ATP dependent RNA helicase DDX6

Overview
NameATP dependent RNA helicase DDX6
Smed IDSMED30023369
Length (bp)1611
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP dependent RNA helicase DDX6 (SMED30023369) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP dependent RNA helicase DDX6 (SMED30023369) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023369

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30023369SMESG000027870.1 SmedASXL_013048SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30023369SMESG000027870.1 dd_Smed_v4_11802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30023369SMESG000027870.1 dd_Smed_v6_11802_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30023369SMESG000027870.1 Contig38363newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30023369SMESG000027870.1 Contig38363uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Human
Match: DDX6 (DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2747])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 279/411 (67.88%), Postives = 340/411 (82.73%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            DWKK+LKLPPKD RIKT+DV +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP +IDK LYV+EY  E   DE
Sbjct:   71 DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDE 481          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Human
Match: DDX6 (DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2747])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 279/411 (67.88%), Postives = 340/411 (82.73%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            DWKK+LKLPPKD RIKT+DV +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP +IDK LYV+EY  E   DE
Sbjct:   71 DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDE 481          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Human
Match: DDX6 (DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2747])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 279/411 (67.88%), Postives = 340/411 (82.73%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            DWKK+LKLPPKD RIKT+DV +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP +IDK LYV+EY  E   DE
Sbjct:   71 DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDE 481          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 294.278 bits (752), Expect = 3.862e-94
Identity = 142/369 (38.48%), Postives = 234/369 (63.41%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF++  L  DL++ I+  G++ PS IQ++ I   + G D++A++++GTGKT  +++ +L  ++  ++  Q LIL PTRELA+Q  +  + L  Y+  +     GGT++ EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L+K FKE + ++   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q++IFCNT ++V+ L +K+ +  ++   +H  M Q  R  +  +FR+G  R L+ TD++ RG+D+P V+++IN+D P   E Y+HRIGRSGRYG  G+AIN +  DD   L++IE    T+I+ +P ++
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV 407          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Human
Match: EIF4A3 (eukaryotic translation initiation factor 4A3 [Source:HGNC Symbol;Acc:HGNC:18683])

HSP 1 Score: 294.278 bits (752), Expect = 3.862e-94
Identity = 142/369 (38.48%), Postives = 234/369 (63.41%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF++  L  DL++ I+  G++ PS IQ++ I   + G D++A++++GTGKT  +++ +L  ++  ++  Q LIL PTRELA+Q  +  + L  Y+  +     GGT++ EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L+K FKE + ++   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q++IFCNT ++V+ L +K+ +  ++   +H  M Q  R  +  +FR+G  R L+ TD++ RG+D+P V+++IN+D P   E Y+HRIGRSGRYG  G+AIN +  DD   L++IE    T+I+ +P ++
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV 407          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Celegans
Match: cgh-1 (ATP-dependent RNA helicase cgh-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95YF3])

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 278/414 (67.15%), Postives = 342/414 (82.61%), Query Frame = 2
Query:  242 DCDWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPT 1483
            D +WK  L LP KD R KT DV  TKG  FE + L RDL+  IFEKGW+ PSPIQE  I  A++G DILARAKNGTGKTGAY +P++ KI P L+A+Q +++VPTRELALQTSQIC+ELSK+++ KVMVTTGGTDL +DI RLN  VHLVI TPGRI DL+++ V   E+CKTLVLDEADKLLS+DF+ I+  +++ LPK+RQ++LYSAT+P T+  FM KH+  P +INLMEELTL G+TQYYA+V+EK KVHCLNTLF KL +NQSIIFCN+TQRVELLAKKIT++GYSCYYIH++M+Q+ RNRVFHDFR G+CRNLVC+DL TRGIDI  VNVVINFD+P+ AETYLHRIGRSGR+GHLG+AINLITY+DR+ L+ IE +L T+IE IPK +D +LYV++ Q+ +  DE T
Sbjct:   16 DENWKAGLNLPAKDRRFKTADVTDTKGVEFEDFCLGRDLLMGIFEKGWEKPSPIQEASIGVALTGQDILARAKNGTGKTGAYCIPVIEKIQPALKAIQAMVIVPTRELALQTSQICVELSKHIQLKVMVTTGGTDLRDDIMRLNGTVHLVIATPGRILDLMEKGVAKMEHCKTLVLDEADKLLSQDFQGILDRLINFLPKERQVMLYSATFPNTVTSFMQKHMHKPYEINLMEELTLLGVTQYYAFVQEKQKVHCLNTLFRKLQINQSIIFCNSTQRVELLAKKITEIGYSCYYIHSKMAQNHRNRVFHDFRQGNCRNLVCSDLLTRGIDIQAVNVVINFDFPRNAETYLHRIGRSGRFGHLGVAINLITYEDRHTLRRIEQELRTRIEPIPKTVDPKLYVADQQLVDAADETT 429          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Celegans
Match: Y65B4A.6 (pep chromosome:WBcel235:I:629492:636350:-1 gene:WBGene00022029.1 transcript:Y65B4A.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y65B4A.6)

HSP 1 Score: 305.834 bits (782), Expect = 3.364e-99
Identity = 148/369 (40.11%), Postives = 235/369 (63.69%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF+   L  DL++ I+  G++ PS IQ++ IPA +   D++A+A++GTGKT  +++ +L  ++  ++  Q LIL PTRELA+Q  ++ + L  Y+  +     GGT+L EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L+K FKE + +I   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q+++FCNT ++V+ L  K+ +  ++   +H  M Q  R+ V  +FRAG  R L+ TD++ RG+D+P V++VIN+D P   E Y+HRIGRSGR+G  G+AIN +  DD   L++IE    T+I+ +P +I
Sbjct:   27 TFDKMGLREDLLRGIYAYGFEKPSAIQQRAIPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNI 395          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Celegans
Match: F33D11.10 (pep chromosome:WBcel235:I:5866514:5868139:-1 gene:WBGene00018007.1 transcript:F33D11.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F33D11.10)

HSP 1 Score: 305.449 bits (781), Expect = 5.229e-99
Identity = 147/369 (39.84%), Postives = 235/369 (63.69%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF+   L  DL++ I+  G++ PS IQ++ +PA +   D++A+A++GTGKT  +++ +L  ++  ++  Q LIL PTRELA+Q  ++ + L  Y+  +     GGT+L EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L+K FKE + +I   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q+++FCNT ++V+ L  K+ +  ++   +H  M Q  R+ V  +FRAG  R L+ TD++ RG+D+P V++VIN+D P   E Y+HRIGRSGR+G  G+AIN +  DD   L++IE    T+I+ +P +I
Sbjct:   27 TFDKMGLREDLLRGIYAYGFEKPSAIQQRAVPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQVRETQALILSPTRELAVQIQKVVLALGDYMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVFDMIRRRNLRTRAIKLLVLDEADEMLNKGFKEQLYDIYRYLPPGAQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREEWKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDMEQKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNI 395          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 305.449 bits (781), Expect = 5.324e-99
Identity = 145/369 (39.30%), Postives = 240/369 (65.04%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            +F+   L  +L++ I+  G++ PS IQ++ I    +G D++A+A++GTGKT  +++ +L +I+ +   VQ L++ PTRELA Q  ++   L +YL   ++   GGT + +D  +L   +H+V+GTPGR+ D++ R  ++    K  VLDEAD++LS+ FK+ +  +   +P+D Q++L SAT P  + +   + +R+PI+I +  +ELTL+GI Q+Y  V K++ K  CL  L++ + V Q++IFCNT ++V+ L +K+T+  ++   +H  M Q  R+ +  +FR+G  R L+ TD+  RGID+  V++VIN+D P   E Y+HRIGRSGR+G  G+AIN +T +D   LKEIES   T+IE +P+ I
Sbjct:   30 SFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESI 398          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Celegans
Match: inf-1 (Eukaryotic initiation factor 4A [Source:UniProtKB/Swiss-Prot;Acc:P27639])

HSP 1 Score: 305.449 bits (781), Expect = 5.324e-99
Identity = 145/369 (39.30%), Postives = 240/369 (65.04%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            +F+   L  +L++ I+  G++ PS IQ++ I    +G D++A+A++GTGKT  +++ +L +I+ +   VQ L++ PTRELA Q  ++   L +YL   ++   GGT + +D  +L   +H+V+GTPGR+ D++ R  ++    K  VLDEAD++LS+ FK+ +  +   +P+D Q++L SAT P  + +   + +R+PI+I +  +ELTL+GI Q+Y  V K++ K  CL  L++ + V Q++IFCNT ++V+ L +K+T+  ++   +H  M Q  R+ +  +FR+G  R L+ TD+  RGID+  V++VIN+D P   E Y+HRIGRSGR+G  G+AIN +T +D   LKEIES   T+IE +P+ I
Sbjct:   30 SFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDPHVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVRDDQRKLEAGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEVFRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQFYINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTVSCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMPESI 398          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Fly
Match: me31B (gene:FBgn0004419 transcript:FBtr0079975)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 272/402 (67.66%), Postives = 331/402 (82.34%), Query Frame = 2
Query:  242 DCDWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVS 1447
            D  WK  LKLPPKDNR KT DV  T+G+ FE + L R+L+  IFEKGW+ PSPIQE  IP A+SG D+LARAKNGTGKTGAY +P+L +I+P    +Q L++VPTRELALQTSQICIEL+K+L  +VMVTTGGT L +DI R+ + V L+I TPGRI DL+ ++V +  +C+ LVLDEADKLLS DF+ ++ +++  LPKD QILL+SAT+P+T+  FM KHLR P +INLMEELTLKG+TQYYA+V+E+ KVHCLNTLFSKL +NQSIIFCN+TQRVELLAKKIT+LGY CYYIHA+M+Q  RNRVFHDFR G CRNLVC+DLFTRGID+  VNVVINFD+P+ AETYLHRIGRSGR+GHLGIAINLITY+DR+ L  IE +L T+I+ IPK ID  LYV+
Sbjct:   31 DMGWKSKLKLPPKDNRFKTTDVTDTRGNEFEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILKDDILRIYQKVQLIIATPGRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKELGTEIKPIPKVIDPALYVA 432          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Fly
Match: me31B (gene:FBgn0004419 transcript:FBtr0079976)

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 271/399 (67.92%), Postives = 330/399 (82.71%), Query Frame = 2
Query:  251 WKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVS 1447
            WK  LKLPPKDNR KT DV  T+G+ FE + L R+L+  IFEKGW+ PSPIQE  IP A+SG D+LARAKNGTGKTGAY +P+L +I+P    +Q L++VPTRELALQTSQICIEL+K+L  +VMVTTGGT L +DI R+ + V L+I TPGRI DL+ ++V +  +C+ LVLDEADKLLS DF+ ++ +++  LPKD QILL+SAT+P+T+  FM KHLR P +INLMEELTLKG+TQYYA+V+E+ KVHCLNTLFSKL +NQSIIFCN+TQRVELLAKKIT+LGY CYYIHA+M+Q  RNRVFHDFR G CRNLVC+DLFTRGID+  VNVVINFD+P+ AETYLHRIGRSGR+GHLGIAINLITY+DR+ L  IE +L T+I+ IPK ID  LYV+
Sbjct:    3 WKSKLKLPPKDNRFKTTDVTDTRGNEFEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILKDDILRIYQKVQLIIATPGRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKELGTEIKPIPKVIDPALYVA 401          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Fly
Match: CG7483 (gene:FBgn0037573 transcript:FBtr0081834)

