V-type proton ATPase subunit G

Overview
NameV-type proton ATPase subunit G
Smed IDSMED30023364
Length (bp)501
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-type proton ATPase subunit G (SMED30023364) t-SNE clustered cells

Violin plots show distribution of expression levels for V-type proton ATPase subunit G (SMED30023364) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of V-type proton ATPase subunit G (SMED30023364) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for V-type proton ATPase subunit G (SMED30023364) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023364

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023364SMESG000019261.1 Contig118GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023364SMESG000078548.1 Contig118GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30023364SMESG000078548.1 dd_Smed_v4_545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023364SMESG000078548.1 dd_Smed_v4_545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of V-type proton ATPase subunit G vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 72.0182 bits (175), Expect = 3.054e-16
Identity = 46/115 (40.00%), Postives = 77/115 (66.96%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV +ARK+KA +L++AKE+AQ E+E  +   E EF++KQ+   GS+ +   ++++ T +Q+  +      N+E+ + +LL +V D+   VH N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 72.0182 bits (175), Expect = 3.054e-16
Identity = 46/115 (40.00%), Postives = 77/115 (66.96%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV +ARK+KA +L++AKE+AQ E+E  +   E EF++KQ+   GS+ +   ++++ T +Q+  +      N+E+ + +LL +V D+   VH N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 72.0182 bits (175), Expect = 3.054e-16
Identity = 46/115 (40.00%), Postives = 77/115 (66.96%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV +ARK+KA +L++AKE+AQ E+E  +   E EF++KQ+   GS+ +   ++++ T +Q+  +      N+E+ + +LL +V D+   VH N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 72.0182 bits (175), Expect = 3.054e-16
Identity = 46/115 (40.00%), Postives = 77/115 (66.96%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV +ARK+KA +L++AKE+AQ E+E  +   E EF++KQ+   GS+ +   ++++ T +Q+  +      N+E+ + +LL +V D+   VH N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Human
Match: ATP6V1G2 (ATPase H+ transporting V1 subunit G2 [Source:HGNC Symbol;Acc:HGNC:862])

HSP 1 Score: 72.0182 bits (175), Expect = 3.054e-16
Identity = 46/115 (40.00%), Postives = 77/115 (66.96%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV +ARK+KA +L++AKE+AQ E+E  +   E EF++KQ+   GS+ +   ++++ T +Q+  +      N+E+ + +LL +V D+   VH N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Celegans
Match: vha-10 (Probable V-type proton ATPase subunit G [Source:UniProtKB/Swiss-Prot;Acc:P91303])

HSP 1 Score: 80.4925 bits (197), Expect = 6.621e-20
Identity = 52/114 (45.61%), Postives = 80/114 (70.18%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNF 413
            M S+  GIQ+LLAAEK AA+K+NEARK+K  + ++AK++AQ E+E  K   E EFK  +++  G++ED E KI+ +T+ Q++ + + V  NK+  I RLL+LV DI+ ++H N 
Sbjct:    1 MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQQYLGTKEDIESKIRRDTEDQISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHNL 114          
BLAST of V-type proton ATPase subunit G vs. Ensembl Celegans
Match: vha-10 (Probable V-type proton ATPase subunit G [Source:UniProtKB/Swiss-Prot;Acc:P91303])

HSP 1 Score: 80.4925 bits (197), Expect = 6.621e-20
Identity = 52/114 (45.61%), Postives = 80/114 (70.18%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNF 413
            M S+  GIQ+LLAAEK AA+K+NEARK+K  + ++AK++AQ E+E  K   E EFK  +++  G++ED E KI+ +T+ Q++ + + V  NK+  I RLL+LV DI+ ++H N 
Sbjct:    1 MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQQYLGTKEDIESKIRRDTEDQISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHNL 114          
BLAST of V-type proton ATPase subunit G vs. Ensembl Fly
Match: Vha13 (gene:FBgn0283536 transcript:FBtr0346100)

HSP 1 Score: 60.8474 bits (146), Expect = 2.462e-12
Identity = 48/114 (42.11%), Postives = 73/114 (64.04%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNF 413
            M S+  GIQ+LLAAEK+AA+KV EARK+KA +L++AK++A +EIE  +   ER FK  + K  GSRE    KI  +   ++ ++   + T K+  I  +L+ V +I  +VH N+
Sbjct:    1 MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGSREGVAAKIDADIRVKLADMDRAIQTRKDPFILEILQYVYNISPEVHKNY 114          
BLAST of V-type proton ATPase subunit G vs. Ensembl Fly
Match: Vha13 (gene:FBgn0283536 transcript:FBtr0083804)

HSP 1 Score: 60.8474 bits (146), Expect = 2.462e-12
Identity = 48/114 (42.11%), Postives = 73/114 (64.04%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNF 413
            M S+  GIQ+LLAAEK+AA+KV EARK+KA +L++AK++A +EIE  +   ER FK  + K  GSRE    KI  +   ++ ++   + T K+  I  +L+ V +I  +VH N+
Sbjct:    1 MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQERERAFKEFEAKHMGSREGVAAKIDADIRVKLADMDRAIQTRKDPFILEILQYVYNISPEVHKNY 114          
BLAST of V-type proton ATPase subunit G vs. Ensembl Zebrafish
Match: atp6v1g1 (ATPase H+ transporting V1 subunit G1 [Source:ZFIN;Acc:ZDB-GENE-030131-6965])

