSES-RNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAA------GCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFE 2430
            LH A   N   +A  L+   ANPN  +   G T LH  ++ G+  +   L+   AD   K +  L+ MH +     + +   +L          +IDSK     TPL  A + G    +  L+K    +    N G  +LH A   G  +VI  L+   A+   RN+Q      +A      ++FE
Sbjct:   88 LHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLAEGMGTKSLFE 273          

HSP 6 Score: 52.7582 bits (125), Expect = 4.959e-7
Identity = 47/174 (27.01%), Postives = 87/174 (50.00%), Query Frame = 1
Query: 1111 AAHCGHVRMANLLIEC-ACEINARALNGFTPLHIACKKNRVKVVELLLKCGASI-EATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQ----EEMIKILLKNGSLVDARAKE--QQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIA 1608
            AA  G +++   ++E  A +IN   ++  + LH AC  NR  V + LL  GA+  +A    G + LH AA  G+  I  +L+++GA+P L+  +    +H +  ++       ++  ++ N   VD  +K+   +TPL  AA  G+   +++LL+  +         ++ LH A
Sbjct:   57 AAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCA 230          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO45487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW5])

HSP 1 Score: 311.612 bits (797), Expect = 6.130e-94
Identity = 183/441 (41.50%), Postives = 256/441 (58.05%), Query Frame = 1
Query: 2878 DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGE-AWKEHSLETSD---QAVMDALGTSFGDNFETSESL-KEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGELTNLRLLCSI-------SGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAK-TTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPAR 4161
            DNVP+   PVT GFLVSFLVDAR G M  S   G++I++PP +   PTR+TCR+++ +R    P L +GE LACR+L++GP   +F  PV LEVP+FA+LR  +RE+V+++ D+G   W E S+E       A+   +    G   ++ +++   +R  +I T   P  FA+V+R+++EI  +G+ G  I S+VL  VQ   PEGA+    K+ LQ   +D       L   + VSP+VT+EP    F KP+TVTIP P     G  N     +LRLLC         S  T   QW+DITG+TPL+ +    SFT    AR+WL++ +N          +Y++   VPY+ KFV+FAK + +  E  LR FCITDDK+DKTLE Q GF   A S +VEV D R   +   GN+ PV +  D L L+F +F+ENRL    R
Sbjct:    4 DNVPLYEPPVTGGFLVSFLVDARSGKME-STQTGIKIVLPPRSCQMPTRITCRLLRINRPTLLPPLREGEALACRVLDIGPSGTRFLQPVYLEVPYFAALRDGERELVVMKTDDGGWNWDEVSVEDMKGKCHAICLKIERVKGYKEDSPDAIFPSRRYAKISTQALPERFAVVSRVKKEIFSVGSRGESIRSAVLPSVQVNVPEGAVASGTKMSLQVQPVDENF--NNLEEWVTVSPVVTLEPADIIFKKPVTVTIPCP--VYSGQSNPDIQPSLRLLCCFPKEAKAGSAQTPAYQWQDITGNTPLTVIGANASFTIDRPARYWLIETRNPDNVTADARLIYRKLAAVPYLAKFVVFAKLSADGTEARLRVFCITDDKMDKTLEGQTGFVEIARSRDVEVHDGRPIHIRCLGNLAPVQR--DPLHLNFFSFRENRLSVTVR 437          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO45486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW2])

HSP 1 Score: 195.667 bits (496), Expect = 9.220e-56
Identity = 118/286 (41.26%), Postives = 159/286 (55.59%), Query Frame = 1
Query: 3328 KRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGELTNLRLLCSI-------SGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAK-TTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPAR 4161
            +R  +I T   P  FA+V+R+++EI  +G+ G  I S+VL  VQ   PEGA+    K+ LQ   +D       L   + VSP+VT+EP    F KP+TVTIP P     G  N     +LRLLC         S  T   QW+DITG+TPL+ +    SFT    AR+WL++ +N          +Y++   VPY+ KFV+FAK + +  E  LR FCITDDK+DKTLE Q GF   A S +VEV D R   +   GN+ PV +  D L L+F +F+ENRL    R
Sbjct:   10 RRYAKISTQALPERFAVVSRVKKEIFSVGSRGESIRSAVLPSVQVNVPEGAVASGTKMSLQVQPVDENF--NNLEEWVTVSPVVTLEPADIIFKKPVTVTIPCP--VYSGQSNPDIQPSLRLLCCFPKEAKAGSAQTPAYQWQDITGNTPLTVIGANASFTIDRPARYWLIETRNPDNVTADARLIYRKLAAVPYLAKFVVFAKLSADGTEARLRVFCITDDKMDKTLEGQTGFVEIARSRDVEVHDGRPIHIRCLGNLAPVQR--DPLHLNFFSFRENRLSVTVR 289          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 119.013 bits (297), Expect = 3.731e-29
Identity = 79/244 (32.38%), Postives = 121/244 (49.59%), Query Frame = 1
Query:   94 PVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKW 825
            P  + +SG  FL A  SG+V ++   L  G DI   N +GL ALH A  +   D+VK+L+ K A ++    +G TSLH A   G V++  +LIE+GA V   +  G  PL +A +E   ++  LL     +Q +  DD        +    +  +     N+S+ +    ALH+A+ K  +K   LLL     ++ + A  +TPLH AAH+G  +   LL E G D  F A+N +  +     W
Sbjct:   43 PKIQFNSGIVFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEE---DMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGAD--FNARNKMVGIDHQQNW 281          

HSP 2 Score: 102.449 bits (254), Expect = 1.464e-23
Identity = 66/219 (30.14%), Postives = 108/219 (49.32%), Query Frame = 1
Query:  232 ASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTR 888
            A   G VD VK LL K AD+N     G T+LH AC+    D+V  L++ GA ++V+   G+T L+ AA    VE+ K L+ N A      ++G  PL +A ++  E ++   +EN     I +       +K  +  A   L  +   + +  +  + LH+A+  G + +  LL++ G ++N +  +N TPLH +  WG     E L E GA    + +
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQG---IDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 3 Score: 85.1149 bits (209), Expect = 1.042e-17
Identity = 65/227 (28.63%), Postives = 107/227 (47.14%), Query Frame = 1
Query: 1111 AAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSL--VDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKD--NYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGR 1779
            A   G V     L+    +IN + ++G T LH AC      +V++L+  GAS++     G + LH AA  G   IA  LI+NGA+        E  L LA   + E+++   ++N  +   DARA E++  L+ A    N + I           N +KD    S LH+A+ + ++    +L++ G ++       +T LH AA +G+     LL + G D N + +
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCI-----------NESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 4 Score: 81.6481 bits (200), Expect = 1.826e-16
Identity = 60/215 (27.91%), Postives = 99/215 (46.05%), Query Frame = 1
Query: 1624 VDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQ 2268
            VD  + L+  GA +      G TALH A       L  +L+  G   +V+   G T LH A    S+ +   LIE  A     +  G  PL +A  +++ ++    IENQ     ++R     + L   +    + K  I+      +K K   S++H+A+ +  + V  +LL  G EI++K    +TPLH A H+GQ +    L ++  + NA+
Sbjct:   62 VDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIML--NDAQSWLNKNCINE-----SKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNAR 269          

HSP 5 Score: 79.337 bits (194), Expect = 1.163e-15
Identity = 61/224 (27.23%), Postives = 100/224 (44.64%), Query Frame = 1
Query:  682 QSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQG-------DHIEC-------------------GQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEA 1275
            Q  SG   L  A   G+V+    L+ +G D+N+Q  + +T LH +    N  + + LV+KGA ++ +  +G T LH A   G   I  +L+++G++ +A    G   L +A +        D IE                     Q  +N             + LHVA+  G++++  LL++   EINA+  + +TPLH A    +    ELL + GA   A
Sbjct:   46 QFNSGIVFLS-AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNA 268          

HSP 6 Score: 75.485 bits (184), Expect = 2.160e-14
Identity = 55/212 (25.94%), Postives = 93/212 (43.87%), Query Frame = 1
Query: 1519 GNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTS--------------------------KNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAK 2076
            G++D +K LL   A+ N    D  + LH A  +++ D  +VL++ GA +++   +G+T+LH AA  G V +A  L++ G D       G  PL LA       +    IE Q      +                          K   + LH+A+ K  L++   L++     N++  + +TPLH  +  G     + L ++ AD NA+ K
Sbjct:   60 GDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 7 Score: 64.6994 bits (156), Expect = 6.585e-11
Identity = 55/210 (26.19%), Postives = 92/210 (43.81%), Query Frame = 1
Query:  631 DVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENI---------------------------TAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINAR 1179
            DV     LL   A++++Q+  G T LH A    N ++  +L+++G  ++ +     T LH +   G++ + + L+E GA +     +G  PL  A     E++                            ++L K+  N S K +   ++LH+AS   +++   LL+  G  +N    D  TPLH AAH G      LL E   + NAR
Sbjct:   61 DVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINES-KDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNAR 269          

HSP 8 Score: 49.2914 bits (116), Expect = 8.834e-6
Identity = 42/175 (24.00%), Postives = 80/175 (45.71%), Query Frame = 1
Query: 1879 NGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGV-AEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVA 2400
            +G T LH A      ++   L++  A+ +     G+T LH  +  G  ++AK+LI++ AD  A        + LA +ED   +  + +   G ++D         +        +N     +  NC   ++    +++LH+A+ +G+L+VI  LL    + N +++ N T  H A
Sbjct:   81 DGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIM--------LNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAA 247          