HSP 1 Score: 297.36 bits (760), Expect = 9.027e-96
Identity = 146/369 (39.57%), Postives = 235/369 (63.69%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF + +L  +L++ I+  G++ PS IQ++ I   + G D++A+A++GTGKT  +++ +L  ++  L+  Q L L PTRELA+Q  ++ + L   +  +  V  GGT+L EDI +L+   H+V GTPGR+ D++KR V+     K LVLDEAD++L+K FKE + ++   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q++IFCNT ++V+ L +K+ +  ++   +H  M Q  R+ +  +FRAG  R L+ TD++ RGID+  V++VIN+D P   E Y+HRIGRSGR+G  G+AIN +  DD   L++IE    T+I+ +P ++
Sbjct:   27 TFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNV 395          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079178)

HSP 1 Score: 281.952 bits (720), Expect = 1.084e-89
Identity = 150/368 (40.76%), Postives = 235/368 (63.86%), Query Frame = 2
Query:  329 FESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYVKEKH-KVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            F+  +L  +L++ I+  G++ PS IQ++ I   + G D++A+A++GTGKT  +++ +L +I+  ++  Q LIL PTRELA Q  ++ + L +Y+K       GGT++ ED   L    H+V+GTPGR+ D++ R+V+  +Y K  VLDEAD++LS+ FK+ + ++   LP D Q++L SAT P  + E     +R P+ I +  EELTL+GI Q+Y  VK+++ K+  L  L+  L++ QS+IFCNT ++V+ L ++++   ++   +H  M Q  R  +   FR+G  R L+ TDL  RGID+  V++VIN+D P   E Y+HRIGR GR+G  G+AIN IT DDR  LK+IE    T IE +P +I
Sbjct:   32 FDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANI 399          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Fly
Match: eIF4A (gene:FBgn0001942 transcript:FBtr0079175)

HSP 1 Score: 281.952 bits (720), Expect = 1.084e-89
Identity = 150/368 (40.76%), Postives = 235/368 (63.86%), Query Frame = 2
Query:  329 FESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYVKEKH-KVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            F+  +L  +L++ I+  G++ PS IQ++ I   + G D++A+A++GTGKT  +++ +L +I+  ++  Q LIL PTRELA Q  ++ + L +Y+K       GGT++ ED   L    H+V+GTPGR+ D++ R+V+  +Y K  VLDEAD++LS+ FK+ + ++   LP D Q++L SAT P  + E     +R P+ I +  EELTL+GI Q+Y  VK+++ K+  L  L+  L++ QS+IFCNT ++V+ L ++++   ++   +H  M Q  R  +   FR+G  R L+ TDL  RGID+  V++VIN+D P   E Y+HRIGR GR+G  G+AIN IT DDR  LK+IE    T IE +P +I
Sbjct:   32 FDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANI 399          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Zebrafish
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 277/407 (68.06%), Postives = 334/407 (82.06%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIEN 1465
            DWKK+LKLPPKD R+KT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+    ++Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V      + +VLDEADKLLS+DF ++M  ILS L K RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK  ETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E+
Sbjct:   72 DWKKNLKLPPKDLRMKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDSIQAVVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDETVHVVIATPGRILDLIKKGVAKVGQVQMIVLDEADKLLSQDFVQMMEEILSSLSKQRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLGETYLHRIGRSGRFGHLGLAINLITYDDRFNLKGIEEQLGTEIKPIPSSIDKSLYVAEYHSES 478          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Zebrafish
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 277/407 (68.06%), Postives = 334/407 (82.06%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIEN 1465
            DWKK+LKLPPKD R+KT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+    ++Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V      + +VLDEADKLLS+DF ++M  ILS L K RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK  ETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E+
Sbjct:   72 DWKKNLKLPPKDLRMKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDSIQAVVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDETVHVVIATPGRILDLIKKGVAKVGQVQMIVLDEADKLLSQDFVQMMEEILSSLSKQRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLGETYLHRIGRSGRFGHLGLAINLITYDDRFNLKGIEEQLGTEIKPIPSSIDKSLYVAEYHSES 478          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Zebrafish
Match: ddx61 (DEAD (Asp-Glu-Ala-Asp) box helicase 61 [Source:ZFIN;Acc:ZDB-GENE-030131-6611])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 276/411 (67.15%), Postives = 332/411 (80.78%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            DWKK L+LPPKD R++T DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+     +Q ++LVPTRELALQ SQI I +SK+L   KVM TTGGT+L +DI RL+  VH++I TPGRI DL+K+ V   +  +  V+DEADKLLS+DF  ++ +I+S LPK RQILLYSAT+P+++ +FM KHL+ P +INLM+ELTLKGITQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN+TQRVELLAKKIT LGYSC+YIHA+M Q +RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGRYGHLG+AINLIT +DR+ LK IE QL T I+ IP  IDK LYV+E+   N  +E
Sbjct:   63 DWKKCLQLPPKDTRVRTTDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDYIQAIVLVPTRELALQVSQISINMSKHLGGIKVMATTGGTNLRDDIMRLDEIVHVIIATPGRILDLIKKGVAKVDKVQMAVMDEADKLLSQDFVVLIEDIISFLPKKRQILLYSATFPISVQKFMTKHLQKPYEINLMDELTLKGITQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRYGHLGLAINLITSEDRFNLKGIEDQLMTDIKPIPSSIDKSLYVAEFHSMNPDEE 473          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Zebrafish
Match: ddx61 (DEAD (Asp-Glu-Ala-Asp) box helicase 61 [Source:ZFIN;Acc:ZDB-GENE-030131-6611])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 276/411 (67.15%), Postives = 332/411 (80.78%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            DWKK L+LPPKD R++T DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+     +Q ++LVPTRELALQ SQI I +SK+L   KVM TTGGT+L +DI RL+  VH++I TPGRI DL+K+ V   +  +  V+DEADKLLS+DF  ++ +I+S LPK RQILLYSAT+P+++ +FM KHL+ P +INLM+ELTLKGITQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN+TQRVELLAKKIT LGYSC+YIHA+M Q +RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGRYGHLG+AINLIT +DR+ LK IE QL T I+ IP  IDK LYV+E+   N  +E
Sbjct:   63 DWKKCLQLPPKDTRVRTTDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDYIQAIVLVPTRELALQVSQISINMSKHLGGIKVMATTGGTNLRDDIMRLDEIVHVIIATPGRILDLIKKGVAKVDKVQMAVMDEADKLLSQDFVVLIEDIISFLPKKRQILLYSATFPISVQKFMTKHLQKPYEINLMDELTLKGITQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRYGHLGLAINLITSEDRFNLKGIEDQLMTDIKPIPSSIDKSLYVAEFHSMNPDEE 473          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Zebrafish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:394053])

HSP 1 Score: 292.352 bits (747), Expect = 1.505e-93
Identity = 142/369 (38.48%), Postives = 232/369 (62.87%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF++  L  DL++ I+  G++ PS IQ++ I   + G D++A++++GTGKT  + + +L  ++  ++  Q LIL PTRELA Q  ++ + L  Y+  +     GGT++ EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L+K FKE + ++   LP   Q+ L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q++IFCNT ++V+ L +K+ +  ++   +H  M Q  R  +  +FR+G  R L+ TD++ RG+D+P V+++IN+D P   E Y+HRIGRSGRYG  G+AIN +  DD   L++IE    T+I+ +P ++
Sbjct:   34 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV 402          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 277/417 (66.43%), Postives = 340/417 (81.53%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTND-----VLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEP 1480
            DWKK+LKLPPKD RIKT+      + +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E+  D+P
Sbjct:   70 DWKKTLKLPPKDLRIKTSVRWYRYLWSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDCIQAMVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDIIITLPKNRQILLYSATFPLSVQKFMTSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSSIDKSLYVAEYHSESGEDKP 486          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 277/417 (66.43%), Postives = 340/417 (81.53%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTND-----VLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEP 1480
            DWKK+LKLPPKD RIKT+      + +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E+  D+P
Sbjct:   64 DWKKTLKLPPKDLRIKTSVRWYRYLWSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDCIQAMVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDIIITLPKNRQILLYSATFPLSVQKFMTSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSSIDKSLYVAEYHSESGEDKP 480          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 269/417 (64.51%), Postives = 330/417 (79.14%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTND-----VLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEP 1480
            DWKK+LKLPPKD RIKT+      + +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG            KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E+  D+P
Sbjct:   70 DWKKTLKLPPKDLRIKTSVRWYRYLWSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDCIQAMVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDIIITLPKNRQILLYSATFPLSVQKFMTSHLQKPYEINLMEELTLKG------------KVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSSIDKSLYVAEYHSESGEDKP 474          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 504.212 bits (1297), Expect = 7.091e-176
Identity = 250/416 (60.10%), Postives = 303/416 (72.84%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTND-----VLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEP 1480
            DWKK+LKLPPKD RIKT+      + +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL ++                                            DL +D  +    VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E+  D+P
Sbjct:   70 DWKKTLKLPPKDLRIKTSVRWYRYLWSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERL--------------------------------------------DLKKDCIQ----VHVVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDIIITLPKNRQILLYSATFPLSVQKFMTSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSSIDKSLYVAEYHSESGEDKP 437          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Xenopus
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:780039])

HSP 1 Score: 503.056 bits (1294), Expect = 3.408e-175
Identity = 247/417 (59.23%), Postives = 309/417 (74.10%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTND-----VLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEP 1480
            DWKK+LKLPPKD RIKT+      + +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCT                                  GR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E+  D+P
Sbjct:   70 DWKKTLKLPPKDLRIKTSVRWYRYLWSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDCIQAMVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDIIITLPKNRQILLYSATFPLSVQKFMTSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCT----------------------------------GRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSSIDKSLYVAEYHSESGEDKP 452          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Mouse
Match: Ddx6 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 [Source:MGI Symbol;Acc:MGI:104976])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 279/411 (67.88%), Postives = 340/411 (82.73%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            DWKK+LKLPPKD RIKT+DV +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP +IDK LYV+EY  E   DE
Sbjct:   71 DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPAEDE 481          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Mouse
Match: Ddx6 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 [Source:MGI Symbol;Acc:MGI:104976])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 279/411 (67.88%), Postives = 340/411 (82.73%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            DWKK+LKLPPKD RIKT+DV +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP +IDK LYV+EY  E   DE
Sbjct:   71 DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPAEDE 481          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Mouse
Match: Eif4a3 (eukaryotic translation initiation factor 4A3 [Source:MGI Symbol;Acc:MGI:1923731])

HSP 1 Score: 293.893 bits (751), Expect = 4.253e-94
Identity = 142/369 (38.48%), Postives = 234/369 (63.41%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF++  L  DL++ I+  G++ PS IQ++ I   + G D++A++++GTGKT  +++ +L  ++  ++  Q LIL PTRELA+Q  +  + L  Y+  +     GGT++ EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L+K FKE + ++   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q++IFCNT ++V+ L +K+ +  ++   +H  M Q  R  +  +FR+G  R L+ TD++ RG+D+P V+++IN+D P   E Y+HRIGRSGRYG  G+AIN +  DD   L++IE    T+I+ +P ++
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSVSVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV 407          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Mouse
Match: Eif4a3l1 (eukaryotic translation initiation factor 4A3 like 1 [Source:MGI Symbol;Acc:MGI:3644226])

HSP 1 Score: 291.197 bits (744), Expect = 5.129e-93
Identity = 141/369 (38.21%), Postives = 233/369 (63.14%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF++  L  DL++ I+  G++ PS IQ++ I   M G D++A++++GTGKT  +++ +L  ++  ++  Q LIL PTRELA+Q  +  + L  Y+  +     GGT++ EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L++ FKE + ++   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q++IFC T ++V+ L +K+ +  ++   +H  M Q  R  +  +FR+G  R L+ TD++ RG+D+P V+++IN+D P   E Y+HRIGRSGRYG  G+AIN +  DD   L++IE    T+I+ +P ++
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIMKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACVGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLTTRAIKMLVLDEADEMLNRGFKEQIYDVYRYLPPATQVVLVSATLPHEILEMTNKFMTHPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCITKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNL 407          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Mouse
Match: Eif4a3l1 (eukaryotic translation initiation factor 4A3 like 1 [Source:MGI Symbol;Acc:MGI:3644226])

HSP 1 Score: 291.197 bits (744), Expect = 5.129e-93
Identity = 141/369 (38.21%), Postives = 233/369 (63.14%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF++  L  DL++ I+  G++ PS IQ++ I   M G D++A++++GTGKT  +++ +L  ++  ++  Q LIL PTRELA+Q  +  + L  Y+  +     GGT++ EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L++ FKE + ++   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q++IFC T ++V+ L +K+ +  ++   +H  M Q  R  +  +FR+G  R L+ TD++ RG+D+P V+++IN+D P   E Y+HRIGRSGRYG  G+AIN +  DD   L++IE    T+I+ +P ++
Sbjct:   39 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIMKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACVGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLTTRAIKMLVLDEADEMLNRGFKEQIYDVYRYLPPATQVVLVSATLPHEILEMTNKFMTHPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCITKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNL 407          
BLAST of ATP dependent RNA helicase DDX6 vs. UniProt/SwissProt
Match: sp|Q95YF3|CGH1_CAEEL (ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans OX=6239 GN=cgh-1 PE=1 SV=1)

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 278/414 (67.15%), Postives = 342/414 (82.61%), Query Frame = 2
Query:  242 DCDWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPT 1483
            D +WK  L LP KD R KT DV  TKG  FE + L RDL+  IFEKGW+ PSPIQE  I  A++G DILARAKNGTGKTGAY +P++ KI P L+A+Q +++VPTRELALQTSQIC+ELSK+++ KVMVTTGGTDL +DI RLN  VHLVI TPGRI DL+++ V   E+CKTLVLDEADKLLS+DF+ I+  +++ LPK+RQ++LYSAT+P T+  FM KH+  P +INLMEELTL G+TQYYA+V+EK KVHCLNTLF KL +NQSIIFCN+TQRVELLAKKIT++GYSCYYIH++M+Q+ RNRVFHDFR G+CRNLVC+DL TRGIDI  VNVVINFD+P+ AETYLHRIGRSGR+GHLG+AINLITY+DR+ L+ IE +L T+IE IPK +D +LYV++ Q+ +  DE T
Sbjct:   16 DENWKAGLNLPAKDRRFKTADVTDTKGVEFEDFCLGRDLLMGIFEKGWEKPSPIQEASIGVALTGQDILARAKNGTGKTGAYCIPVIEKIQPALKAIQAMVIVPTRELALQTSQICVELSKHIQLKVMVTTGGTDLRDDIMRLNGTVHLVIATPGRILDLMEKGVAKMEHCKTLVLDEADKLLSQDFQGILDRLINFLPKERQVMLYSATFPNTVTSFMQKHMHKPYEINLMEELTLLGVTQYYAFVQEKQKVHCLNTLFRKLQINQSIIFCNSTQRVELLAKKITEIGYSCYYIHSKMAQNHRNRVFHDFRQGNCRNLVCSDLLTRGIDIQAVNVVINFDFPRNAETYLHRIGRSGRFGHLGVAINLITYEDRHTLRRIEQELRTRIEPIPKTVDPKLYVADQQLVDAADETT 429          
BLAST of ATP dependent RNA helicase DDX6 vs. UniProt/SwissProt
Match: sp|Q0IHV9|DDX6_XENTR (Probable ATP-dependent RNA helicase ddx6 OS=Xenopus tropicalis OX=8364 GN=ddx6 PE=2 SV=1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 279/412 (67.72%), Postives = 341/412 (82.77%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEP 1480
            DWKK+LKLPPKD RIKT+DV +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E+  D+P
Sbjct:   70 DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDCIQAMVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFVQIMEDIIITLPKNRQILLYSATFPLSVQKFMTSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSSIDKSLYVAEYHSESGEDKP 481          
BLAST of ATP dependent RNA helicase DDX6 vs. UniProt/SwissProt
Match: sp|P54824|DDX6_XENLA (ATP-dependent RNA helicase ddx6 OS=Xenopus laevis OX=8355 GN=ddx6 PE=1 SV=2)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 279/412 (67.72%), Postives = 341/412 (82.77%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEP 1480
            DWKK+LKLPPKD RIKT+DV +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E+  D+P
Sbjct:   70 DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDCIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHIQMIVLDEADKLLSQDFMQIMEDIIMTLPKNRQILLYSATFPLSVQKFMTLHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSSIDKNLYVAEYHSESGEDKP 481          
BLAST of ATP dependent RNA helicase DDX6 vs. UniProt/SwissProt
Match: sp|Q5ZKB9|DDX6_CHICK (Probable ATP-dependent RNA helicase DDX6 OS=Gallus gallus OX=9031 GN=DDX6 PE=2 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 280/411 (68.13%), Postives = 340/411 (82.73%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            DWKK+LKLPPKD RIKT+DV +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   E+ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP +IDK LYV+EY  E   DE
Sbjct:   71 DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVEHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDE 481          
BLAST of ATP dependent RNA helicase DDX6 vs. UniProt/SwissProt
Match: sp|P54823|DDX6_MOUSE (Probable ATP-dependent RNA helicase DDX6 OS=Mus musculus OX=10090 GN=Ddx6 PE=1 SV=1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 279/411 (67.88%), Postives = 340/411 (82.73%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            DWKK+LKLPPKD RIKT+DV +TKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q +++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   ++ + +VLDEADKLLS+DF +IM +I+  LPK+RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP +IDK LYV+EY  E   DE
Sbjct:   71 DWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPAEDE 481          
BLAST of ATP dependent RNA helicase DDX6 vs. TrEMBL
Match: A0A1I8IM45 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032789g1 PE=3 SV=1)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 317/422 (75.12%), Postives = 369/422 (87.44%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRGL 1513
            DWK  LKLPPKDNR++T DV +TKG+ FE ++L RDL+  I+EKGW+ PSPIQE  IP A++G D+LARAKNGTGKTGAY +PLL KI+    AVQ +I+VPTRELALQTSQICIEL+K+   K+MVTTGGT+L +DI RL+  VHLVI TPGR+ DLLK++V+  + CKTLVLDEADKLLS+DFK ++S I+S LPKDRQILL+SAT+P+T+ EFM  +LR+P +INLMEELTLKGITQ+YAYV+EKHKVHCLNTLFSKL +NQSIIFCNT QRVELLAKKIT+LGYSCYYIHARMSQHFRNRVFHDFR GHCRNLVCTDLFTRGIDIP+VNVVINFD+PKYAETYLHRIGRSGRYGHLGIAINLITYDDR+ALK+IE QL+T+I+AIPK IDKRLYVSEYQ E   D+ TK  + SG+GL
Sbjct:   13 DWKDGLKLPPKDNRLRTVDVTSTKGNAFEDFNLKRDLLMGIYEKGWEKPSPIQEASIPIALTGRDVLARAKNGTGKTGAYCIPLLEKIDTSKNAVQSMIIVPTRELALQTSQICIELAKHTGAKIMVTTGGTNLKDDIMRLDEEVHLVIATPGRVLDLLKKDVLKTDVCKTLVLDEADKLLSQDFKIMLSGIISRLPKDRQILLFSATFPLTVQEFMETYLRTPYEINLMEELTLKGITQFYAYVQEKHKVHCLNTLFSKLQINQSIIFCNTAQRVELLAKKITELGYSCYYIHARMSQHFRNRVFHDFRQGHCRNLVCTDLFTRGIDIPSVNVVINFDFPKYAETYLHRIGRSGRYGHLGIAINLITYDDRFALKQIEQQLNTEIKAIPKLIDKRLYVSEYQQEGELDDETKAMLASGKGL 434          
BLAST of ATP dependent RNA helicase DDX6 vs. TrEMBL
Match: A0A0X3NQB9 (ATP-dependent RNA helicase cgh-1 OS=Schistocephalus solidus OX=70667 GN=CGH1 PE=3 SV=1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 302/425 (71.06%), Postives = 357/425 (84.00%), Query Frame = 2
Query:  254 KKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRGLPRSNK 1528
            K S   P KDNR+KT DVL++KG++FE + L R+L+K I+EKGWD PSP+QE  IP A++G DILARAKNGTGKTGAY LP+L KI P +  +Q LILVPTRELALQTSQI  E+SKYL   VMVTTGGT+L ED+ RLN  VHL+I TPGR  D L R +IN E C TLVLDEADKLLS  F E++ N++  LP+DRQI+LYSAT+PV++  F MKHL++  +INLM+ELTLKGITQYYAYV+EKHKVHCLNTLFSKL +NQ+IIFCNT QRVELLAKK+T+LGYSCYYIHARMSQ +RNRVFHDFRAGHCRNLVCTDLFTRGIDIP+VNVVINFD+PKYAETYLHRIGRSGR+GHLGIAINLITYDD Y+LK IE+QL T+I+AIP+ ID+RLYV+EYQ  +  DE TK+++  G G+P  +K
Sbjct:    3 KSSKGFPEKDNRLKTVDVLSSKGNSFEDFCLKRELLKGIYEKGWDTPSPVQESSIPVALTGRDILARAKNGTGKTGAYLLPILEKIEPKVDHLQALILVPTRELALQTSQIAREISKYLGINVMVTTGGTNLVEDLVRLNGAVHLLIATPGRTLDFLNRSIINMEKCNTLVLDEADKLLSAGFHEMIDNVIKTLPEDRQIMLYSATFPVSVQSFTMKHLKNAYEINLMDELTLKGITQYYAYVQEKHKVHCLNTLFSKLQINQAIIFCNTAQRVELLAKKVTELGYSCYYIHARMSQQYRNRVFHDFRAGHCRNLVCTDLFTRGIDIPSVNVVINFDFPKYAETYLHRIGRSGRFGHLGIAINLITYDDCYSLKVIETQLRTEIKAIPRSIDERLYVAEYQNPSKMDEETKRSLSMGLGIPDKSK 427          
BLAST of ATP dependent RNA helicase DDX6 vs. TrEMBL
Match: A4UY08 (DEAD box RNA helicase Me31B OS=Dugesia japonica OX=6161 GN=Djcbc-1 PE=2 SV=1)