HSP 9 Score: 48.9062 bits (115), Expect = 9.236e-6
Identity = 31/117 (26.50%), Postives = 57/117 (48.72%), Query Frame = 1
Query: 1960 PNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQ 2310
            P  +  +G   L   S    D++ K L    AD N +  + L+++H A  ++   + +VL+  G  +D +   G+T LH A   G + +  +LI++  ++ A  N G   L LA ++
Sbjct:   43 PKIQFNSGIVFLSAVSSGDVDEVKKLLAKG-ADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEE 158          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 111.309 bits (277), Expect = 2.678e-25
Identity = 110/437 (25.17%), Postives = 186/437 (42.56%), Query Frame = 1
Query: 1192 FTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVL-----IQNGANPNLQTI-----RCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLH---IAARLGNIDIIKI-------------------------------LLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQ----LGTDSNVQGRNGLT----PLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIE-NQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLD 2343
             TPLH+AC    + V + L++ GA + +  E  ++PLH A   G+  +A +L     ++ G +   + +       +T+LHLA      ++ K+ L+ G+ V+A  + +    H   + AR     +IK+                               +++ +A      KD  + L IAA+++HVD  R L++ GA +         ++  AA  G +      L+    + T  +    NGL      L L +  SS     LL++  A     +    TP+H AA+   +     L++ + A  N E     TPLHL +  GH  + K L+      +A+   L + +  AA    V VA +LL     +D   KA  TPLH A   G + M+  L+    NI    + G   L +A +  H +V +A++D
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQ----LLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 2 Score: 105.531 bits (262), Expect = 1.921e-23
Identity = 117/445 (26.29%), Postives = 192/445 (43.15%), Query Frame = 1
Query:  697 FTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLEC-----------KTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXH---------VAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLH-LATRANQEEMI-----KILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQ-ANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIEN 1950
             TPLH+A  +G + +A  L+E G D+    +  +TPLH +   GNL V  +L+   A+L             + R+  T LH AV  G+ ++    L+ G+N +A   +   + H        EC  ++I        +                  V   C  +R        AC I  R  +  TPL IA +KN V  V  LL+ GA I A   +  + +  AA  G        +++     + TI  +  L+ L   +N+  ++     ++LL NG+ +D++  E  TP+H AA+ G +  +  LL+   A  N+    + + LH+AA   H    + L+  G  ++      +T L  AA  G V +A +LL      +   +   TPLHLA     + M  LL+  +A+   T   G   L IA   +  E+A  +I++
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVA-KLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVAR-ECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFR------AC-IECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEH--QKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 3 Score: 84.3445 bits (207), Expect = 1.290e-16
Identity = 74/284 (26.06%), Postives = 128/284 (45.07%), Query Frame = 1
Query:  247 LVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDD--------GFTPLAVALQQGHEKVVAILLEN----DSRGRIRLPALHIAAKKDDVKAANLLLTND-ANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINY 1059
            +V I+  ++   A +    K  +T L IA     VD V  L++HGA +  +  N    ++ AA E  +E ++  L +        DD        G   L + L+   +    +LL+N    DS+    +  +H AAK   V+    LL  D A ++ +  +  TPLH+AA +G+  +   L+ RGG ++ +     TPL  +   G + V   L+++ A ++   +   TPLH A R G+  +   LL   +N +     G   L +A +  H E    +I++
Sbjct:  159 VVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQ----LLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 4 Score: 74.3294 bits (181), Expect = 2.089e-13
Identity = 70/275 (25.45%), Postives = 121/275 (44.00%), Query Frame = 1
Query:  223 LHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVK----LLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLE------NDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLL-----KSGSNHSAKTRNGLTS 1002
            L IA+++  VD V+ LL   AD+ +       S+  A   G ++ +   +EH   V     +      +      + V++    LLL N A      D+  TP+  A + G  + V  LL+      ND  G    P LH+AA          LL     +D ++A+ +TPL  AA  G V +AN+L++    V+   K   TPLH++++ G++ + + L+ + A +      G   L  A+ S ++ +   ++     K    +  K  N +TS
Sbjct:  184 LMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTP-LHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDHVDWKQAMRNRCKLGNAITS 457          

HSP 5 Score: 68.9366 bits (167), Expect = 9.290e-12
Identity = 93/402 (23.13%), Postives = 162/402 (40.30%), Query Frame = 1
Query: 1480 KEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKL--------ELTT---RKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLH----------------------------------LAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEG----------HDK---------------------------MAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAG-CEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVL 2436
            K Q TPLH+A   G I + K L++  A+  +L ++  + LH A  E ++  A++L  A A+L        ++ T   R+  TALH+A + G   LA L L+ G + N    +     H                                  L   +  + +   +I F+A      K+  TPL IAA KN ++    L+++ A+  ++  N    +   + EG          H K                            ++ L+D+ A  ++K    ++ +H AA+  +V     LL      I+ +  A  TPLH A   G   ++  L+     I+A+     T L  AA +G ++V   LLD+ A  +  +    T  H+A R+ ++ + ++L
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVA-AELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLL 402          

HSP 6 Score: 68.1662 bits (165), Expect = 1.736e-11
Identity = 51/157 (32.48%), Postives = 80/157 (50.96%), Query Frame = 1
Query:  133 AARSGNVQKIIDFLDNGGDIATANANGLNA-LHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKV-VAILLENDSRGRIR 597
            AA+ G V+ +   L     I        N  LH+A+  G   +VK LL +   +++      T L  A   G V+V N L++  A V+   +   TPL++A++E HVE+VKLLL   A+ TL    G   L +A++  H++V VAI+   D +  +R
Sbjct:  290 AAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDHVDWKQAMR 446          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO37520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFL9])

HSP 1 Score: 107.842 bits (268), Expect = 3.524e-23
Identity = 105/389 (26.99%), Postives = 162/389 (41.65%), Query Frame = 1
Query:  793 NITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHI-ECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGAN----PNLQTI-------------------RCETSLHLATRANQEEMIKILLK-NGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANP----------NNLTKDNY--------------STLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLL-QLGTDSNVQGRNGLTPLHLAV 1809
            N+T LH +    N  V   L    + ++C  R+  TP   A  +G +NI A L + G+N    T N L+  H     + + +C +L+  Y               H AA  GHV     L+      +A +  G TP+ IA +  RV V+E+L K GA  +        PL  AA  GH      L Q G +    P   +I                   RCET+LH+A+   Q +++  +L+ N + +         PLH A    +I  +K  L++  +P          +   +D Y              + LH+AA+   V+    L+E GAK  +    G  A+H+AA Y +V + +LL+ +   D N +   G TP H AV
Sbjct:  803 NMTALHFAASTSNTGVIGLLANHFSTVDCLDRNSRTPAFIAASTGQKNILAILFQKGANLFHVT-NSLSKKHQQRAKNPVKDCKRLMCGYSLL------------HAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGRVSVMEVLHKHGAPCDP------RPLRSAAAGGHLPAVRFLHQAGVSDECVPCKYSISPSYMKQRVGKLVDDEYLWRCETALHIASAMEQPDIVSYILRSNDTALTCYDYLGMRPLHKAVVYNSIKSLKAFLEYGVSPLSRCAPAEVLSTYPEDKYKNIADYFEPCICRYNALHLAARHGRVNMIATLLEYGAKTGVFDACGSQAVHVAACYDQVGVLSLLVAEYKVDVNSRDLIGKTPFHYAV 1172          

HSP 2 Score: 79.337 bits (194), Expect = 1.590e-14
Identity = 96/365 (26.30%), Postives = 148/365 (40.55%), Query Frame = 1
Query:  211 GLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEK-VVAILLENDSRGRIRLPALHIAA--KKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERG-GDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLI-ECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESG 1290
            G + LH A++ G V+ VK LL      ++ +  GNT + IA   G+V V+  L +HGA  + +      PL  AA   H+  V+ L            D   P   ++   + K  V  L++++   R    ALHIA+  ++ D+  + +L +ND  +      G  PLH A  Y ++      +E G   ++  A   +   +   K+ N+A             C  R     LH A R G  N+ A LL+ G                A  G    CG   +                 HVAA    V + +LL+ E   ++N+R L G TP H A K      ++ L K GA+I A  + G
Sbjct:  890 GYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGRVSVMEVLHKHGAPCDPR------PLRSAAAGGHLPAVRFL------HQAGVSDECVPCKYSISPSYMKQRVGKLVDDEYLWRCE-TALHIASAMEQPDI-VSYILRSNDTALTCYDYLGMRPLHKAVVYNSIKSLKAFLEYGVSPLSRCAPAEVLSTYPEDKYKNIADYFE--------PCICR--YNALHLAARHGRVNMIATLLEYG----------------AKTGVFDACGSQAV-----------------HVAACYDQVGVLSLLVAEYKVDVNSRDLIGKTPFHYAVKCKAAGALKRLFKLGANIHAEDDEG 1197          

HSP 3 Score: 70.0922 bits (170), Expect = 8.555e-12
Identity = 95/381 (24.93%), Postives = 151/381 (39.63%), Query Frame = 1
Query: 1393 TSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQ---------------HQANPNNLTKD------NYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQ-----GRNGLTPLHLAVHYSSMPMTVLLIEFQASPF-------KTSKNGY-----TPLHIAARKNLLEIADKLIE-NQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAK--NLLSSMHLAAQEDKV-GVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAA---QQGHLQVIIALLDKKADPNIRNSQNMTAAHVA 2400
            T+LH A   +   +I +L  + S VD   +  +TP  IAA  G  +I+ IL Q               HQ    N  KD       YS LH AA+  HV+  + L+      +  +  G T + IAA+YG+V++  +L + G   + +        G  P    +H + +    +  ++  SP        K   + Y     T LHIA+     +I   ++  N          G  PLH        K  K  ++      ++     +LS+      EDK   +A+      C         Y  LH A   G++NMI  L+++          GS ++H+AA   Q G L +++A  + K D N R+    T  H A
Sbjct:  805 TALHFAASTSNTGVIGLLANHFSTVDCLDRNSRTPAFIAASTGQKNILAILFQKGANLFHVTNSLSKKHQQRAKNPVKDCKRLMCGYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGRVSVMEVLHKHGAPCDPRPLRSAAAGGHLPAVRFLHQAGVSDECVPCKYSISPSYMKQRVGKLVDDEYLWRCETALHIASAMEQPDIVSYILRSNDTALTCYDYLGMRPLHKAVVYNSIKSLKAFLEYGVSPLSRCAPAEVLSTY----PEDKYKNIADYFEPCICR--------YNALHLAARHGRVNMIATLLEYGAKTGVFDACGSQAVHVAACYDQVGVLSLLVA--EYKVDVNSRDLIGKTPFHYA 1171          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 1434.85 bits (3713), Expect = 0.000e+0
Identity = 770/1619 (47.56%), Postives = 1058/1619 (65.35%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFW--KDSTFTKDQYIAQ-TKLGHEYAVASPVADWDYAP-DNVPITRKPVTSG-----------FLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSE-DNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSR-------EGTTEASFDVDSQSEFQVLSDEYEQRNQGETLPINTDQD 4881
            K DS  SFLRAAR+GN+ K++++L  G DI+T N NGLNALH+A+KEG +D+V+ LL + A V+S+TKKGNT+LHI+ LAG+ +VV  L++ GA +N QSQNGFTPLYMAAQENH++VV+ LL N  +Q+ AT+DGFTPLA+ALQQGH +VV+ILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  +   L+++G+Q++ KTRDGLTPLHCA RSG+E     LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNRVKV+ELL+K GASI+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ETSLH+A RA Q E+++ LL+NG++VDARA+E QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHI+A+E  ++ A VL+EAGA   L T+KGFT LH+ +KYG + +A LLLQ     +  G+NGLTPLH+A HY +  + +LL++  ASP  T+KNGYTPLHIAA+KN ++IA  L++  A  N+ ++ G TPLHL SQEGH  MA  L+   A  N   K+ L+++HLAAQED+V VAE+L+  G  +D +TK GYTPL  ACH+G   M+ FL+++  ++NA+T  G T LH AAQQG+  +I  LL   A PN       TA  +ARR  Y+++ + L+ V   V         V  K +L+ PE M E  V D  D+ GD   T      L   +       G ++L      G+   H +L   ++         DS   +F+  HH ++  +     +D    Q + L  +    S    W     DNV ++  PV SG           FLVSF+VDARGG+MRG RH GLRI++PP   SAPTR+TCR++K  R+   P + +GEGLA R++E+GP   +F  PV++E+PHFASLRGR+RE+VILR + GE+WKEH  E + Q  ++ +     ++ +T E L+ KRI RI+T +FP YFA V+R++Q+  +IG +GG++SS+V+ QVQAVFPEGAL KRI+VGLQA  +   +V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P + +  ++N   G    LRLLCSI+GGT PAQWEDITG+TPL+ +  CVSFTT VSARFWL+DC+   E      ++Y+E I VPYM KFVIFAKT +  E  LRCFC+TDDKIDKTLE QE F   A S +VEVL+ +  + +  GN++P+TK G      F AFKENRL    +++D + E   G+++FM++PRN           +++ Q  +C L I L +        + +S         +LD +     EEA+              K +  L  +A  +G  W  LA++LG +   IN +++E  N   ++S  LL  W++ + +H      L + L +I R D+V        R T+ED  +    ++ +       EG +    D+DS    +           G+ +P+ + +D
Sbjct:   29 KSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLRVVTEEVV---TTTTTVTEKHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRPEDLRE---LGDDSLPGQYLDGMNYLHFSLEGGRT---------DSAERSFTPTHHGYYSPRHEGVLEDVLSQQLSSLARDNERDSYRLSWCADNLDNVALSSSPVHSGRCSPCHGDHSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCSAPTRITCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFASLRGRERELVILRSETGESWKEHHCEHT-QEELNQILNGMDEDLDTPEELERKRICRIITRDFPQYFAAVSRIKQDSHLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQPVSVNVVRKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPGSNSDPVLNGFGGYTPTLRLLCSITGGTTPAQWEDITGTTPLTFINDCVSFTTNVSARFWLIDCRQVQESINFSTQVYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFYAFKENRLALFIKIRDNTQE-PCGRLSFMKEPRNY----------RALTQNAICNLNITLPS-------YSKVSRTLE-----KLDPQ-----EEAE--------------KREQRLAVIADHLGFSWTELARDLGFSEEKINTIRNENPNSLLDQSHALLNQWAQREAQHATAEATLVKQLTKINRMDIVHLIETGLNRSTQEDTSSHTYAEIEQTIALDHSEGFSALHEDIDSPRPRRHKETASRSPVSGQQVPVVSAED 1587          