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 297/449 (66.15%), Postives = 371/449 (82.63%), Query Frame = 2
Query:  251 WKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRGLPRSNKPSDEMKRETTEIGTEMANSNTNA 1597
            WK  L +P KDNRIKT DV AT+G++F+ + L RD++K I+EKGW+MPSPIQE  IP ++ G DILARAKNGTGKTGAY++PLL KI+P +  +QG+ILVPTRELALQTSQIC EL+K+ + K+MVTTGGT L +DI RL + VH+++ TPGR+ DL+KR++++  +CK LV+DEADKLLS DF+E++  I+S LP  RQI+LYSAT+P ++ +F+ KH+R P +INLM+ELTLKGI+QYYAYV+E+ KVHCLNTLFS+L +NQSIIFCNT QRVELLAKKITDLGYSCYYIHA+M+Q +RNRVFH+FR G+CRNLVCTDLFTRGIDIP+VNVVINFD+PKYAETYLHRIGRSGRYGHLG+A+NLITYDDR+ALK IE+QL+T+I+AIPK IDKRLYV+EYQ EN  D   + A+  G G     + ++E+    T   T M    TNA
Sbjct:   25 WKNYLNIPEKDNRIKTVDVTATQGNSFDDFCLKRDILKGIYEKGWEMPSPIQEASIPISLIGRDILARAKNGTGKTGAYSIPLLEKIDPSINQIQGIILVPTRELALQTSQICTELAKHTETKIMVTTGGTSLKDDIVRLQQTVHIILATPGRVNDLIKRDIVSTNFCKILVIDEADKLLSADFEEVIDYIISKLPTQRQIMLYSATFPQSVQQFLEKHMRDPYEINLMDELTLKGISQYYAYVQERQKVHCLNTLFSRLQINQSIIFCNTAQRVELLAKKITDLGYSCYYIHAKMNQVYRNRVFHEFRNGNCRNLVCTDLFTRGIDIPSVNVVINFDFPKYAETYLHRIGRSGRYGHLGVAVNLITYDDRFALKNIETQLNTEIKAIPKHIDKRLYVAEYQNENELDTRVRDALARGEGQLLDIENTNEITPPVTNATTVMT---TNA 470          
BLAST of ATP dependent RNA helicase DDX6 vs. TrEMBL
Match: A0A0R3UJY7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7858 PE=3 SV=1)

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 297/440 (67.50%), Postives = 363/440 (82.50%), Query Frame = 2
Query:  263 LKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRGLPRSNKPSDEMKRETTEIGTEMAN 1582
            L LPPKD+R+KT DV++TKG++FE + L R+L+K I+EKGW  PSP+QE  IP A+SG DILARAKNGTGKTGAY +P+L +I+P +  +Q LILVPTRELALQTSQI  E+SKYL  ++MVTTGGT+L ED+ RL+  VH +I TPGR  D L R ++N E C TLVLDEADKLLS  F E++ +++  LP DRQI+LYSAT+PV++  F   HL++P +INLMEELTLKG+TQ+YAYV+EK+KVHCLNTLFSKL +NQ+IIFCNT QRVELLAKK+T+LGYSCYYIHARM QH+RNRVFHDFRAGHCRNLVCTDLFTRGIDIP+VNVVINFD+PKYAETYLHRIGRSGR+GHLG+AINLIT+DD Y LK IE+QL T+I+AIPK+IDKRLYVSEYQ  +  DE T++A+  G G+P  +K  D +   T  +  E+ N
Sbjct:   11 LTLPPKDDRLKTIDVISTKGNSFEDFCLKRNLLKGIYEKGWSTPSPVQESSIPMALSGRDILARAKNGTGKTGAYLVPILERIDPSIGKLQALILVPTRELALQTSQIATEVSKYLGIRIMVTTGGTNLVEDLARLDGAVHCLIATPGRTLDFLNRSILNMEKCHTLVLDEADKLLSTGFHEMIDDVIKTLPDDRQIMLYSATFPVSVQSFTKAHLKNPYEINLMEELTLKGVTQFYAYVQEKYKVHCLNTLFSKLQINQAIIFCNTAQRVELLAKKVTELGYSCYYIHARMPQHYRNRVFHDFRAGHCRNLVCTDLFTRGIDIPSVNVVINFDFPKYAETYLHRIGRSGRFGHLGVAINLITHDDCYHLKAIETQLRTEIKAIPKNIDKRLYVSEYQNLSTLDEETRRALSLGLGIPEESKERD-ISSPTNTLPVEVEN 449          
BLAST of ATP dependent RNA helicase DDX6 vs. TrEMBL
Match: A0A087VZ41 (ATP dependent RNA helicase DDX6 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000123700 PE=3 SV=1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 293/419 (69.93%), Postives = 353/419 (84.25%), Query Frame = 2
Query:  260 SLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRGLP 1516
            SL LPPKD R+KT DV++ KG++FE + L RDL+K I+EKGW  PSP+QE  IP A+SG DILARAKNGTGKTGAY +P+L +I+  +  +Q LILVPTRELALQTSQI  E+SKYL  K+MVTTGGT+L +D+ RL+  VH +I TPGRI D L R ++  E C TLVLDEADKLLS  F E + +++  LP+DRQI+LYSAT+P+++  F   HL++P +INLMEELTLKG+TQ+YAYV+EKHKVHCLNTLFSKL +NQ+IIFCNT QRVELLAKK+T+LGYSCYYIHARM QH+RNRVFHDFRAGHCRNLVCTDLFTRGIDIP+VNVVINFD+PKYAETYLHRIGRSGR+GHLG+AINLIT+DD Y LK IE+QL T+I+AIPKDIDKRLYVSEYQ  ++ DE T++A+  G G+P
Sbjct:   13 SLALPPKDERLKTIDVMSIKGNSFEDFCLKRDLLKGIYEKGWSTPSPVQESSIPMALSGRDILARAKNGTGKTGAYLVPILERIDASVNKLQALILVPTRELALQTSQIATEVSKYLGIKIMVTTGGTNLADDLARLDGAVHCLIATPGRIIDFLNRSILKMEQCSTLVLDEADKLLSSGFNETIPDVIKNLPEDRQIMLYSATFPLSVQSFTKAHLKNPYEINLMEELTLKGVTQFYAYVQEKHKVHCLNTLFSKLQINQAIIFCNTAQRVELLAKKVTELGYSCYYIHARMPQHYRNRVFHDFRAGHCRNLVCTDLFTRGIDIPSVNVVINFDFPKYAETYLHRIGRSGRFGHLGVAINLITHDDCYHLKVIENQLRTEIKAIPKDIDKRLYVSEYQNVSSLDEETRRALSMGLGIP 431          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Cavefish
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:103046116])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 278/408 (68.14%), Postives = 334/408 (81.86%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENN 1468
            DWKK+LKLPPKD R+KT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+     +Q L++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V      + +VLDEADKLLS+DF ++M  ILS L K RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK  ETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E++
Sbjct:   72 DWKKNLKLPPKDMRMKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDCIQALVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDETVHVVIATPGRILDLIKKGVAKVGQVQMIVLDEADKLLSQDFVQMMEEILSFLAKQRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLGETYLHRIGRSGRFGHLGLAINLITYDDRFNLKGIEEQLGTEIKPIPSSIDKSLYVAEYHSESS 479          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Cavefish
Match: ENSAMXT00000045184.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:103037120])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 278/407 (68.30%), Postives = 335/407 (82.31%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIEN 1465
            DWKKSL+LPPKDNR+KT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +P+L +I+     VQ +++VPTRELALQ SQI I+LSK+L   KVM TTGGT+L +DI RL+  VH++I TPGRI DL+K+ V   +  + +V+DEADKLLS+DF  ++ +I+S L K+RQILLYSAT+P ++ +FM KHL+ P +INLMEELTLKGITQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN+TQRVELLAKKIT LGYSC+YIHA+M Q +RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLIT +DR+ LK IE QL T I+ IP  IDK LYV+EY + N
Sbjct:   67 DWKKSLQLPPKDNRVKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPMLERIDLKKDHVQAMVMVPTRELALQVSQISIQLSKHLGGVKVMATTGGTNLRDDIMRLDETVHVIIATPGRILDLIKKGVAKVDKVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPTSVQKFMSKHLQKPYEINLMEELTLKGITQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITAEDRFNLKAIEDQLVTDIKPIPGSIDKSLYVAEYHLGN 473          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Cavefish
Match: ddx61 (probable ATP-dependent RNA helicase DDX6 [Source:NCBI gene;Acc:103044136])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 278/407 (68.30%), Postives = 333/407 (81.82%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIEN 1465
            DWKKSL+LPPKD R+KT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+     +Q +++VPTRELALQ SQICI +SK+L   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   +  + +V+DEADKLLS+DF  ++ +I+S L K+RQILLYSAT+PV++  FM KHLR P +INLM+ELTLKGITQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN+TQRVELLA+KI+ LGYSC+YIHA+M Q +RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGRYGHLG+AINLIT DDR+ LK IE QL T I+ IP  IDK LYV+E+   N
Sbjct:   63 DWKKSLQLPPKDTRVKTSDVTATKGNDFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDHIQAVVMVPTRELALQMSQICISMSKHLGGVKVMATTGGTNLKDDIMRLDETVHVVIATPGRILDLIKKGVAKVDKVQMMVMDEADKLLSQDFVVLIEDIISFLDKNRQILLYSATFPVSVQRFMAKHLRKPYEINLMDELTLKGITQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLARKISQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRYGHLGLAINLITSDDRFNLKTIEEQLVTDIKPIPGSIDKSLYVAEFHSTN 469          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Cavefish
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:103046116])

HSP 1 Score: 509.22 bits (1310), Expect = 6.533e-178
Identity = 249/408 (61.03%), Postives = 304/408 (74.51%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENN 1468
            DWKK+LKLPPKD R+KT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+     +Q L++VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V      + +VLDEADKLLS+DF ++M  ILS L K RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCT                                  GR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E++
Sbjct:   72 DWKKNLKLPPKDMRMKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDCIQALVIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDETVHVVIATPGRILDLIKKGVAKVGQVQMIVLDEADKLLSQDFVQMMEEILSFLAKQRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCT----------------------------------GRFGHLGLAINLITYDDRFNLKGIEEQLGTEIKPIPSSIDKSLYVAEYHSESS 445          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Cavefish
Match: eif4a3 (eukaryotic translation initiation factor 4A3 [Source:NCBI gene;Acc:103037591])

HSP 1 Score: 293.508 bits (750), Expect = 4.551e-94
Identity = 142/369 (38.48%), Postives = 233/369 (63.14%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF++  L  DL++ I+  G++ PS IQ++ I   + G D++A++++GTGKT  + + +L  ++  ++  Q LIL PTRELA Q  ++ + L  Y+  +     GGT++ EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L+K FKE + ++   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q++IFCNT ++V+ L +K+ +  ++   +H  M Q  R  +  +FR+G  R L+ TD++ RG+D+P V+++IN+D P   E Y+HRIGRSGRYG  G+AIN +  DD   L++IE    T+I+ +P ++
Sbjct:   34 TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNV 402          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Sea Lamprey
Match: ddx6 (DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN;Acc:ZDB-GENE-070912-83])

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 275/406 (67.73%), Postives = 335/406 (82.51%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIE 1462
            DWK  LKLPPKD R+KT+DV ATKG+ FE Y L R+L+  IFEKGW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +++     +Q L +VPTRELALQTSQICIELSK++   KVM TTGGT+L +DI RL+  VH++I TPGRI DL+ + +   +  + +VLDEADKLLS+DF +++ +I+  +P++RQILLYSAT+P+++ +FM +HL+ P +INLMEELTLKGITQ+YAYV E+ KVHCLNTLFSKL +NQSIIFCN+TQRVELLAKKIT LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVC+DLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGRYGHLG+AINLITY+DR+ LK IE QL T+I+ IP  IDK LYV+E+  E
Sbjct:   74 DWKAGLKLPPKDRRVKTSDVTATKGNEFEDYCLKRELLMGIFEKGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDMKKPYIQALTIVPTRELALQTSQICIELSKHMGGVKVMATTGGTNLRDDILRLDETVHVIIATPGRILDLINKGLAKVDAVQMIVLDEADKLLSQDFVQMLDDIIRAMPRNRQILLYSATFPLSVQKFMNRHLQKPYEINLMEELTLKGITQFYAYVNERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMKQEHRNRVFHDFRRGECRNLVCSDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRYGHLGLAINLITYEDRFNLKGIEEQLGTEIKPIPGTIDKSLYVAEFHSE 479          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.965 bits (611), Expect = 5.095e-74
Identity = 133/370 (35.95%), Postives = 213/370 (57.57%), Query Frame = 2
Query:  356 LMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKR-EVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEEL-TLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFC---NTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSE 1450
            L +A  + GW  P+ IQ + IP A+ G DI+  A+ G+GKTGA+ALP+L  +    Q +  L+L PTRELA Q S+    L   +  K  V  GG D+      L +  H++I TPGR+ D L+  +  N    K LV+DEAD++L+ DF+  +  IL  +PK+R+  L+SAT    + +     L+ P+K ++  +  T++ + QYY ++  K K   L  + ++LA N  IIFC   N TQR+ LL   + +LG++   +H +MSQ+ R    + F+      L+ TD+ +RG+DIP V+VVINFD P +++ Y+HR+GR+ R G  G +I  ++  D    + IE  +  K+ A P + ++ + ++E
Sbjct:    6 LCEACEQLGWKQPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQALLDAPQRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKGFNIRALKYLVMDEADRILNMDFETEVDKILKVIPKERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKLQQYYVFIPAKFKDSYLVYILNELAGNSFIIFCSTCNNTQRIALL---LRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVELFQRIEHLIGKKLPAFPTNEEEVMMLTE 372          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Sea Lamprey
Match: ddx39aa (DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa [Source:ZFIN;Acc:ZDB-GENE-030131-4275])

HSP 1 Score: 205.682 bits (522), Expect = 5.321e-61
Identity = 128/389 (32.90%), Postives = 213/389 (54.76%), Query Frame = 2
Query:  308 LATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYL-KFKVMVTTGGTDLT--EDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDF-KEIMSNILSCLPKDRQILLYSATYPVTLHEFMMK-HLRSPIKINLMEE--LTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLIT-YDDRYALKEIESQLDTKIEAIPKDIDKRLYVSE 1450
            ++   S F  + L  +L++AI + G++ PS +Q + IP A+ G D+L +AK+G GKT  + L  L ++ P    V  L++  TRELA Q S+     SKY+   KV V  GG  +   E++ + N P H+V+GTPGR+  L + + +N ++ K  +LDE DK+L +      +  +L   P   Q+LL +    +T+           P+++ + +E  LTL G+ QYY  +K+  K   L  L   L  NQ +IF  + QR   LA+ + +  +    IH  M+Q  R   +  F+    R LV T+LF RG+DI  VN+V N+D P+ ++TYLHR+ R+GR+G  G+A+  ++  +D   L +++ + +  +  +P +ID   Y+ +
Sbjct:   39 VSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPTDGQVSVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGLSIKKDEEVLKKNCP-HIVVGTPGRLA-LSRNKTLNLKHVKHFILDECDKMLEQLVTASEVEQLLHISP--HQLLLDACFADLTVVLCCSSWQCYPPMEVFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCMALAQLLIEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAVTFVSDENDAKILNDVQDRFEVNVSELPDEIDLSSYIEQ 423          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 211.46 bits (537), Expect = 2.130e-59
Identity = 121/401 (30.17%), Postives = 215/401 (53.62%), Query Frame = 2
Query:  356 LMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKIN-----PDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKR---EVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLM-EELTLKGITQYYAYVKEKHKVHCLNTLFS----KLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPT--KKAIISGRGL 1513
            ++  + ++ ++ P+PIQ Q IPA MSG D++  AK G+GKT  + LP+   +       + +   G+I+ PTRELALQ ++ C + +K L  +V+   GGT ++E I  L R   +++ TPGR+ D+L      V N      +VLDEAD++    F+  +  I+     DRQ +++SAT+P  +     + L  P+++ +    +    + Q+   ++E  K + L  L      K AV   I+F +  +  + L K +    Y C  +H  + Q+ R+ + +DF++G CR +V T +  RG+D+  + +V+N+D P + E Y+HR+GR+GR G+ G +   IT +      +I   L+     +P D++ RL+ +E++ +   +  T  K +  SG+G 
Sbjct:  380 ILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQRPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRIIETSRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCSDVEQHVIVIEEDTKFYKLLELLGLYQEKGAV---IVFVDKQEHADTLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVKHLIMVVNYDCPNHYEDYVHRVGRTGRAGNKGYSYTFITSEQERYSGDIIKALELSGTPLPPDLE-RLW-TEFREKQKAEGKTMRKSSGFSGKGF 775          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Sea Lamprey
Match: DDX54 (DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:20084])

HSP 1 Score: 198.749 bits (504), Expect = 1.253e-58
Identity = 116/362 (32.04%), Postives = 187/362 (51.66%), Query Frame = 2
Query:  290 IKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINP-DLQA-VQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAV---NQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDD 1360
            +K  +    K   F+S  L+  + K +  KG+ +P+PIQ + IP  + G D++A A+ G+GKT A+ +P+  +++    QA  + L+L PTRELALQTS+   EL K+   K  +  GG  + +    L+    ++IGTPGR+  ++    +  +  + +V DEAD+L    F E ++ I+  LP  RQ LL+SAT P  L EF    L  P+ I L  +  L    +            C+     +  V    Q+++F  T   VE L + ++  G SC YI++ + Q  R      F       L+ TD+  RGID P ++ VIN+++P   + ++HR+GR  R G  G A +L+  D+
Sbjct:   22 VKQQNCKKKKSGGFQSMGLSYPVFKGVMGKGYKVPTPIQRKCIPVILEGRDVVAMARTGSGKTAAFLVPMFERLHARSAQAGARALVLSPTRELALQTSKFTKELGKHTGLKTALILGGDRMEDQFAALHENPDIIIGTPGRLMHVVVEMNLKLQAMEYVVFDEADRLFEMGFAEQLTEIIRRLPDSRQTLLFSATLPKQLVEFARAGLSDPVLIRLDVDSKLSDQLKLAFMCSRADDKPCVLLHLLRTVVKPHEQTVVFVATKHHVEYLRELVSQAGMSCAYIYSALDQTERKINVGKFVHKKTMLLIVTDVAARGID-PMLDNVINYNFPGKPKLFIHRVGRVARAGRSGTAYSLVAPDE 382          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Yeast
Match: DHH1 (Cytoplasmic DEAD-box helicase, stimulates mRNA decapping; coordinates distinct steps in mRNA function and decay, interacting with both decapping and deadenylase complexes; role in translational repression, mRNA decay, and possibly mRNA export; interacts and cooperates with Ngr1p to promote specific mRNA decay; ATP- and RNA-bound form promotes processing body (PB) assembly, while ATPase stimulation by Not1p promotes PB disassembly; forms cytoplasmic foci on replication stress [Source:SGD;Acc:S000002319])

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 259/403 (64.27%), Postives = 319/403 (79.16%), Query Frame = 2
Query:  242 DCDWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSE 1450
            D DWK +L +P KD R +T+DVL TKG+TFE ++L R+L+  IFE G++ PSPIQE+ IP A++G DILARAKNGTGKT A+ +P L K+ P L  +Q LI+VPTRELALQTSQ+   L K+     MVTTGGT+L +DI RLN  VH+++GTPGR+ DL  R+V +   C   ++DEADK+LS+DFK I+  ILS LP   Q LL+SAT+P+T+ EFM+KHL  P +INLMEELTLKGITQYYA+V+E+ K+HCLNTLFSKL +NQ+IIFCN+T RVELLAKKITDLGYSCYY HARM Q  RN+VFH+FR G  R LVC+DL TRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLI ++DR+ L +IE +L T+I AIP  IDK LYV+E
Sbjct:   19 DRDWKTALNIPKKDTRPQTDDVLNTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAE 421          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Yeast
Match: FAL1 (Nucleolar protein required for maturation of 18S rRNA; member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases; 18S rRNA biogenesis defect of the null mutant is functionally complemented by human EIF4A3 [Source:SGD;Acc:S000002428])

HSP 1 Score: 292.352 bits (747), Expect = 1.200e-94
Identity = 149/370 (40.27%), Postives = 231/370 (62.43%), Query Frame = 2
Query:  323 STFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNR-PVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSK--DFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIP 1417
            STFES +L  DL++ I+  G++ PS IQ + I   +SG D++A+A++GTGKT  + + LL  I+   + +Q LIL PTRELA Q  Q+   L  Y+       TGG  L +D+ ++ +     V GTPGR+ D++K++++     + LVLDEAD+LLS+   FK+ + +I + LPK+ Q+++ SAT    + E   K +  P+KI +  +E++L+GI QY   V KE+ K   L  ++  L + Q +IFCNT ++V+ L++++    ++   +H  M Q  R++V +DFR GH R L+ TD++ RGID+  V++VIN+D P+  E Y+HRIGRSGR+G  G+AIN IT  D   L+EIE     KI  +P
Sbjct:   23 STFESMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKKDLQALILSPTRELASQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKHGCQAVSGTPGRVLDMIKKQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNCQVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIKQYVVNVDKEEWKFDTLCDIYDSLTITQCVIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFITKADLAKLREIEKFYSIKINPMP 392          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Yeast
Match: TIF1 (Translation initiation factor eIF4A; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G; protein abundance increases in response to DNA replication stress; TIF1 has a paralog, TIF2, that arose from the whole genome duplication [Source:SGD;Acc:S000001767])

HSP 1 Score: 281.952 bits (720), Expect = 1.153e-90
Identity = 154/386 (39.90%), Postives = 248/386 (64.25%), Query Frame = 2
Query:  278 KDNRIKTN-DVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLM-EELTLKGITQYYAYVKEK-HKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            ++++I+TN D +  K   F+   L+ +L++ +F  G++ PS IQ++ I   + G+D+LA+A++GTGKTG +++  L +I+  ++A Q L+L PTRELALQ  ++ + L+ ++  KV    GGT   ED   L R   +V+GTPGR+ D ++R     +  K  +LDEAD++LS  FKE +  I + LP   Q++L SAT P  + E   K +R+P++I +  +ELTL+GI Q+Y  V+E+ +K  CL  L+  ++V Q++IFCNT ++VE L  K+ +  ++   I++ + Q  R+ +  +FR+G  R L+ TDL  RGID+  V++VIN+D P   E Y+HRIGR GR+G  G+AIN +T +D  A++E+E    T+IE +P DI
Sbjct:    9 EESQIQTNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL-RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDI 390          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Yeast
Match: TIF2 (Translation initiation factor eIF4A; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G; protein abundance increases in response to DNA replication stress; TIF2 has a paralog, TIF1, that arose from the whole genome duplication [Source:SGD;Acc:S000003674])

HSP 1 Score: 281.952 bits (720), Expect = 1.153e-90
Identity = 154/386 (39.90%), Postives = 248/386 (64.25%), Query Frame = 2
Query:  278 KDNRIKTN-DVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLM-EELTLKGITQYYAYVKEK-HKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            ++++I+TN D +  K   F+   L+ +L++ +F  G++ PS IQ++ I   + G+D+LA+A++GTGKTG +++  L +I+  ++A Q L+L PTRELALQ  ++ + L+ ++  KV    GGT   ED   L R   +V+GTPGR+ D ++R     +  K  +LDEAD++LS  FKE +  I + LP   Q++L SAT P  + E   K +R+P++I +  +ELTL+GI Q+Y  V+E+ +K  CL  L+  ++V Q++IFCNT ++VE L  K+ +  ++   I++ + Q  R+ +  +FR+G  R L+ TDL  RGID+  V++VIN+D P   E Y+HRIGR GR+G  G+AIN +T +D  A++E+E    T+IE +P DI
Sbjct:    9 EESQIQTNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL-RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDI 390          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Yeast
Match: SUB2 (Component of the TREX complex required for nuclear mRNA export; member of the DEAD-box RNA helicase superfamily and is involved in early and late steps of spliceosome assembly; homolog of the human splicing factor hUAP56; relocalizes from nucleus to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000002242])