HSP 2 Score: 262.307 bits (669), Expect = 5.752e-70
Identity = 160/552 (28.99%), Postives = 288/552 (52.17%), Query Frame = 1
Query:  880 KTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHL---------------------------------AVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVL 2436
            K  D  T    A R+G  +     LK G + S   +NGL +LH+A++  H++  Q L++ G  ++ +T    T LH+++  G   +   L++   +INA++ NGFTPL++A ++N + VV  LL+ G +    TE G +PL +A   GH  +  +L++N     ++      +LH+A R +  +   +LL+N    D ++K   TPLHIAA  GN+++  +LL   A  +   ++  + LH+A+K  + +  R+L++ G++++  TR G T LH AA+ G  A   +LL+ G     + +NGL+PLH+                                 A H     +T LL++ +A+P   + NG+TPLHIA +KN +++ + L++  A+  + + +G TP+H+ +  GH  +   L+ + A  +       +S+H+AA+  +  V   LL  G  +D++ +   TPLH A   G+  ++  L++H  + +A T  G T LH++A++G L+    LL+  A  ++   +  T  HV  +   L++ ++L
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLL 575          

HSP 3 Score: 189.119 bits (479), Expect = 1.634e-47
Identity = 125/391 (31.97%), Postives = 201/391 (51.41%), Query Frame = 1
Query:   88 SSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSR----GRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELL 1248
            S  V+ +    S   AAR+G  + +   L NG  +          LHIAS+ G  +IV++LL   A  ++AT  G T LHI+   G+++  + L+E GA  ++ ++ GFTPL++ ++   ++V KLLL   A    A  +G TPL VA    ++KV  +LL+  +      +     LHIAAKK+ +  A +LL   A  +  +  G TPLH+A+  G+ ++A LL+ +G  +N   K+ +T LH++ +   +AV E LV  GA L+ +T+ G TPL  A   G   + +FLL++G++ +AKT+NG T LH A+Q                                  G+  + N+L++   + NA  +NG T L IA +   + VV+ L
Sbjct:  449 SPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQ---------------------------------GNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 1433.31 bits (3709), Expect = 0.000e+0
Identity = 769/1617 (47.56%), Postives = 1057/1617 (65.37%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFW--KDSTFTKDQYIAQ-TKLGHEYAVASPVADWDYAP-DNVPITRKPVTSG-----------FLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSE-DNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSR-------EGTTEASFDVDSQSEFQVLSDEYEQRNQGETLPINTDQD 4881
            DS  SFLRAAR+GN+ K++++L  G DI+T N NGLNALH+A+KEG +D+V+ LL + A V+S+TKKGNT+LHI+ LAG+ +VV  L++ GA +N QSQNGFTPLYMAAQENH++VV+ LL N  +Q+ AT+DGFTPLA+ALQQGH +VV+ILLEND++G++RLPALHIAA+KDD K+A LLL ND N D QS SGFTPLHIAAHYGNVN+A LL+ RG  V+F A+N ITPLHV++K GN  +   L+++G+Q++ KTRDGLTPLHCA RSG+E     LL+ G+   A+T+NGL+ LHMA+QGDH+EC + L+ +   ++D TLDYLT LHVAAHCGH R+  LL++     NARALNGFTPLHIACKKNRVKV+ELL+K GASI+A TESGL+P+HVAAFMGH NI L+L+QNGA+P++  IR ETSLH+A RA Q E+++ LL+NG++VDARA+E QTPLHIA+RLG  +I+++LLQH A+P+  T + Y+ LHI+A+E  ++ A VL+EAGA   L T+KGFT LH+ +KYG + +A LLLQ     +  G+NGLTPLH+A HY +  + +LL++  ASP  T+KNGYTPLHIAA+KN ++IA  L++  A  N+ ++ G TPLHL SQEGH  MA  L+   A  N   K+ L+++HLAAQED+V VAE+L+  G  +D +TK GYTPL  ACH+G   M+ FL+++  ++NA+T  G T LH AAQQG+  +I  LL   A PN       TA  +ARR  Y+++ + L+ V   V         V  K +L+ PE M E  V D  D+ GD   T      L   +       G ++L      G+   H +L   ++         DS   +F+  HH ++  +     +D    Q + L  +    S    W     DNV ++  PV SG           FLVSF+VDARGG+MRG RH GLRI++PP   SAPTR+TCR++K  R+   P + +GEGLA R++E+GP   +F  PV++E+PHFASLRGR+RE+VILR + GE+WKEH  E + Q  ++ +     ++ +T E L+ KRI RI+T +FP YFA V+R++Q+  +IG +GG++SS+V+ QVQAVFPEGAL KRI+VGLQA  +   +V K+LGN+   SPIVT+EPRRRKFHKPIT+TIP+P + +  ++N   G    LRLLCSI+GGT PAQWEDITG+TPL+ +  CVSFTT VSARFWL+DC+   E      ++Y+E I VPYM KFVIFAKT +  E  LRCFC+TDDKIDKTLE QE F   A S +VEVL+ +  + +  GN++P+TK G      F AFKENRL    +++D + E   G+++FM++PRN           +++ Q  +C L I L +        + +S         +LD +     EEA+              K +  L  +A  +G  W  LA++LG +   IN +++E  N   ++S  LL  W++ + +H      L + L +I R D+V        R T+ED  +    ++ +       EG +    D+DS    +           G+ +P+ + +D
Sbjct:   46 DSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLRVVTEEVV---TTTTTVTEKHKLNVPETMTE--VLDVSDEEGDDTMTGDGGEYLRPEDLRE---LGDDSLPGQYLDGMNYLHFSLEGGRT---------DSAERSFTPTHHGYYSPRHEGVLEDVLSQQLSSLARDNERDSYRLSWCADNLDNVALSSSPVHSGRCSPCHGDHSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCSAPTRITCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFASLRGRERELVILRSETGESWKEHHCEHT-QEELNQILNGMDEDLDTPEELERKRICRIITRDFPQYFAAVSRIKQDSHLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQPVSVNVVRKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPGSNSDPVLNGFGGYTPTLRLLCSITGGTTPAQWEDITGTTPLTFINDCVSFTTNVSARFWLIDCRQVQESINFSTQVYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFYAFKENRLALFIKIRDNTQE-PCGRLSFMKEPRNY----------RALTQNAICNLNITLPS-------YSKVSRTLE-----KLDPQ-----EEAE--------------KREQRLAVIADHLGFSWTELARDLGFSEEKINTIRNENPNSLLDQSHALLNQWAQREAQHATAEATLVKQLTKINRMDIVHLIETGLNRSTQEDTSSHTYAEIEQTIALDHSEGFSALHEDIDSPRPRRHKETASRSPVSGQQVPVVSAED 1602          