HSP 1 Score: 229.18 bits (583), Expect = 8.001e-70
Identity = 130/394 (32.99%), Postives = 217/394 (55.08%), Query Frame = 2
Query:  293 KTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYL-KFKVMVTTGGTDLTEDICRL---NRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSK-DFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEE--LTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITY-DDRYALKEIESQLDTKIEAIPKD-IDKRLYVS 1447
            K    +    + F+ + L  +L +AI + G++ PS +Q+  IP ++ G D+L +AK+G GKT  + L  L +++P    V  +++   RELA Q     +  SKY+   K  V  GGT +++D   L   +   H+V+ TPGR++ L++ + I+  + K  V+DE DK+L + D +  +  I    P+D+Q++++SAT    +     + L++P++I + +E  LTL G+ QYY  ++E+ K   L  L   L  NQ IIF  +T R   L K +    +    +H  M Q  R   +  F+    R  V TD+F RGIDI  +N+ IN+D    A+ YLHR+GR+GR+G  G+AI+ ++  +D   L +I+ + D KI   P++ ID   Y++
Sbjct:   52 KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKEDEEVLAKIQERFDVKIAEFPEEGIDPSTYLN 445          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Nematostella
Match: EDO39940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H2])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 271/409 (66.26%), Postives = 340/409 (83.13%), Query Frame = 2
Query:  251 WKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            WK +LKLPPKDNR KT+DV ATKG+ FE Y L R+L+  IFEKG+D PSPIQE+ IP A++G DILARAKNGTGKT AY +PLL + +     +Q L+LVPTRELALQTSQICIEL K++  +VMVTTGGT L +DI RL   VH+++ TPGR+ DL+K+++ +   C+ LV+DEADKLLS DFK+++  I+  LP++RQILL+SAT+P+++ +F  KHLR P +INLM+ELTL G+TQYYA+V+EK KVHCLNTLF KL +NQSIIFCN+ QRVELLA+KI +LG+SC+YIHARMSQ  RNRVFHDFR GHCRNLVC+DLFTRGIDI +VNVVINFD+PK +ETYLHRIGRSGR+GHLG+AINLITYDDR+ L +IE++LDT+I+ IP  IDK++YV+E+Q +   DE
Sbjct:   23 WKANLKLPPKDNRFKTSDVTATKGNEFEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGGTSLKDDILRLYNKVHVIVATPGRVLDLMKKKLADMSKCQMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPISVRDFKEKHLRKPYEINLMDELTLHGVTQYYAFVEEKQKVHCLNTLFQKLQINQSIIFCNSVQRVELLARKILELGFSCFYIHARMSQSHRNRVFHDFRQGHCRNLVCSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDRFDLYKIENELDTEIKPIPSVIDKKVYVAEFQQQQPDDE 431          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Nematostella
Match: EDO48460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIU5])

HSP 1 Score: 299.286 bits (765), Expect = 8.872e-97
Identity = 145/369 (39.30%), Postives = 233/369 (63.14%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            TF++  L  DL++ I+  G++ PS IQ++ I   + G D++A+A++GTGKT  +++ +L  I+  L+  Q L+L PTRELA Q  ++ + L  Y+  +     GGT++ EDI +L+   H+V GTPGR+ D+++R  +     K LVLDEAD++L+K FKE + ++   LP   Q++L SAT P  + E   K +  PI+I +  +ELTL+GI Q++  V +E+ K   L  L+  L + Q++IFCNT ++V+ L +K+ +  ++   +H  M Q  R  +  DFRAG  R L+ TD++ RG+D+  V++VIN+D P   E Y+HRIGRSGR+G  G+AIN +  DD   L++IE    T+I+ +P ++
Sbjct:   35 TFDAMKLREDLLRGIYAYGFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLDYGQHIVSGTPGRVFDMIRRRNLRTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVASMHGDMPQKEREAIMKDFRAGQSRVLISTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNV 403          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Nematostella
Match: EDO45225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTJ5])

HSP 1 Score: 269.24 bits (687), Expect = 3.921e-85
Identity = 148/375 (39.47%), Postives = 233/375 (62.13%), Query Frame = 2
Query:  326 TFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQ------AVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYV-KEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDI 1426
            +F+  +L   L++ I+  G++ PS IQ++ I       D++A+A++GTGKT  +A+ +L +I+ + +        Q L+L PTRELA Q  ++ + L  Y+  K     GGT++ ED  +L   VH+V+GTPGR+ D++ R V+N    K  VLDEAD++LS+ FK+ + ++ + LP   Q++L SAT P  + E   K +R  ++I +  EE+TL+GI Q++  V KE  K+  L  L+  L + Q++IF NT ++V+ LA K+T+  ++   +H  MSQ  R+ +  +FR+G  R L+ TDL  RGID+  V++VIN+D P   E Y+HRIGR GR+G  G AIN +T DD   LK+IE   +TKIE +P ++
Sbjct:   34 SFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQARDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVKCHACIGGTNVREDRMKLEEGVHVVVGTPGRVFDMINRGVLNTRDIKLFVLDEADEMLSRGFKDQIYDVFTRLPTSVQVVLLSATMPTDVLEVTNKFMRDVVRILVKREEVTLEGIKQFFVLVEKEDWKLDTLCDLYETLTITQAVIFANTRRKVDWLAAKMTEKDHTVSSMHGDMSQKERDIIMKEFRSGSSRVLITTDLLARGIDVHQVSLVINYDLPSNRENYIHRIGRGGRFGRKGAAINFVTNDDVRMLKDIEQYYNTKIEEMPMNV 408          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Nematostella
Match: EDO46214 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQR7])

HSP 1 Score: 244.973 bits (624), Expect = 6.393e-76
Identity = 138/389 (35.48%), Postives = 219/389 (56.30%), Query Frame = 2
Query:  284 NRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQ-ICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINL-MEELTLKGITQYYAYVKE--------KHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYD-DRYALKEIESQLDTKIEAIP 1417
             R +T DVL  +   F S  L+  L++ + E G++ PSPIQ + IP    G D++A+AK+GTGKT  +++  L  +  +   +Q +IL PTRE+A+Q    IC     Y      V  GG  L ED   L +  H+ +GTPGR++ L++++ +  E  +  +LDEADKLL + F++ ++ I S LP+++Q++ +SATYP  L   + K++  P  + L   + +L+GI Q+Y+ V+         + KV  L  L S +  NQ ++F N   R + L+  +   G+   +I    +Q  R       ++ HCR L+ TDL  RGID   VN+V+N D P   ETYLHRIGR+GR+G  G+A+  +    +   L++IE  +D K+E +P
Sbjct:    8 QRKRTTDVLIEEQIDFHSLLLSPTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYDGLACKVFIGGISLEEDKKAL-KSCHIAVGTPGRVKYLIEQKYLKTESVRMFILDEADKLLDESFQQQINWIFSALPENKQMMAFSATYPEVLANHLKKYMTEPTFVRLNAADPSLQGIKQFYSLVRFHPLPHKTFQEKVDGLIKLLSSVNFNQCLVFSNYQIRAKSLSDTLCRKGWPSTFIAGYQTQAKRLEAMEKLKSFHCRILISTDLTARGIDAENVNLVVNMDVPHNGETYLHRIGRAGRFGTEGMAVTYVANGKEERELRDIERSIDVKMELLP 395          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Nematostella
Match: EDO33593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU4])

HSP 1 Score: 238.039 bits (606), Expect = 1.081e-72
Identity = 128/367 (34.88%), Postives = 209/367 (56.95%), Query Frame = 2
Query:  323 STFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKR-EVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEEL-TLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIP 1417
            +TF+S  +   L +A  + GW  PS IQ + IP A+ G D++  A+ G+GKTGA+ALP+L  +  + Q +  LIL PTRELA Q S+ C  L   +  K  V  GG D+      L +  H++I TPGR+ D L+  +  +    K LV+DEAD++L+ DF++ +  +L  +PK+R+  L+SAT    + +     L++P+K+ +  +  T++ + Q Y ++  K K   L  + ++LA N  ++FC T   V+ +   + +LG     +H +MSQ  R    + F++     LV TD+ +RG+DIP V+VVINFD P +++ Y+HR+GR+ R G  G ++  +T  D    + IE  +  K+   P
Sbjct:   14 TTFKSLGVVDALCEACKQLGWKTPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGVKCAVIVGGIDMMSQALMLAKKPHIIIATPGRLIDHLENTKGFSLRTLKYLVMDEADRILNMDFEKEVDKLLKVIPKERRTFLFSATMTKKVQKLQRASLQAPVKVEVATKYQTVEKLQQSYLFIPSKFKDCYLVYVLNELAGNSFMVFCGTCNNVQRVTLMLRNLGLDAVPLHGQMSQSKRLGALNKFKSKSRSILVATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGRSVTFVTQYDVELYQRIEHLIAKKLPQYP 380          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Medaka
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:101169303])

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 280/408 (68.63%), Postives = 330/408 (80.88%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENN 1468
            DWKKSLKLPPKD RIKT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+     +Q L +VPTRELALQ SQICI++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V      + +VLDEADKLLS+DF  +M  IL  LPK RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK  ETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E  
Sbjct:   67 DWKKSLKLPPKDTRIKTSDVTATKGNEFEDYCLKRELLMGIFEMGWERPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKRDCIQALGIVPTRELALQVSQICIQVSKHMGGVKVMATTGGTNLRDDIMRLDETVHVVIATPGRILDLIKKGVAKVNQVQMIVLDEADKLLSQDFVVMMEEILGFLPKQRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLGETYLHRIGRSGRFGHLGLAINLITYDDRFNLKGIEEQLGTEIKPIPGIIDKSLYVAEYHSEGG 474          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Medaka
Match: ENSORLT00000028513.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 274/403 (67.99%), Postives = 333/403 (82.63%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEY 1453
            DWK+SL LPPKDNR+KT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+     +Q +++VPTRELALQ SQI I++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   +  + +V+DEADKLLS+DF  ++ +I+S L K+RQILLYSAT+P+++ +FM KHL+ P +INLMEELTLKGITQ+YAYV E+ KVHCLNTLFS+L +NQSIIFCN+TQRVELLAKKIT LGYSC+YIHA+M Q +RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLIT +DR+ LK IE QL T I+ IP  IDK LYV+EY
Sbjct:   64 DWKRSLLLPPKDNRVKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDHIQAIVMVPTRELALQVSQISIQISKHMGGVKVMATTGGTNLRDDIMRLDEIVHVVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPMSVQKFMAKHLQKPYEINLMEELTLKGITQFYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITSEDRFNLKAIEEQLVTDIKPIPSSIDKSLYVAEY 466          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Medaka
Match: ENSORLT00000045064.1 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 274/403 (67.99%), Postives = 333/403 (82.63%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEY 1453
            DWK+SL LPPKDNR+KT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I+     +Q +++VPTRELALQ SQI I++SK++   KVM TTGGT+L +DI RL+  VH+VI TPGRI DL+K+ V   +  + +V+DEADKLLS+DF  ++ +I+S L K+RQILLYSAT+P+++ +FM KHL+ P +INLMEELTLKGITQ+YAYV E+ KVHCLNTLFS+L +NQSIIFCN+TQRVELLAKKIT LGYSC+YIHA+M Q +RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLIT +DR+ LK IE QL T I+ IP  IDK LYV+EY
Sbjct:   64 DWKRSLLLPPKDNRVKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDHIQAIVMVPTRELALQVSQISIQISKHMGGVKVMATTGGTNLRDDIMRLDEIVHVVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPMSVQKFMAKHLQKPYEINLMEELTLKGITQFYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITSEDRFNLKAIEEQLVTDIKPIPSSIDKSLYVAEY 466          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Medaka
Match: ddx6 (DEAD-box helicase 6 [Source:NCBI gene;Acc:101169303])

HSP 1 Score: 507.679 bits (1306), Expect = 1.450e-177
Identity = 252/405 (62.22%), Postives = 293/405 (72.35%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIE 1462
            DWKKSLKLPPKD RIKT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I                                            DL  D  +    VH+VI TPGRI DL+K+ V      + +VLDEADKLLS+DF  +M  IL  LPK RQILLYSAT+P+++ +FM  HL+ P +INLMEELTLKG+TQYYAYV E+ KVHCLNTLFS+L +NQSIIFCN++QRVELLAKKI+ LGYSC+YIHA+M Q  RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK  ETYLHRIGRSGR+GHLG+AINLITYDDR+ LK IE QL T+I+ IP  IDK LYV+EY  E
Sbjct:   67 DWKKSLKLPPKDTRIKTSDVTATKGNEFEDYCLKRELLMGIFEMGWERPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERI--------------------------------------------DLKRDCIQ----VHVVIATPGRILDLIKKGVAKVNQVQMIVLDEADKLLSQDFVVMMEEILGFLPKQRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLGETYLHRIGRSGRFGHLGLAINLITYDDRFNLKGIEEQLGTEIKPIPGIIDKSLYVAEYHSE 423          
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Medaka
Match: ENSORLT00000011518.2 (probable ATP-dependent RNA helicase ddx6 [Source:NCBI gene;Acc:101166148])

HSP 1 Score: 502.286 bits (1292), Expect = 2.296e-175
Identity = 248/402 (61.69%), Postives = 297/402 (73.88%), Query Frame = 2
Query:  248 DWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEY 1453
            DWK+SL LPPKDNR+KT+DV ATKG+ FE Y L R+L+  IFE GW+ PSPIQE+ IP A+SG DILARAKNGTGK+GAY +PLL +I                                            DL +D  +    VH+VI TPGRI DL+K+ V   +  + +V+DEADKLLS+DF  ++ +I+S L K+RQILLYSAT+P+++ +FM KHL+ P +INLMEELTLKGITQ+YAYV E+ KVHCLNTLFS+L +NQSIIFCN+TQRVELLAKKIT LGYSC+YIHA+M Q +RNRVFHDFR G CRNLVCTDLFTRGIDI  VNVVINFD+PK AETYLHRIGRSGR+GHLG+AINLIT +DR+ LK IE QL T I+ IP  IDK LYV+EY
Sbjct:   64 DWKRSLLLPPKDNRVKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERI--------------------------------------------DLKKDHIQ----VHVVIATPGRILDLIKKGVAKVDRVQMIVMDEADKLLSQDFVVLIEDIISFLAKNRQILLYSATFPMSVQKFMAKHLQKPYEINLMEELTLKGITQFYAYVTERQKVHCLNTLFSRLQINQSIIFCNSTQRVELLAKKITQLGYSCFYIHAKMMQEYRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLITSEDRFNLKAIEEQLVTDIKPIPSSIDKSLYVAEY 417          
BLAST of ATP dependent RNA helicase DDX6 vs. Planmine SMEST
Match: SMESG000027870.1 (SMESG000027870.1)

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 449/449 (100.00%), Postives = 449/449 (100.00%), Query Frame = 2
Query:  254 KKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRGLPRSNKPSDEMKRETTEIGTEMANSNTNAN 1600
            KKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRGLPRSNKPSDEMKRETTEIGTEMANSNTNAN
Sbjct:    6 KKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRGLPRSNKPSDEMKRETTEIGTEMANSNTNAN 454          
BLAST of ATP dependent RNA helicase DDX6 vs. Planmine SMEST
Match: SMESG000073910.1 (SMESG000073910.1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 295/452 (65.27%), Postives = 371/452 (82.08%), Query Frame = 2
Query:  251 WKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRG----LPRSNKPSDEMKRETTEIGTEMANSNTN 1594
            WK  L +P KDNRIKT DV AT+G++F+ + L RD++K I+EKGW+MPSPIQE  IP ++ G DILARAKNGTGKTGAY++PLL KI+P +  +QG+ILVPTRELALQTSQIC EL+K+ + K+MVTTGGT L +DI RL + VH+++ TPGR+ DL+KR++++  +CK LV+DEADKLLS DF+E++  I+  LP  RQI+LYSAT+P ++ +F+ KH+R P +INLM+ELTLKGI+QYYAYV+E+ KVHCLNTLFS+L +NQSIIFCNT QRVELLAKKITDLGYSCYYIHA+M+Q +RNRVFH+FR G+CRNLVCTDLFTRGIDIP+VNVVINFD+PKYAETYLHRIGRSGRYGHLG+A+NLITYDDR+ALK IE+QL+T+I+AIPK IDKRLYV+EYQ EN  D   +  +  G G    +  +N+ +  +   T+ I T  A S  N
Sbjct:   26 WKNYLNIPEKDNRIKTVDVTATQGNSFDDFCLKRDILKGIYEKGWEMPSPIQEASIPISLIGRDILARAKNGTGKTGAYSIPLLEKIDPSINQIQGIILVPTRELALQTSQICTELAKHTETKIMVTTGGTSLKDDIVRLQQTVHIILATPGRVNDLIKRDIVSTNFCKILVIDEADKLLSADFEEVIDYIIGKLPAQRQIMLYSATFPQSVQQFLEKHMRDPYEINLMDELTLKGISQYYAYVQERQKVHCLNTLFSRLQINQSIIFCNTAQRVELLAKKITDLGYSCYYIHAKMNQVYRNRVFHEFRNGNCRNLVCTDLFTRGIDIPSVNVVINFDFPKYAETYLHRIGRSGRYGHLGVAVNLITYDDRFALKNIETQLNTEIKAIPKHIDKRLYVAEYQNENELDSRIRDVLARGEGQLLDIETTNEINAPISNATSSIMTANAKSAPN 477          
BLAST of ATP dependent RNA helicase DDX6 vs. Planmine SMEST
Match: SMESG000001583.1 (SMESG000001583.1)

HSP 1 Score: 486.108 bits (1250), Expect = 3.167e-168
Identity = 240/415 (57.83%), Postives = 305/415 (73.49%), Query Frame = 2
Query:  245 CDWKKSLKLPPKDNRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLN---RPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYALKEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDE 1477
            C+ +  LK     +RI+T+DVL     +F+ + LNRD++ A++E GW+ PSPIQ   IP+ + G +++ARAKNGTGKTGAYA+ ++N +     +VQ ++LVPTRELALQTS  CI L+KYL+   +MV+TGGTD+T+DICRLN   +PV  ++ TPGR  D +    I  +  K  VLDEADKL+S DFK I+ +IL+ L   RQ++L+SATYP  L  F+ K++    KINLM ELTLKG+TQYYAY+KE+ K+ CL  L   L V+Q+IIFC+T  RVELLAK I ++GYSCYY HA+M Q  RN+VF DFRAGH RNLVCTD+ TRGIDIP VNVV NFD+PK+ ETYLHRIGR GR+GHLGIAINLIT  D     EIE QL  KI AIPKDIDKRLYV+ +Q+E+ FDE
Sbjct:   67 CETRSILK-----SRIQTSDVLQQSNVSFDDFKLNRDILMALYEMGWEWPSPIQAISIPSIIDGENVIARAKNGTGKTGAYAIGIINNLTTS-NSVQCIVLVPTRELALQTSNECINLAKYLQGINIMVSTGGTDVTDDICRLNNSAQPVQFLVATPGRALDFITNNQIKTKDIKYFVLDEADKLMSNDFKSIIIDILAHLDSKRQMILFSATYPENLKSFIDKYMPLSKKINLMNELTLKGVTQYYAYLKEEQKLCCLKILLKNLEVHQAIIFCSTMLRVELLAKSIINMGYSCYYTHAKMDQKSRNQVFVDFRAGHVRNLVCTDVMTRGIDIPRVNVVFNFDFPKHTETYLHRIGRCGRFGHLGIAINLITKRDLKYFFEIEQQLACKIVAIPKDIDKRLYVASHQLESCFDE 475          
BLAST of ATP dependent RNA helicase DDX6 vs. Planmine SMEST
Match: SMESG000073847.1 (SMESG000073847.1)

HSP 1 Score: 334.339 bits (856), Expect = 6.262e-110
Identity = 165/323 (51.08%), Postives = 228/323 (70.59%), Query Frame = 2
Query:  284 NRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVNV 1249
            NRI+T DV  +  ++FES ++N +++ A+ E  W  PSPIQE  IP  M G +++AR+KNGTGKTGA+A+ +LN I+P  +++Q LIL PTRELALQT  +C+ LSKYL   K+MV+TGGT+L+ED+ RL++ ++++IGTPGRI DLL     +  +   L+LDEADKLLS DF+  + +I++ LP   Q +L+SATYPV L  F+ +++ +    N+M EL LKG+TQ+YAY+KE  K              Q+IIFCN+++RVELL K + + GYS YYIH++MSQ  RNRVFHDFR G    LVCTD+ TRGID+  VNV
Sbjct:   99 NRIRTTDVKPSPDASFESLNINSNILLAMTENQWHCPSPIQEISIPKIMEGKNVVARSKNGTGKTGAFAVSMLNTIDPK-KSLQVLILTPTRELALQTGNVCLTLSKYLNNIKIMVSTGGTNLSEDLYRLSKSINIIIGTPGRILDLLIYRFDSFAHVNILILDEADKLLSLDFQPFIEDIITNLPNRCQKVLFSATYPVNLKSFVKRYIVNCEYCNVMNELALKGVTQFYAYLKENQK--------------QAIIFCNSSKRVELLVKFVIEAGYSSYYIHSKMSQEARNRVFHDFRCGFVTFLVCTDIMTRGIDVSNVNV 406          
BLAST of ATP dependent RNA helicase DDX6 vs. Planmine SMEST
Match: SMESG000073847.1 (SMESG000073847.1)