HSP 2 Score: 189.119 bits (479), Expect = 1.672e-47
Identity = 125/391 (31.97%), Postives = 201/391 (51.41%), Query Frame = 1
Query:   88 SSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSR----GRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELL 1248
            S  V+ +    S   AAR+G  + +   L NG  +          LHIAS+ G  +IV++LL   A  ++AT  G T LHI+   G+++  + L+E GA  ++ ++ GFTPL++ ++   ++V KLLL   A    A  +G TPL VA    ++KV  +LL+  +      +     LHIAAKK+ +  A +LL   A  +  +  G TPLH+A+  G+ ++A LL+ +G  +N   K+ +T LH++ +   +AV E LV  GA L+ +T+ G TPL  A   G   + +FLL++G++ +AKT+NG T LH A+Q                                  G+  + N+L++   + NA  +NG T L IA +   + VV+ L
Sbjct:  464 SPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQ---------------------------------GNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 418/781 (53.52%), Postives = 569/781 (72.86%), Query Frame = 1
Query:  103 KMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKV 2445
            + D+  SFLRAARSGN+ K +D + NG +I  AN NGLN LH+ASKEG V +V  LL    ++ + TKKGNT+LHIA LAG+  VV  L+ +GA VN QS  GF+PLYMAAQENH+EVVK LL N A+Q+L T+DGFTPLAVALQQGHE VVA+L+   ++G++RLPALHIAA+ DD + A +LL ND N D  S +GFTPLHIAAHY N+++A LL+ RG +VNF  KN ITPLH++++ GN+ +   L+++GAQ++ +T+D LTPLHCA R+G+  I   LL+ G+   AKT+NGL+ +HMA+QGDH++C + L+ Y   ++D TLD+LTPLHVAAHCGH RMA +L++   + NARALNGFTPLHIACKKN ++ ++LLLK  AS+EA TESGL+PLHVAAFMGH NI   L+Q GA+PN   ++ ET LH+A+RA   E+ + LL+N + VDARAK+ QTPLH AAR+G+ +++K+LL H+ANP++ T   ++ LHIAA+E H+   R+L++AGA+    T+KGFT LH+A+KYGKV +A LLL+ G + N  G+NGLTPLH+AVH++++ +  LL+    S   T++NGYTPLHIAA++N +E+A  L++N A+PN ES  G TPLHL SQEG   M   LI  +A+ N   KN L+ +HL AQE  VG+A+ L+  G  + + ++ GYTPLH ACH+G I M+ FL++   ++NA+T  G T LH AAQQGH  ++  LL   A PN   S   +   +A+R  Y+++ +VLK V
Sbjct:    7 QADAATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLV 787          

HSP 2 Score: 484.952 bits (1247), Expect = 8.668e-142
Identity = 259/610 (42.46%), Postives = 363/610 (59.51%), Query Frame = 1
Query: 2878 DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGE--LTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLR-LHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKS 4695
            DNV     P+ +GFLVSF+VDARGGSMRGSRH GLR+++PP   +APTR+TCR++K  ++  PP L +GEGLA RI+ +GP   +F  PV++E+PHFASL   DRE+V+LR +NG  WKEH     D+ V++ +     ++ E+ E L++KRI RI++ +FP+YFA+V+R++QE  +IG +GG ++S ++  V+A+FPE A+ KR+++GLQA  I  EL+ + LGN+   SP+VTIEPRRRKFH+PI + IPLP +  +   + GE   T+LRLLCS+ GGT PAQWEDITG+T L     C SFTT VSARFWL DC    E       LYKE + +PYM KFVIFAK  E  E  LRC+C+TDDK+DKTLE  E F   A S ++E+++     LE +GN++P+ K   Q R   F AF++NRLP   +++D + E + G ++F+   R C  Y   ++         LC L I +      C  +A                     SEE ++              + L L E    +      LA+EL    + IN+++ E  N   ++S  LL  W+      A    L  ALR I R D+V S
Sbjct:  884 DNVSPVASPIHTGFLVSFMVDARGGSMRGSRHHGLRVIIPPRTCAAPTRITCRLVKPQKLTTPPPLVEGEGLASRIISLGPSSMQFLGPVIVEIPHFASLGRGDRELVVLRSENGSVWKEHRNRYGDE-VLETILNGMDEDLESQEELEKKRIRRIISTDFPLYFAVVSRIQQESDLIGPEGGRLTSKLVPHVEAIFPESAVTKRVRLGLQAQPIPDELLTRQLGNQATFSPVVTIEPRRRKFHRPIGLRIPLPPSWRESPRDAGEGDTTSLRLLCSVIGGTAPAQWEDITGTTKLMYAHNCASFTTNVSARFWLADCPRTAEAVTFANLLYKELMAIPYMAKFVIFAKMNEAREGRLRCYCMTDDKMDKTLELHENFSEVARSRDIELMEGMPLHLECSGNLVPIRKATQQPRSFSFQAFRDNRLPVSVKVRDSNKEAT-GFLSFL---RKCTKYEDAQHV--------LCNLNITMP----PCVKVAG--------------------SEERRRTL------------TPLALRERYSALNDPAAELARELQFGVDDINRIRVENPNSLLDQSSTLLNLWASREGKKAKMESLYTALRNIDRADIVAS 1444          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 360/729 (49.38%), Postives = 497/729 (68.18%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLH 2295
            D+G SFLRAARSGN+ K ++ + NG DI TAN NGLNALH+ASKEG V +V  LL     + + TKKGNT+LHIA LAG+  VV  L+ +G  VN QSQ GFTPLYMAAQENH+EVVK LL N A+Q++ T+DGFTPLAVALQQGHE VVA+L+   ++G++RLPAL              L          S +GFTPLHIAAHY N+N+A LL+ RG      A + +TPLH + + G+  + E L++ GA ++ KT++GL+P+H                                 MA+QGDH++C + L+ Y   ++D TLD+LTPLHVAAHCGH RMA +L++   + N+RALNGFTPLHIACKKN ++V++LLLK  ASIEA TESGL+PLHVA+FMGH NI  +L+Q GA+P+   ++ ET LH+A+R+   E+ + LL+N + VDA+AK+ QTPLH AAR+G+ +++K+LL+H+ANPN+ T   +S LHIAA+E HV   R+L++  A+    T+KGFT LH+A+KYGKV +A LLL+ G + N  G+NGLTPLH+AVH++++ +  LL+    SP   ++NGYT LHIAA++N +E+A+ L+++ A+ N+ES  G TPLHL SQEG   +   LI  +A+ N   K+ L+ +HL AQE  VG+A++L+  G  + + T+ GYTPLH ACH+G I M+ FL++   N+N++T       H
Sbjct:    6 DAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPAL--------TDFCFFL----------SVTGFTPLHIAAHYENLNVAQLLLNRG------ANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIH---------------------------------MAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCH 677          

HSP 2 Score: 497.664 bits (1280), Expect = 2.709e-146
Identity = 264/608 (43.42%), Postives = 370/608 (60.86%), Query Frame = 1
Query: 2878 DNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGE--LTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLR-LHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINE-EEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVV 4689
            DNV     P+ +GFLVSF+VDARGGSMRGSRH GLR+++PP   +APTR+TCR++K  ++  PP L +GEGLA RI+ +GP   +F  PV++E+PHFA+L   DRE+V+LR +NG  WKEH     D+ V++ +     +  E+ E L +KRI RI++ +FP+YFA+V+R++QE  +IG +GG ++S ++  VQA FPE A+ KR+++GLQA  +  ELVAKLLGN+   SP+VT+EPRRRKFH+PI + IPLP +      + GE   T+LRLLCS+ GGT  AQWEDITG+T L     C SFTT VSARFWL DC    E       LY+E   VPYM KFV+FAK  E  E  LRC+C+TDDK+DKTLE  E F   A S ++EV++     LE +GN++PV K   Q R   F AF++NRLP   +++D S E + G ++F+R           +Y      Q  LC L I +      C  M    +       + L  +   L+E A         S   + +++L +  +A+++G  W  LA+EL ++ + INK++ E  N   E+S  LL  W+      A    L  AL+ I R D++
Sbjct:  806 DNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCRLVKPQKLTSPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFAALGRGDRELVVLRSENGSVWKEHRNRYGDE-VLETILNGMDEELESQEELGKKRIRRIISTDFPLYFAVVSRVQQESDLIGPEGGSLTSKLVPMVQATFPETAVTKRVRLGLQAQPVPDELVAKLLGNQANFSPVVTVEPRRRKFHRPIGLRIPLPPSWRDSPRDSGEGDTTSLRLLCSVIGGTASAQWEDITGTTKLIYANDCASFTTNVSARFWLADCPRTAEAVSFANLLYRELSAVPYMAKFVVFAKMNELREGRLRCYCMTDDKMDKTLEQHENFAEVARSRDIEVMEGMPLHLECSGNLLPVRKATQQPRCFSFQAFRDNRLPVTVKVRDSSKEPT-GFLSFLRK--------STKYEDS---QHVLCNLNITMP----PCITMRGSEDRRRTLTPLALRERYNALNEPAMA-------SMSAMERTELKMAVIAEQLGLSWAELARELQLSVDDINKIRVENPNSLLEQSSALLNLWATREGKRAKMESLYTALKSIDRMDII 1389          

HSP 3 Score: 348.591 bits (893), Expect = 7.479e-97
Identity = 207/620 (33.39%), Postives = 337/620 (54.35%), Query Frame = 1
Query:  598 LPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAK-----------TRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNI 2424
            L ALH+A+K+  VK    LL N   ++  +  G T LHIAA  G   +   L+  G +VN Q++   TPL+++ +  +L V + L+E GA     T DG TPL  A++ G+EN+ A L+  G+    +           +  G T LH+A+  +++   QLL+N G N   T L      H AA  GH R+  +L++    I A+  NG +P+H+A + + +  V+ LL+  A I+  T   L+PLHVAA  GH  +A VL+  GA PN + +   T LH+A + N   ++ +LLK+ + ++A  +   TPLH+A+ +G+++I+KILLQ  A+P+       + LH+A++  H + A  L++  A ++   +   T LH AA+ G   L  LLL+   + N     G +PLH+A     +    LL++ +A   K +K G+TPLH+A++   +++A+ L+E  ANPN+  +NG TPLH+     +  +   L+      ++ A+N  +++H+AA++++V VA  LL  G   ++++  G TPLH A   G+ +++  LI    N+N     G T LHL AQ+GH+ +   L+ + A          T  HVA   HY NI
Sbjct:   41 LNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPL------HCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVA--CHYGNI 652          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 538.88 bits (1387), Expect = 4.406e-175
Identity = 267/421 (63.42%), Postives = 342/421 (81.24%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPN 1371
            DS  S+LRAAR+GN++K++D+L +G +I   N NGLNALH+ASKEG V++V  LL   A V++ATKKGNT+LHI+ LAG+ +VV  L+ +GA VN QSQNGFTPLYMAAQENH+EVV+ LL NSASQ++AT+DGFTPLAVALQQGH++VV++LLEND++G++RLPALHIAA+KDD KAA LLL ND N D +S SGFTPLHIAAHYGN+N+A LL+ R   V+F A+N+ITPLHV+ K GN  + + L+++GA++E KT+DGLTPLHC  RSG+E +   LL  G+   +KT+NGL+ LHMA+QGDH+ C QLL+ +   ++D T DYLT LHVAAHCGH ++A L+++     NA+ALNGFTPLHIACKKNRV+V+ELLLK GASI+A TESGL+P+HVAAFMGH NI   LI +GA+PN
Sbjct:   16 DSNASYLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPN 436          

HSP 2 Score: 231.106 bits (588), Expect = 1.791e-65
Identity = 137/420 (32.62%), Postives = 230/420 (54.76%), Query Frame = 1
Query: 1111 AAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRN 2370
            AA  G++      ++   EIN    NG   LH+A K+  V+VV  LLK GAS++A T+ G + LH+++  G   +   L+ NGAN N Q+    T L++A + N  E+++ LL+N +      ++  TPL +A + G+  ++ +LL++        K     LHIAA++D   AA +L++     ++ ++ GFT LHIAA YG + +ATLLL      +   RN +TPLH+A    +  M  LL++  A     +K+G TPLH  AR    ++ + L++  A   S+++NG +PLH+ +Q  H    + L+  +   +    + L+++H+AA      VA++++      ++K   G+TPLH AC   ++ ++  L+KH  +I A T  G T +H+AA  GH  ++ AL++  A PN  N
Sbjct:   24 AARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK----GKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPNTTN 439          

HSP 3 Score: 218.009 bits (554), Expect = 5.990e-61
Identity = 145/460 (31.52%), Postives = 237/460 (51.52%), Query Frame = 1
Query:  913 AVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGY-TPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTS 2289
            A R+G        LKSG   +   +NGL +LH+AS+  H+E    L+  G +++  T    T LH+++  G   +   L+     +NA++ NGFTPL++A ++N ++VV  LL+  AS    TE G +PL VA   GH  +  +L++N     ++      +LH+A R +  +   +LL+N    D  +K   TPLHIAA  GNI++  +LL   A  + + +++ + LH+AAK  + +  ++L++ GA++E  T+ G T LH  A+ G   +  +LL  G     + +NGL+PLH+A     +    LL++    P     N Y T LH+AA     ++A  +++ +ANPN+++ NGFTPL                                 H+A ++++V V E+LL  G  I + T++G TP+H A   G  N++  LI H  + N  TN  S S
Sbjct:   24 AARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDV-PVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPL---------------------------------HIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPNT-TNVVSCS 444          

HSP 4 Score: 203.371 bits (516), Expect = 5.785e-56
Identity = 129/389 (33.16%), Postives = 215/389 (55.27%), Query Frame = 1
Query: 1276 TTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKK 2442
            T++S  S L  AA  G+    L  +++G   N+       +LHLA++    E++  LLK G+ VDA  K+  T LHI++  G  +++  L+ + AN N  +++ ++ L++AA+E+H++  R L+E  A   + T  GFT L +A + G   + +LLL+    ++ +G+  L  LH+A          LL++   +    SK+G+TPLHIAA    + +A  L+   A  +  +RN  TPLH+ ++ G+  M K L+D  A   AK K+ L+ +H  A+     V E+LL  G  I SKTK G +PLH A     +N +  L++H+  ++  TN   T+LH+AA  GH +V   ++DKKA+PN +     T  H+A +++ + + E+L K
Sbjct:   14 TSDSNASYLR-AARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLE----NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLK 397          

HSP 5 Score: 192.971 bits (489), Expect = 2.008e-52
Identity = 123/395 (31.14%), Postives = 207/395 (52.41%), Query Frame = 1
Query:  691 SGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTS 1875
            +G   LH+A+  G+V +   L++ G  V+   K   T LH+S+  G   V   LV  GA +  ++++G TPL+ A +  +  +  FLL++ ++ S  T +G T L +A Q  H +   LL+      +      L  LH+AA     + A LL++     +  + +GFTPLHIA     + V  LLL   A+++    + ++PLHVAA  G++N+  +L+  GA    +T    T LH   R+  E++++ILL  G+ + ++ K   +PLH+A +  +++ +++LLQH    +++T D  + LH+AA   H   A+++++  A        GFT LHIA K  +V +  LLL+ G        +GLTP+H+A       +   LI   ASP  T+
Sbjct:   49 NGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLE----NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPNTTN 439          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000040152.1 (SMESG000040152.1)

HSP 1 Score: 3536.5 bits (9169), Expect = 0.000e+0
Identity = 1740/1742 (99.89%), Postives = 1741/1742 (99.94%), Query Frame = 1
Query:   37 MTLKEDTDQNKDKSSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEYEQRNQGETLPINTDQDKMEPFDIPDTDIVRESESMTTSDFDDHEEIQNKEITNVPXXXXXXXXXXXXQFDELQQSIEPIKADENCGDQNEALLKCDSSEQENEPTNEFEDFQEAIQMETDSIRPITEGSKHIQSETPSDLLEQ 5262
            MTLKEDTDQNKDKSSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGTNLNDTTLDYLTPLHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWEEEEEEVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRN QGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEYEQRNQGETLPINTDQDKMEPFDIPDTDIVRESESMTTSDFDDHEEIQNKEITNVPIDDNHIDLDLINQFDELQQSIEPIKADENCGDQNEALLKCDSS+QENEPTNEFEDFQEAIQMETDSIRPITEGSKHIQSETPSDLLEQ
Sbjct:    1 MTLKEDTDQNKDKSSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGTNLNDTTLDYLTPLHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWEEEEEEVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIPASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGEDSIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNFQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEYEQRNQGETLPINTDQDKMEPFDIPDTDIVRESESMTTSDFDDHEEIQNKEITNVPIDDNHIDLDLINQFDELQQSIEPIKADENCGDQNEALLKCDSSKQENEPTNEFEDFQEAIQMETDSIRPITEGSKHIQSETPSDLLEQ 1742          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000040152.1 (SMESG000040152.1)

HSP 1 Score: 1588.93 bits (4113), Expect = 0.000e+0
Identity = 780/782 (99.74%), Postives = 781/782 (99.87%), Query Frame = 1
Query: 2917 FLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEYEQRNQGETLPINTDQDKMEPFDIPDTDIVRESESMTTSDFDDHEEIQNKEITNVPXXXXXXXXXXXXQFDELQQSIEPIKADENCGDQNEALLKCDSSEQENEPTNEFEDFQEAIQMETDSIRPITEGSKHIQSETPSDLLEQ 5262
            FLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRN QGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEYEQRNQGETLPINTDQDKMEPFDIPDTDIVRESESMTTSDFDDHEEIQNKEITNVPIDDNHIDLDLINQFDELQQSIEPIKADENCGDQNEALLKCDSS+QENEPTNEFEDFQEAIQMETDSIRPITEGSKHIQSETPSDLLEQ
Sbjct:   12 FLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMINQGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNFQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTNNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEYEQRNQGETLPINTDQDKMEPFDIPDTDIVRESESMTTSDFDDHEEIQNKEITNVPIDDNHIDLDLINQFDELQQSIEPIKADENCGDQNEALLKCDSSKQENEPTNEFEDFQEAIQMETDSIRPITEGSKHIQSETPSDLLEQ 793          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 478/819 (58.36%), Postives = 627/819 (76.56%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLL-TNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIK--HNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDD 2556
            +S  SFLRAAR+GN+ K+IDFL+ G DI T N  GL+ALH+A+KEG + IVK L+ +   +++ TKKGN++LHIA LAGK +VV  L+E+GA VN+QS NGFTPLYMAAQENH+EVV  L+ N A QT+ T+DGFTPLAVALQQGHE++VA+LLEND+R + RLPALHIA KK+DV A NLLL +++ +V+HQS+SGFTPLHIAAHYGN   A LLIE+  DVNFQAKNNITPLHV+ KWG   + + L++ GA + C+TRDGLTPLHC+ RSG+  +   L+ +G++  +KTRNGLTSLHMA+QGD  +  ++L+    N+N+TT D+LTPLHV AH G+ ++A +L++  C+ NARALNGFTPLHIACKK+++K+VELLLK GA IEATTE+GL+PLHV+AF+G      +L+Q GAN    T+R ET+LHLATR NQ E +K+LLK G++ DA+A+E QTPLH+A ++GN+++I + LQ  ++PN  T+DNY+ LH+AAKE   +A  +L+++GAK+E  T++GFT LHIAAKY KV +A++LLQ   + N  G+NGLTPLH+A HY+   +  LL++ +A P   +KNGYTPLHIAA+KN  ++A  L+ + A+ N+ESRNGF+PL L SQEGH  +   L+  +AD N KAKN L+SMHL AQEDKV VA +L+ AG +I   T A YTPLHTA HFGQINM  +LI       IN +T  G T LHLAAQQGHLQ++  LL+ +ADPNI+N+Q  TAAH+AR+QHYLNIFEVL+KV T V  WE EEEE    + L++PE MGE+ V+DSED+
Sbjct:   10 ESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDE 828          

HSP 2 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 342/680 (50.29%), Postives = 454/680 (66.76%), Query Frame = 1
Query: 2857 ADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQK------DWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTN-----NFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNR-----AKHQMSREGTTEASFDVDSQSEFQVLSDEYEQR 4842
            +DWD+ P+NVPI RKPV+SGFLVSF+VDARGG M+  R   LR  VPPS+A  PTR+ CR+IK  ++  PP LNDG+G ACRI+EMGP   +FNSP+L+EVPH+ASLR R+REI+ILR +NGE WKEH +E +DQA+ +++G SF +   T+E ++  RI RILT++ P YFA+++R+RQE+++IG +G V+SSSV+ QVQAVFPEGAL K+ +VG+QAH I  E+V +LLGNR+A SPI++IEPRRRKFHKPIT+T+PLP+  NKGMIN      ++LRLLCSI+GG+ PA WEDI+GSTPLS  K CVSFTTTVSAR WL+DC N    AEM   +Y+E+ +VPYMG+FV++ +  + EE   R   +TDD +DKTLECQE F+L A+ P VEVL +R +W+ETAGN++PVTK GDQL +   A  ENR+ F  R+KD   E   GK+A +   RN QG       G S  QKP+ TLEI        C                 L S+  P+S+  ++      ++I  +  +D IAKS+LDL  VA ++G DW  LA  LG+++     N  N    EY      +  LLI W      +  GNEL++ALR IGREDVVK+CM N   VT+EDE+++     AKH+ +    T+ +  VD     +V  D   QR
Sbjct: 1015 SDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSF-ERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPK-GKLAILLHQRN-QGMGAGNALGTSAVQKPITTLEI--------C-----------------LPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEY-----SAYALLILWRSKRGDLVCGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQR 1661          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 478/819 (58.36%), Postives = 627/819 (76.56%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLL-TNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIK--HNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDD 2556
            +S  SFLRAAR+GN+ K+IDFL+ G DI T N  GL+ALH+A+KEG + IVK L+ +   +++ TKKGN++LHIA LAGK +VV  L+E+GA VN+QS NGFTPLYMAAQENH+EVV  L+ N A QT+ T+DGFTPLAVALQQGHE++VA+LLEND+R + RLPALHIA KK+DV A NLLL +++ +V+HQS+SGFTPLHIAAHYGN   A LLIE+  DVNFQAKNNITPLHV+ KWG   + + L++ GA + C+TRDGLTPLHC+ RSG+  +   L+ +G++  +KTRNGLTSLHMA+QGD  +  ++L+    N+N+TT D+LTPLHV AH G+ ++A +L++  C+ NARALNGFTPLHIACKK+++K+VELLLK GA IEATTE+GL+PLHV+AF+G      +L+Q GAN    T+R ET+LHLATR NQ E +K+LLK G++ DA+A+E QTPLH+A ++GN+++I + LQ  ++PN  T+DNY+ LH+AAKE   +A  +L+++GAK+E  T++GFT LHIAAKY KV +A++LLQ   + N  G+NGLTPLH+A HY+   +  LL++ +A P   +KNGYTPLHIAA+KN  ++A  L+ + A+ N+ESRNGF+PL L SQEGH  +   L+  +AD N KAKN L+SMHL AQEDKV VA +L+ AG +I   T A YTPLHTA HFGQINM  +LI       IN +T  G T LHLAAQQGHLQ++  LL+ +ADPNI+N+Q  TAAH+AR+QHYLNIFEVL+KV T V  WE EEEE    + L++PE MGE+ V+DSED+
Sbjct:   10 ESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDE 828          