HSP 1 Score: 332.413 bits (851), Expect = 3.336e-109
Identity = 164/322 (50.93%), Postives = 227/322 (70.50%), Query Frame = 2
Query:  284 NRIKTNDVLATKGSTFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTGKTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLK-FKVMVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLDEADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPIKINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQRVELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTRGIDIPTVN 1246
            NRI+T DV  +  ++FES ++N +++ A+ E  W  PSPIQE  IP  M G +++AR+KNGTGKTGA+A+ +LN I+P  +++Q LIL PTRELALQT  +C+ LSKYL   K+MV+TGGT+L+ED+ RL++ ++++IGTPGRI DLL     +  +   L+LDEADKLLS DF+  + +I++ LP   Q +L+SATYPV L  F+ +++ +    N+M EL LKG+TQ+YAY+KE  K              Q+IIFCN+++RVELL K + + GYS YYIH++MSQ  RNRVFHDFR G    LVCTD+ TRGID+  VN
Sbjct:   99 NRIRTTDVKPSPDASFESLNINSNILLAMTENQWHCPSPIQEISIPKIMEGKNVVARSKNGTGKTGAFAVSMLNTIDPK-KSLQVLILTPTRELALQTGNVCLTLSKYLNNIKIMVSTGGTNLSEDLYRLSKSINIIIGTPGRILDLLIYRFDSFAHVNILILDEADKLLSLDFQPFIEDIITNLPNRCQKVLFSATYPVNLKSFVKRYIVNCEYCNVMNELALKGVTQFYAYLKENQK--------------QAIIFCNSSKRVELLVKFVIEAGYSSYYIHSKMSQEARNRVFHDFRCGFVTFLVCTDIMTRGIDVSNVN 405          
The following BLAST results are available for this feature:
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX60.000e+067.88DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX60.000e+067.88DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX60.000e+067.88DEAD-box helicase 6 [Source:HGNC Symbol;Acc:HGNC:2... [more]
EIF4A33.862e-9438.48eukaryotic translation initiation factor 4A3 [Sour... [more]
EIF4A33.862e-9438.48eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cgh-10.000e+067.15ATP-dependent RNA helicase cgh-1 [Source:UniProtK... [more]
Y65B4A.63.364e-9940.11pep chromosome:WBcel235:I:629492:636350:-1 gene:WB... [more]
F33D11.105.229e-9939.84pep chromosome:WBcel235:I:5866514:5868139:-1 gene:... [more]
inf-15.324e-9939.30Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
inf-15.324e-9939.30Eukaryotic initiation factor 4A [Source:UniProtKB... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
me31B0.000e+067.66gene:FBgn0004419 transcript:FBtr0079975[more]
me31B0.000e+067.92gene:FBgn0004419 transcript:FBtr0079976[more]
CG74839.027e-9639.57gene:FBgn0037573 transcript:FBtr0081834[more]
eIF4A1.084e-8940.76gene:FBgn0001942 transcript:FBtr0079178[more]
eIF4A1.084e-8940.76gene:FBgn0001942 transcript:FBtr0079175[more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx60.000e+068.06DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
ddx60.000e+068.06DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
ddx610.000e+067.15DEAD (Asp-Glu-Ala-Asp) box helicase 61 [Source:ZFI... [more]
ddx610.000e+067.15DEAD (Asp-Glu-Ala-Asp) box helicase 61 [Source:ZFI... [more]
eif4a31.505e-9338.48eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx60.000e+066.43DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
ddx60.000e+066.43DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
ddx60.000e+064.51DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
ddx67.091e-17660.10DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
ddx63.408e-17559.23DEAD-box helicase 6 [Source:NCBI gene;Acc:780039][more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx60.000e+067.88DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 [Source:M... [more]
Ddx60.000e+067.88DEAD (Asp-Glu-Ala-Asp) box polypeptide 6 [Source:M... [more]
Eif4a34.253e-9438.48eukaryotic translation initiation factor 4A3 [Sour... [more]
Eif4a3l15.129e-9338.21eukaryotic translation initiation factor 4A3 like ... [more]
Eif4a3l15.129e-9338.21eukaryotic translation initiation factor 4A3 like ... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95YF3|CGH1_CAEEL0.000e+067.15ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis... [more]
sp|Q0IHV9|DDX6_XENTR0.000e+067.72Probable ATP-dependent RNA helicase ddx6 OS=Xenopu... [more]
sp|P54824|DDX6_XENLA0.000e+067.72ATP-dependent RNA helicase ddx6 OS=Xenopus laevis ... [more]
sp|Q5ZKB9|DDX6_CHICK0.000e+068.13Probable ATP-dependent RNA helicase DDX6 OS=Gallus... [more]
sp|P54823|DDX6_MOUSE0.000e+067.88Probable ATP-dependent RNA helicase DDX6 OS=Mus mu... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IM450.000e+075.12Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0X3NQB90.000e+071.06ATP-dependent RNA helicase cgh-1 OS=Schistocephalu... [more]
A4UY080.000e+066.15DEAD box RNA helicase Me31B OS=Dugesia japonica OX... [more]
A0A0R3UJY70.000e+067.50Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A087VZ410.000e+069.93ATP dependent RNA helicase DDX6 OS=Echinococcus mu... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx60.000e+068.14DEAD-box helicase 6 [Source:NCBI gene;Acc:10304611... [more]
ENSAMXT00000045184.10.000e+068.30probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
ddx610.000e+068.30probable ATP-dependent RNA helicase DDX6 [Source:N... [more]
ddx66.533e-17861.03DEAD-box helicase 6 [Source:NCBI gene;Acc:10304611... [more]
eif4a34.551e-9438.48eukaryotic translation initiation factor 4A3 [Sour... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx60.000e+067.73DEAD (Asp-Glu-Ala-Asp) box helicase 6 [Source:ZFIN... [more]
ENSPMAT00000000216.15.095e-7435.95pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
ddx39aa5.321e-6132.90DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa [Sourc... [more]
ddx462.130e-5930.17DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
DDX541.253e-5832.04DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DHH10.000e+064.27Cytoplasmic DEAD-box helicase, stimulates mRNA dec... [more]
FAL11.200e-9440.27Nucleolar protein required for maturation of 18S r... [more]
TIF11.153e-9039.90Translation initiation factor eIF4A; DEA(D/H)-box ... [more]
TIF21.153e-9039.90Translation initiation factor eIF4A; DEA(D/H)-box ... [more]
SUB28.001e-7032.99Component of the TREX complex required for nuclear... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399400.000e+066.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484608.872e-9739.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452253.921e-8539.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462146.393e-7635.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335931.081e-7234.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx60.000e+068.63DEAD-box helicase 6 [Source:NCBI gene;Acc:10116930... [more]
ENSORLT00000028513.10.000e+067.99probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
ENSORLT00000045064.10.000e+067.99probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
ddx61.450e-17762.22DEAD-box helicase 6 [Source:NCBI gene;Acc:10116930... [more]
ENSORLT00000011518.22.296e-17561.69probable ATP-dependent RNA helicase ddx6 [Source:N... [more]
back to top
BLAST of ATP dependent RNA helicase DDX6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027870.10.000e+0100.00SMESG000027870.1[more]
SMESG000073910.10.000e+065.27SMESG000073910.1[more]
SMESG000001583.13.167e-16857.83SMESG000001583.1[more]
SMESG000073847.16.262e-11051.08SMESG000073847.1[more]
SMESG000073847.13.336e-10950.93SMESG000073847.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023369 ID=SMED30023369|Name=ATP dependent RNA helicase DDX6|organism=Schmidtea mediterranea sexual|type=transcript|length=1611bp
GATTAAATGATTAATTATAAAGAATTATAGAATCTATTAACTAAATAAGA
TTATCAGTTTGTTTAAACAGTAACACGATAACAACGAATACGTAGAAATT
GATCTTTTATTTTGAATCGCTTTCCCATCAATTTAATTGTTCCTTGAATT
CTACATTTGAACAGTTGTAAACATGAGCGTGTCAGTTATTTCGGCCAGCA
ATCTTAATGACGGAGACAATAAAAAGTTAAATAATTCCAATGATTGTGAT
TGGAAAAAAAGTCTAAAGTTACCACCTAAAGACAATAGAATTAAAACAAA
TGACGTTTTAGCAACAAAAGGAAGTACTTTTGAGTCATATCATCTGAATC
GAGATCTAATGAAGGCGATTTTCGAGAAAGGTTGGGATATGCCATCTCCA
ATACAAGAACAGGGAATACCAGCTGCAATGTCTGGTAATGATATTCTTGC
AAGAGCTAAAAATGGTACTGGAAAAACTGGTGCTTATGCTCTTCCTTTGC
TAAACAAGATAAACCCTGATTTACAGGCAGTACAAGGTTTAATACTTGTC
CCTACGAGAGAATTAGCTCTACAAACGAGTCAAATTTGTATAGAACTATC
GAAATATCTAAAATTTAAAGTAATGGTTACTACAGGTGGTACTGATCTAA
CGGAGGACATTTGTCGACTTAATAGACCAGTACATTTAGTTATAGGAACT
CCTGGAAGAATTCAAGACTTATTGAAAAGAGAAGTAATAAATGGAGAATA
CTGTAAAACATTAGTTTTAGATGAAGCGGATAAATTGCTCTCTAAGGATT
TCAAAGAAATAATGAGCAACATATTATCTTGTCTTCCAAAAGATCGTCAA
ATCCTTCTATATTCAGCAACTTATCCTGTAACATTACACGAATTCATGAT
GAAACATTTGAGGTCTCCAATTAAAATTAATTTAATGGAAGAATTAACTT
TAAAAGGGATAACCCAATATTACGCCTACGTAAAAGAAAAACATAAGGTA
CACTGTCTAAATACATTATTTTCAAAACTTGCTGTCAATCAATCCATTAT
TTTTTGCAATACTACTCAAAGAGTTGAGTTGCTGGCCAAGAAGATTACTG
ACCTAGGATATTCTTGCTATTACATTCACGCTAGGATGTCACAGCATTTT
AGAAATCGAGTGTTTCATGACTTTAGAGCCGGACACTGTCGTAATCTCGT
GTGTACAGACTTATTTACAAGAGGAATAGACATCCCAACAGTTAACGTTG
TCATCAATTTTGACTATCCTAAATACGCCGAAACATATCTCCATCGTATT
GGAAGATCAGGAAGATATGGTCATTTAGGAATTGCCATTAACTTGATAAC
ATATGACGATAGATACGCACTTAAAGAAATCGAATCACAACTTGATACAA
AAATTGAAGCAATACCAAAAGACATCGATAAACGACTATATGTTTCAGAA
TATCAGATTGAAAATAACTTTGATGAGCCAACGAAGAAAGCTATTATTAG
TGGTCGTGGATTACCTCGCTCCAACAAACCAAGTGATGAAATGAAACGAG
AAACTACTGAAATAGGAACCGAGATGGCGAATTCCAATACTAATGCAAAC
TAACTTTTTAC
back to top

protein sequence of SMED30023369-orf-1

>SMED30023369-orf-1 ID=SMED30023369-orf-1|Name=SMED30023369-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=477bp
MSVSVISASNLNDGDNKKLNNSNDCDWKKSLKLPPKDNRIKTNDVLATKG
STFESYHLNRDLMKAIFEKGWDMPSPIQEQGIPAAMSGNDILARAKNGTG
KTGAYALPLLNKINPDLQAVQGLILVPTRELALQTSQICIELSKYLKFKV
MVTTGGTDLTEDICRLNRPVHLVIGTPGRIQDLLKREVINGEYCKTLVLD
EADKLLSKDFKEIMSNILSCLPKDRQILLYSATYPVTLHEFMMKHLRSPI
KINLMEELTLKGITQYYAYVKEKHKVHCLNTLFSKLAVNQSIIFCNTTQR
VELLAKKITDLGYSCYYIHARMSQHFRNRVFHDFRAGHCRNLVCTDLFTR
GIDIPTVNVVINFDYPKYAETYLHRIGRSGRYGHLGIAINLITYDDRYAL
KEIESQLDTKIEAIPKDIDKRLYVSEYQIENNFDEPTKKAIISGRGLPRS
NKPSDEMKRETTEIGTEMANSNTNAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0016787hydrolase activity