HSP 2 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 342/680 (50.29%), Postives = 454/680 (66.76%), Query Frame = 1
Query: 2857 ADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQK------DWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTN-----NFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNR-----AKHQMSREGTTEASFDVDSQSEFQVLSDEYEQR 4842
            +DWD+ P+NVPI RKPV+SGFLVSF+VDARGG M+  R   LR  VPPS+A  PTR+ CR+IK  ++  PP LNDG+G ACRI+EMGP   +FNSP+L+EVPH+ASLR R+REI+ILR +NGE WKEH +E +DQA+ +++G SF +   T+E ++  RI RILT++ P YFA+++R+RQE+++IG +G V+SSSV+ QVQAVFPEGAL K+ +VG+QAH I  E+V +LLGNR+A SPI++IEPRRRKFHKPIT+T+PLP+  NKGMIN      ++LRLLCSI+GG+ PA WEDI+GSTPLS  K CVSFTTTVSAR WL+DC N    AEM   +Y+E+ +VPYMG+FV++ +  + EE   R   +TDD +DKTLECQE F+L A+ P VEVL +R +W+ETAGN++PVTK GDQL +   A  ENR+ F  R+KD   E   GK+A +   RN QG       G S  QKP+ TLEI        C                 L S+  P+S+  ++      ++I  +  +D IAKS+LDL  VA ++G DW  LA  LG+++     N  N    EY      +  LLI W      +  GNEL++ALR IGREDVVK+CM N   VT+EDE+++     AKH+ +    T+ +  VD     +V  D   QR
Sbjct: 1015 SDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSF-ERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPK-GKLAILLHQRN-QGMGAGNALGTSAVQKPITTLEI--------C-----------------LPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEY-----SAYALLILWRSKRGDLVCGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQR 1661          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 478/819 (58.36%), Postives = 627/819 (76.56%), Query Frame = 1
Query:  109 DSGQSFLRAARSGNVQKIIDFLDNGGDIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIACLAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSASQTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDVKAANLLL-TNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQAKNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYENITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGXXXXXXXXXXXXXXHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKVVELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIRCETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDIIKILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKGFTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTVLLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGFTPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEVLLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIK--HNCNINAQTNFGSTSLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVLKKVVTCVTRWXXXXXXVVFKMELDRPEVMGENPVTDSEDD 2556
            +S  SFLRAAR+GN+ K+IDFL+ G DI T N  GL+ALH+A+KEG + IVK L+ +   +++ TKKGN++LHIA LAGK +VV  L+E+GA VN+QS NGFTPLYMAAQENH+EVV  L+ N A QT+ T+DGFTPLAVALQQGHE++VA+LLEND+R + RLPALHIA KK+DV A NLLL +++ +V+HQS+SGFTPLHIAAHYGN   A LLIE+  DVNFQAKNNITPLHV+ KWG   + + L++ GA + C+TRDGLTPLHC+ RSG+  +   L+ +G++  +KTRNGLTSLHMA+QGD  +  ++L+    N+N+TT D+LTPLHV AH G+ ++A +L++  C+ NARALNGFTPLHIACKK+++K+VELLLK GA IEATTE+GL+PLHV+AF+G      +L+Q GAN    T+R ET+LHLATR NQ E +K+LLK G++ DA+A+E QTPLH+A ++GN+++I + LQ  ++PN  T+DNY+ LH+AAKE   +A  +L+++GAK+E  T++GFT LHIAAKY KV +A++LLQ   + N  G+NGLTPLH+A HY+   +  LL++ +A P   +KNGYTPLHIAA+KN  ++A  L+ + A+ N+ESRNGF+PL L SQEGH  +   L+  +AD N KAKN L+SMHL AQEDKV VA +L+ AG +I   T A YTPLHTA HFGQINM  +LI       IN +T  G T LHLAAQQGHLQ++  LL+ +ADPNI+N+Q  TAAH+AR+QHYLNIFEVL+KV T V  WE EEEE    + L++PE MGE+ V+DSED+
Sbjct:   10 ESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDE 828          

HSP 2 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 342/680 (50.29%), Postives = 454/680 (66.76%), Query Frame = 1
Query: 2857 ADWDYAPDNVPITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCRMIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGRDREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRIVRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQKRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPLPQAANKGMIN--QGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSFTTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEEVLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIPVTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGYAGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSKGRPLSEEAQK------DWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMTN-----NFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDVVKSCMKNFQRVTEEDEQNR-----AKHQMSREGTTEASFDVDSQSEFQVLSDEYEQR 4842
            +DWD+ P+NVPI RKPV+SGFLVSF+VDARGG M+  R   LR  VPPS+A  PTR+ CR+IK  ++  PP LNDG+G ACRI+EMGP   +FNSP+L+EVPH+ASLR R+REI+ILR +NGE WKEH +E +DQA+ +++G SF +   T+E ++  RI RILT++ P YFA+++R+RQE+++IG +G V+SSSV+ QVQAVFPEGAL K+ +VG+QAH I  E+V +LLGNR+A SPI++IEPRRRKFHKPIT+T+PLP+  NKGMIN      ++LRLLCSI+GG+ PA WEDI+GSTPLS  K CVSFTTTVSAR WL+DC N    AEM   +Y+E+ +VPYMG+FV++ +  + EE   R   +TDD +DKTLECQE F+L A+ P VEVL +R +W+ETAGN++PVTK GDQL +   A  ENR+ F  R+KD   E   GK+A +   RN QG       G S  QKP+ TLEI        C                 L S+  P+S+  ++      ++I  +  +D IAKS+LDL  VA ++G DW  LA  LG+++     N  N    EY      +  LLI W      +  GNEL++ALR IGREDVVK+CM N   VT+EDE+++     AKH+ +    T+ +  VD     +V  D   QR
Sbjct: 1064 SDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSF-ERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPK-GKLAILLHQRN-QGMGAGNALGTSAVQKPITTLEI--------C-----------------LPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEY-----SAYALLILWRSKRGDLVCGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQR 1710          
The following BLAST results are available for this feature:
BLAST of Ankyrin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK20.000e+048.09ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK20.000e+048.84ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK20.000e+048.84ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK20.000e+048.84ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK20.000e+048.02ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Ankyrin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.253e-16855.91AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.253e-16855.91AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-446.890e-17455.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-446.890e-17455.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.892e-17255.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Ankyrin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank20.000e+050.25gene:FBgn0261788 transcript:FBtr0303121[more]
Ank28.163e-9050.38gene:FBgn0261788 transcript:FBtr0303115[more]
Ank23.958e-7350.25gene:FBgn0261788 transcript:FBtr0303112[more]
Ank29.678e-9050.38gene:FBgn0261788 transcript:FBtr0303124[more]
Ank20.000e+051.33gene:FBgn0261788 transcript:FBtr0303113[more]
back to top
BLAST of Ankyrin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank2b0.000e+046.94ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
ank2b3.556e-7151.06ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
ank3a0.000e+047.15ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a0.000e+047.15ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
BX469921.10.000e+046.74ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
back to top
BLAST of Ankyrin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm40.000e+048.93tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm40.000e+048.93tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm40.000e+048.93tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm40.000e+048.56tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm40.000e+048.16tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of Ankyrin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank30.000e+048.31ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank30.000e+048.67ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank30.000e+048.31ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank30.000e+048.13ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank30.000e+048.67ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of Ankyrin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C8R3|ANK2_MOUSE0.000e+051.86Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
sp|G5E8K5|ANK3_MOUSE0.000e+047.48Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q01484|ANK2_HUMAN0.000e+050.82Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
sp|Q12955|ANK3_HUMAN0.000e+050.53Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|O70511|ANK3_RAT0.000e+049.38Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
back to top
BLAST of Ankyrin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CVV70.000e+054.74Ankyrin-2 isoform 1 OS=Schistosoma japonicum OX=61... [more]
A0A4Z2CW110.000e+054.75Ankyrin-2 isoform 2 OS=Schistosoma japonicum OX=61... [more]
A0A4S2L9R70.000e+056.53Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K4ERA42.136e-4054.21Putative ankyrin 2,3/unc44 OS=Schistosoma mansoni ... [more]
A0A4E0RF100.000e+056.41Ankyrin-2 OS=Fasciola hepatica OX=6192 GN=D915_002... [more]
back to top
BLAST of Ankyrin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b2.362e-8848.59ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a0.000e+046.68ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.193e-4247.15ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a3.225e-8948.94ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank1b4.288e-8947.83ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.11.410e-4254.49pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.10.000e+053.40pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007446.11.668e-8546.83pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.14.125e-7147.11pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000006531.12.305e-11749.06pep scaffold:Pmarinus_7.0:GL477280:1359:33855:1 ge... [more]
back to top
BLAST of Ankyrin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HOS46.923e-1627.41Subunit of the Set3 complex; complex is a meiotic-... [more]
NAS61.910e-1427.93Evolutionarily conserved 19S regulatory particle a... [more]
AKR11.816e-1330.77Palmitoyl transferase involved in protein palmitoy... [more]
AVO22.463e-926.52Component of a complex containing the Tor2p kinase... [more]
AKR23.600e-928.19Ankyrin repeat-containing protein; member of a fam... [more]
back to top
BLAST of Ankyrin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454876.130e-9441.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454869.220e-5641.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436903.731e-2932.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387022.678e-2525.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375203.524e-2326.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039458.15.752e-7047.56ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.11.672e-4747.56ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1b8.668e-14253.52ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a2.709e-14649.38ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000039903.14.406e-17563.42pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
back to top
BLAST of Ankyrin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040152.10.000e+099.89SMESG000040152.1[more]
SMESG000040152.10.000e+099.74SMESG000040152.1[more]
SMESG000000606.10.000e+058.36SMESG000000606.1[more]
SMESG000000606.10.000e+058.36SMESG000000606.1[more]
SMESG000000606.10.000e+058.36SMESG000000606.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023391 ID=SMED30023391|Name=Ankyrin|organism=Schmidtea mediterranea sexual|type=transcript|length=5562bp
TTTAAATAAGTCAATATATTTACAAACATTTTGGATATGACTTTAAAAGA
AGACACAGATCAAAATAAAGATAAATCATCTGATTTATCATCTCCAGTCA
CAAAGATGGATAGTGGTCAGAGTTTTCTGCGAGCTGCTCGATCAGGAAAT
GTTCAGAAAATCATAGATTTCCTCGATAATGGAGGAGATATAGCCACTGC
CAATGCCAATGGACTGAATGCTTTGCATATCGCATCGAAGGAGGGATTGG
TAGATATTGTCAAAATACTATTGACCAAAAATGCAGACGTAAATTCTGCA
ACGAAAAAAGGAAATACTTCTCTTCATATTGCTTGTTTGGCCGGGAAAGT
CGATGTCGTGAATTTCCTAATTGAGCACGGTGCAAAAGTAAATGTACAAT
CTCAGAACGGATTTACTCCGTTATACATGGCTGCTCAAGAAAATCACGTA
GAAGTTGTCAAATTGCTACTGCTTAATTCGGCCAGTCAAACGTTAGCAAC
TGATGATGGGTTCACACCATTAGCCGTAGCTCTTCAACAAGGACATGAAA
AGGTTGTAGCTATTCTTTTAGAAAACGATTCAAGAGGTCGAATACGCTTA
CCAGCTTTGCATATTGCGGCAAAAAAAGACGACGTAAAAGCCGCCAACTT
ACTGTTGACCAATGATGCCAATGTCGACCATCAATCTGCCAGTGGATTTA
CACCGTTACATATTGCAGCTCATTATGGAAATGTTAATATAGCTAATTTA
TTAATCGAACGAGGAGGAGATGTGAATTTCCAGGCAAAAAATAATATAAC
TCCACTTCATGTATCAACCAAATGGGGAAATCTTGCTGTGACTGAGAGAC
TAGTAGAAAAGGGAGCACAACTGGAATGCAAAACTCGAGACGGTCTGACT
CCACTTCATTGTGCTGTTCGATCGGGGTATGAAAATATAACAGCTTTTCT
TTTAAAATCTGGATCAAATCATTCTGCTAAAACGAGAAATGGACTCACTT
CTTTACACATGGCTTCTCAAGGAGATCACATTGAATGTGGACAACTATTA
ATTAATTACGGCACGAACCTTAATGATACAACACTCGACTATTTAACTCC
TTTACATGTGGCTGCACATTGTGGCCACGTTAGGATGGCAAATCTGCTAA
TAGAATGTGCCTGTGAAATAAACGCTAGAGCATTGAATGGGTTTACGCCT
CTTCATATTGCTTGTAAGAAAAATCGAGTGAAAGTCGTAGAACTCCTTTT
GAAATGCGGAGCATCAATTGAAGCAACGACAGAATCCGGCCTTTCACCAC
TGCACGTAGCAGCTTTCATGGGACACACGAATATTGCTTTAGTTTTAATA
CAAAATGGCGCCAATCCGAATCTTCAGACCATTCGATGCGAAACATCACT
ACATCTTGCCACTAGAGCCAACCAAGAAGAAATGATAAAAATTCTTTTGA
AAAATGGATCTCTTGTTGATGCTCGAGCTAAAGAGCAGCAAACACCATTA
CATATTGCTGCCAGACTGGGCAATATTGATATTATCAAGATTCTCCTGCA
ACACCAGGCCAATCCAAACAACCTGACGAAAGATAATTACTCTACCTTGC
ACATTGCAGCGAAAGAGGATCACGTTGACGCAGCGCGAGTCCTTATTGAG
GCTGGGGCGAAATTGGAATTGACTACGAGAAAAGGATTTACAGCATTACA
TATTGCTGCTAAGTACGGTAAAGTCGCACTTGCTACATTACTGTTACAGT
TAGGAACAGATTCAAATGTACAAGGACGCAATGGATTGACACCGTTACAC
CTGGCCGTTCATTATTCATCAATGCCAATGACCGTTCTTTTAATAGAATT
TCAAGCCTCACCATTTAAAACTTCAAAAAATGGATATACTCCGTTGCATA
TAGCTGCCAGGAAAAATTTATTAGAAATAGCTGATAAGTTAATTGAAAAT
CAAGCAAATCCAAATTCTGAATCTAGAAATGGTTTTACGCCTCTTCACTT
ATGCAGTCAAGAAGGCCATGATAAAATGGCAAAATTCCTCATAGACAGTG
AAGCTGATGCTAATGCCAAAGCGAAGAATTTGTTATCCAGTATGCATTTA
GCGGCCCAAGAGGACAAGGTTGGTGTAGCAGAGGTTCTTTTAGCGGCAGG
ATGTGAAATTGATTCAAAAACTAAGGCTGGATACACTCCACTCCATACGG
CTTGCCATTTTGGCCAGATAAACATGATATATTTCCTCATCAAGCATAAT
TGCAACATCAATGCGCAAACAAATTTTGGGTCTACTTCATTACATTTGGC
TGCCCAACAAGGGCATTTGCAAGTCATTATTGCATTATTGGACAAAAAGG
CAGATCCTAATATTCGAAACTCACAAAATATGACAGCAGCTCATGTTGCC
CGTCGACAACATTATTTAAATATATTTGAAGTGCTTAAAAAAGTTGTTAC
TTGTGTAACTCGATGGGAAGAAGAAGAGGAAGAAGTCGTTTTTAAAATGG
AATTGGATCGTCCAGAAGTAATGGGAGAAAATCCTGTAACAGACAGTGAA
GATGATTATGGCGACCCCGACTATACGACAATACCTGCTTCTCCGTTATT
TTCCCGTAACACAATGTCCAATGCTGTGCATGGAGGTAATAACTTATTCA
ATCATACTAACAGTGGAGTTCAATCCAAACATTCGACATTACCAAAAAGT
CAATCTGATAAAAACTCTACAATTTCAGGCGAAGACAGTATTCATGAAGC
ATTTTCTAACGACCATCATCAGTTTTGGAAAGATTCAACATTTACTAAAG
ATCAATATATAGCACAAACGAAACTGGGTCATGAATACGCAGTAGCATCG
CCGGTGGCCGATTGGGATTACGCTCCAGATAATGTTCCTATTACTCGCAA
GCCGGTCACTTCCGGGTTTTTAGTATCATTTTTGGTGGATGCTAGAGGAG
GTTCAATGAGAGGAAGTCGTCATGTTGGTTTACGAATTTTGGTTCCTCCA
AGTGCGGCTAGTGCACCAACTCGAGTTACTTGTCGAATGATAAAAACCGA
TAGAGTTCCTCATCCACCGCAACTAAATGACGGAGAAGGCTTAGCATGCA
GAATTCTGGAAATGGGACCCCATCCATGCAAGTTTAATAGTCCTGTACTT
TTAGAAGTACCGCATTTTGCTTCTTTGAGAGGACGAGACAGAGAAATAGT
TATTTTACGTTGTGATAACGGAGAAGCGTGGAAAGAACATTCTTTGGAAA
CTAGTGATCAAGCTGTTATGGATGCTTTGGGAACTTCCTTTGGTGACAAT
TTTGAAACAAGTGAAAGCCTGAAAGAGAAACGGATAGTACGAATATTAAC
AAATGAATTTCCAATGTATTTTGCAATTGTTACTCGGCTTCGACAAGAAA
TATCAATGATTGGAGCTGATGGCGGAGTGATAAGTTCGTCAGTATTATCT
CAAGTACAAGCCGTATTTCCAGAAGGGGCGTTGCAAAAAAGGATAAAAGT
TGGCTTACAAGCACATTCTATCGATCCTGAGTTGGTAGCAAAATTGCTAG
GAAACAGAATTGCTGTTTCCCCCATTGTCACCATTGAACCAAGAAGACGC
AAATTTCATAAACCGATAACAGTAACTATACCGCTGCCTCAAGCGGCAAA
CAAAGGAATGATTAATCAAGGTGAGTTGACAAACTTGCGATTACTGTGTA
GCATAAGCGGAGGAACGAATCCAGCCCAATGGGAAGACATAACCGGATCA
ACACCTTTGTCACAAGTCAAACAGTGTGTCTCCTTTACTACCACAGTCAG
TGCAAGATTTTGGCTAATGGATTGTCAAAATGCACCAGAATGTGCTGAAA
TGGGAGGAAAACTCTATAAAGAGGCCATTTTAGTTCCATATATGGGTAAA
TTTGTCATTTTTGCCAAGACTACAGAATACGAAGAAGTTCTCTTACGATG
TTTTTGCATCACAGATGATAAAATTGATAAGACATTGGAATGCCAAGAAG
GCTTTGAATTGAAAGCAGCTAGTCCGGAAGTTGAAGTCCTAGATGATCGA
GATAATTGGTTGGAAACTGCCGGTAACATTATTCCGGTTACCAAATTAGG
AGATCAACTTCGATTGCATTTTAATGCCTTTAAAGAAAATAGATTGCCAT
TTCCAGCAAGACTTAAGGATCCGAGTCTAGAAAATTCACTAGGAAAAGTT
GCCTTTATGAGAGATCCAAGAAATTGCCAAGGGTATGCCGGTGTCGAATA
TTCCGGCCAATCTGTTCCTCAAAAGCCACTCTGTACGCTAGAAATTAAAT
TAAGTAATTTGAACCATTCTTGTGAGCACATGGCTCACATATCGGAAGCA
TTTTCCCACAACGGAAAAATCGAGCTTGACTCCAAAGGCCGACCATTAAG
TGAAGAAGCCCAAAAGGACTGGATTAATATTAGCAATTCCAGTGATACTA
TCGCAAAGTCAGATTTAGACCTACATGAAGTAGCTCAAGAAGTGGGGAGT
GACTGGCCTAGTCTTGCCAAGGAATTAGGAATGACGAATAACTTTATCAA
CAAGTTACAAAGCGAATACATCAACGAAGAAGAAAAATCGTTGCATTTAT
TGATATCTTGGAGTGAAGACAACAAACACATTGCAACTGGAAATGAATTG
GATAGAGCTTTGAGAAGAATCGGAAGAGAAGATGTTGTAAAATCCTGCAT
GAAAAATTTCCAACGTGTCACCGAAGAAGATGAACAAAACAGAGCAAAGC
ATCAAATGAGCAGAGAAGGAACCACAGAAGCGTCTTTTGACGTTGATAGT
CAAAGTGAGTTTCAAGTTCTATCGGATGAATACGAACAAAGGAATCAAGG
GGAAACATTGCCTATAAACACAGACCAAGATAAAATGGAACCTTTTGATA
TACCAGATACGGATATAGTTCGTGAAAGTGAATCTATGACTACAAGCGAT
TTCGACGATCATGAAGAAATTCAAAATAAAGAAATCACAAACGTGCCTAT
TGATGATAATCATATTGACCTAGACCTAATAAATCAGTTCGACGAATTGC
AACAATCAATTGAGCCTATAAAAGCGGATGAAAATTGTGGCGATCAAAAC
GAAGCATTACTTAAATGTGATTCTTCCGAGCAAGAAAATGAGCCAACTAA
TGAATTCGAGGACTTCCAAGAAGCCATTCAGATGGAAACCGATTCAATCA
GACCTATCACAGAAGGATCCAAACATATTCAATCAGAAACTCCATCGGAT
TTACTGGAACAATAGATCATGTCAAATTTGATTTTCCAAATATTGAAAAA
TAATTAAATGTTGAAAACAATAACTTTTAAAAATGTAAAAATTATACTTC
ATAATTTGATTAGAGTTCCTATCATATATGATTTCAATGTTTTAGCATGC
GACGCCGAATATAGCTTGAATTATTATCATTGTGGGTGTGTGTGTGTGTG
AATGTGAATTTGATAATATATAATGTGGCGGTAATTATTTTTATTATATT
ATTTCCTACTCTATGGCCAATATGATCATTTGTCAATGTCCCAATTTATT
GATGCTTTGGAA
back to top

protein sequence of SMED30023391-orf-1

>SMED30023391-orf-1 ID=SMED30023391-orf-1|Name=SMED30023391-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1743bp
MTLKEDTDQNKDKSSDLSSPVTKMDSGQSFLRAARSGNVQKIIDFLDNGG
DIATANANGLNALHIASKEGLVDIVKILLTKNADVNSATKKGNTSLHIAC
LAGKVDVVNFLIEHGAKVNVQSQNGFTPLYMAAQENHVEVVKLLLLNSAS
QTLATDDGFTPLAVALQQGHEKVVAILLENDSRGRIRLPALHIAAKKDDV
KAANLLLTNDANVDHQSASGFTPLHIAAHYGNVNIANLLIERGGDVNFQA
KNNITPLHVSTKWGNLAVTERLVEKGAQLECKTRDGLTPLHCAVRSGYEN
ITAFLLKSGSNHSAKTRNGLTSLHMASQGDHIECGQLLINYGTNLNDTTL
DYLTPLHVAAHCGHVRMANLLIECACEINARALNGFTPLHIACKKNRVKV
VELLLKCGASIEATTESGLSPLHVAAFMGHTNIALVLIQNGANPNLQTIR
CETSLHLATRANQEEMIKILLKNGSLVDARAKEQQTPLHIAARLGNIDII
KILLQHQANPNNLTKDNYSTLHIAAKEDHVDAARVLIEAGAKLELTTRKG
FTALHIAAKYGKVALATLLLQLGTDSNVQGRNGLTPLHLAVHYSSMPMTV
LLIEFQASPFKTSKNGYTPLHIAARKNLLEIADKLIENQANPNSESRNGF
TPLHLCSQEGHDKMAKFLIDSEADANAKAKNLLSSMHLAAQEDKVGVAEV
LLAAGCEIDSKTKAGYTPLHTACHFGQINMIYFLIKHNCNINAQTNFGST
SLHLAAQQGHLQVIIALLDKKADPNIRNSQNMTAAHVARRQHYLNIFEVL
KKVVTCVTRWEEEEEEVVFKMELDRPEVMGENPVTDSEDDYGDPDYTTIP
ASPLFSRNTMSNAVHGGNNLFNHTNSGVQSKHSTLPKSQSDKNSTISGED
SIHEAFSNDHHQFWKDSTFTKDQYIAQTKLGHEYAVASPVADWDYAPDNV
PITRKPVTSGFLVSFLVDARGGSMRGSRHVGLRILVPPSAASAPTRVTCR
MIKTDRVPHPPQLNDGEGLACRILEMGPHPCKFNSPVLLEVPHFASLRGR
DREIVILRCDNGEAWKEHSLETSDQAVMDALGTSFGDNFETSESLKEKRI
VRILTNEFPMYFAIVTRLRQEISMIGADGGVISSSVLSQVQAVFPEGALQ
KRIKVGLQAHSIDPELVAKLLGNRIAVSPIVTIEPRRRKFHKPITVTIPL
PQAANKGMINQGELTNLRLLCSISGGTNPAQWEDITGSTPLSQVKQCVSF
TTTVSARFWLMDCQNAPECAEMGGKLYKEAILVPYMGKFVIFAKTTEYEE
VLLRCFCITDDKIDKTLECQEGFELKAASPEVEVLDDRDNWLETAGNIIP
VTKLGDQLRLHFNAFKENRLPFPARLKDPSLENSLGKVAFMRDPRNCQGY
AGVEYSGQSVPQKPLCTLEIKLSNLNHSCEHMAHISEAFSHNGKIELDSK
GRPLSEEAQKDWINISNSSDTIAKSDLDLHEVAQEVGSDWPSLAKELGMT
NNFINKLQSEYINEEEKSLHLLISWSEDNKHIATGNELDRALRRIGREDV
VKSCMKNFQRVTEEDEQNRAKHQMSREGTTEASFDVDSQSEFQVLSDEYE
QRNQGETLPINTDQDKMEPFDIPDTDIVRESESMTTSDFDDHEEIQNKEI
TNVPIDDNHIDLDLINQFDELQQSIEPIKADENCGDQNEALLKCDSSEQE
NEPTNEFEDFQEAIQMETDSIRPITEGSKHIQSETPSDLLEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR040745Ankyrin_UPA
IPR002110Ankyrin_rpt
IPR000906ZU5_dom
IPR000488Death_domain
IPR011029DEATH-like_dom_sf
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 220..235
score: 44.78
coord: 400..414
score: 39.98
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 516..545
e-value: 0.026
score: 23.7
coord: 91..120
e-value: 2.2E-6
score: 37.2
coord: 252..281
e-value: 0.1
score: 21.7
coord: 648..677
e-value: 4.2E-5
score: 32.9
coord: 681..710
e-value: 18.0
score: 14.2
coord: 417..446
e-value: 1.1E-4
score: 31.5
coord: 384..413
e-value: 5.1E-7
score: 39.3
coord: 219..248
e-value: 6.9E-7
score: 38.9
coord: 157..185
e-value: 14.0
score: 14.7
coord: 318..347
e-value: 0.017
score: 24.3
coord: 615..644
e-value: 2.5E-5
score: 33.7
coord: 124..153
e-value: 3.6E-5
score: 33.2
coord: 186..215
e-value: 1.6
score: 17.7
coord: 483..512
e-value: 2.5E-6
score: 37.0
coord: 549..578
e-value: 0.0023
score: 27.2
coord: 285..314
e-value: 6.2E-4
score: 29.1
coord: 714..743
e-value: 3.6E-5
score: 33.2
coord: 582..611
e-value: 0.2
score: 20.8
coord: 450..479
e-value: 0.031
score: 23.4
coord: 747..776
e-value: 2.7E-5
score: 33.6
coord: 58..87
e-value: 4.5E-5
score: 32.9
coord: 351..380
e-value: 0.0012
score: 28.1
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 648..678
e-value: 2.6E-4
score: 21.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 58..90
score: 12.903
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 549..581
score: 12.422
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 351..383
score: 9.965
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 384..416
score: 14.052
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 318..350
score: 10.472
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 157..182
score: 9.03
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 516..548
score: 11.407
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 747..779
score: 12.876
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 285..317
score: 12.022
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 615..647
score: 12.502
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 91..123
score: 14.345
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 252..284
score: 10.606
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 648..680
score: 12.235
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 450..482
score: 10.553
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 714..746
score: 12.129
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 483..515
score: 12.796
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 124..156
score: 11.728
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 417..449
score: 12.823
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 219..251
score: 14.613
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 681..713
score: 8.977
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 582..614
score: 9.271
IPR000488Death domainSMARTSM00005DEATH_4coord: 1465..1558
e-value: 6.7E-8
score: 42.3
IPR000488Death domainPFAMPF00531Deathcoord: 1479..1555
e-value: 1.2E-11
score: 44.6
IPR000488Death domainPROSITEPS50017DEATH_DOMAINcoord: 1475..1558
score: 18.625
IPR000906ZU5 domainSMARTSM00218zu_1coord: 959..1063
e-value: 6.5E-45
score: 165.2
IPR000906ZU5 domainPFAMPF00791ZU5coord: 1124..1199
e-value: 1.3E-6
score: 28.6
coord: 963..1059
e-value: 2.8E-26
score: 91.7
IPR000906ZU5 domainPROSITEPS51145ZU5coord: 1119..1263
score: 15.133
IPR000906ZU5 domainPROSITEPS51145ZU5coord: 961..1117
score: 18.88
NoneNo IPR availablePFAMPF13637Ank_4coord: 188..240
e-value: 5.4E-10
score: 39.6
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 957..1116
e-value: 3.2E-66
score: 223.9
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 1117..1280
e-value: 2.2E-75
score: 253.7
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 1464..1567
e-value: 1.6E-16
score: 61.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.2660coord: 1281..1451
e-value: 2.6E-51
score: 175.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1563..1585
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 878..897
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1717..1742
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1563..1578
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1721..1742
NoneNo IPR availablePANTHERPTHR24133FAMILY NOT NAMEDcoord: 1031..1564
NoneNo IPR availablePANTHERPTHR24133:SF33ANKYRIN, ISOFORM Bcoord: 25..1028
NoneNo IPR availablePANTHERPTHR24133:SF33ANKYRIN, ISOFORM Bcoord: 1031..1564
NoneNo IPR availablePANTHERPTHR24133FAMILY NOT NAMEDcoord: 25..1028
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 418..831
e-value: 2.0E-124
score: 417.4
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 307..417
e-value: 1.5E-30
score: 108.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1..306
e-value: 3.0E-95
score: 321.1
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 61..434
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 419..808
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 452..511
e-value: 9.2E-12
score: 45.4
coord: 554..644
e-value: 2.4E-14
score: 53.7
coord: 124..181
e-value: 1.4E-10
score: 41.6
coord: 686..778
e-value: 1.9E-16
score: 60.4
coord: 356..447
e-value: 6.6E-17
score: 61.9
coord: 245..314
e-value: 9.2E-10
score: 39.0
coord: 32..121
e-value: 5.4E-15
score: 55.8
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 25..800
score: 226.224
IPR040745Ankyrin, UPA domainPFAMPF17809UPA_2coord: 1283..1422
e-value: 1.5E-38
score: 131.5
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 1476..1557