HSP 1 Score: 70.8626 bits (172), Expect = 4.872e-16
Identity = 50/115 (43.48%), Postives = 74/115 (64.35%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV EARK+K  +L++AKE+AQ EIE  +   E+EFKTK+    GS  +   ++ + T  +M  I      NKE  +  LL++V DI+ ++H N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVAEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKTKEAAALGSHGNSAVEVDKETVDKMGRIQGSYQQNKEAVLGNLLKMVCDIKPEIHANYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Zebrafish
Match: atp6v1g1 (ATPase H+ transporting V1 subunit G1 [Source:ZFIN;Acc:ZDB-GENE-030131-6965])

HSP 1 Score: 70.8626 bits (172), Expect = 4.872e-16
Identity = 50/115 (43.48%), Postives = 74/115 (64.35%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV EARK+K  +L++AKE+AQ EIE  +   E+EFKTK+    GS  +   ++ + T  +M  I      NKE  +  LL++V DI+ ++H N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVAEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKTKEAAALGSHGNSAVEVDKETVDKMGRIQGSYQQNKEAVLGNLLKMVCDIKPEIHANYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Xenopus
Match: atp6v1g2 (ATPase H+ transporting V1 subunit G2 [Source:NCBI gene;Acc:780301])

HSP 1 Score: 78.9518 bits (193), Expect = 5.425e-19
Identity = 49/115 (42.61%), Postives = 79/115 (68.70%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            MTS++ GIQ+LL AEK AA++V+EARK+KA +L++AKE+AQ EIE  +   EREF+ +Q    G++ D   +++  T + +  +    G NKE  ++RLL LV +++ ++H N+R
Sbjct:    1 MTSQSQGIQQLLQAEKRAAERVSEARKRKARRLKQAKEEAQVEIEQYRLEREREFQIQQRTALGTQGDLSSEVEARTRQTLQMVQSSHGKNKEAVLRRLLGLVCNVKAELHPNYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Xenopus
Match: lcmt2 (leucine carboxyl methyltransferase 2 [Source:Xenbase;Acc:XB-GENE-5944136])

HSP 1 Score: 66.6254 bits (161), Expect = 2.869e-14
Identity = 47/115 (40.87%), Postives = 76/115 (66.09%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA++V EARK+K  +L++AKE+AQ EIE  +   E++FK K+    GS      ++++ T ++M+ I +    N+EK ++ LL  V DI+ ++H N+R
Sbjct:    1 MASQSAGIQQLLQAEKRAAERVAEARKRKNRRLKQAKEEAQAEIEQYRLQREKDFKAKEAAALGSHGSCLEEVEKETTEKMSIIQQNYAKNREKVLENLLSFVCDIKPEIHLNYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Xenopus
Match: ankrd52 (ankyrin repeat domain 52 [Source:Xenbase;Acc:XB-GENE-1002005])

HSP 1 Score: 55.8398 bits (133), Expect = 3.729e-10
Identity = 42/115 (36.52%), Postives = 72/115 (62.61%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK A  K+ EA+K+K  +LR+AKE+A  +I+  +   E +F+  Q  + GS+ +   KI+E T +++          KE  +++LL+L  +I+ ++HTNF+
Sbjct:    1 MASQSQGIQQLLQAEKRAKDKLEEAKKRKNKRLRQAKEEATADIDQYRLKREGDFRRIQTSVMGSQGNLAVKIEEQTVEKIQLYSSSFHKYKEGVLQQLLDLAYNIKPELHTNFQ 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Mouse
Match: Atp6v1g3 (ATPase, H+ transporting, lysosomal V1 subunit G3 [Source:MGI Symbol;Acc:MGI:2450548])

HSP 1 Score: 73.559 bits (179), Expect = 4.893e-17
Identity = 49/117 (41.88%), Postives = 77/117 (65.81%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT 422
            MTS++ GIQ+LL AEK A  K++EA+K+K  +LR+AKE+A  E +  +  ME++F+ KQ KI GS+     +I+E T +++ E+        E  IK+LL +V D++ +VH N+R T
Sbjct:    1 MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQMEKDFRLKQAKIMGSQSHLSDEIEEQTLEKIKELNGSYNKCMESVIKQLLSMVCDMKPEVHVNYRAT 117          
BLAST of V-type proton ATPase subunit G vs. Ensembl Mouse
Match: Atp6v1g2 (ATPase, H+ transporting, lysosomal V1 subunit G2 [Source:MGI Symbol;Acc:MGI:1913487])

HSP 1 Score: 70.0922 bits (170), Expect = 1.064e-15
Identity = 46/117 (39.32%), Postives = 78/117 (66.67%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT 422
            M S+  GIQ+LL AEK AA+KV +ARK+KA +L++AKE+AQ E+E  +   E+EF++KQ+   GS+ +   ++++ T +Q+  +      N+E+ + +LL +V ++   VH N+R T
Sbjct:    1 MASQTQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCEVRPQVHPNYRVT 117          
BLAST of V-type proton ATPase subunit G vs. Ensembl Mouse
Match: Atp6v1g1 (ATPase, H+ transporting, lysosomal V1 subunit G1 [Source:MGI Symbol;Acc:MGI:1913540])

HSP 1 Score: 68.9366 bits (167), Expect = 3.227e-15
Identity = 47/115 (40.87%), Postives = 74/115 (64.35%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV+EARK+K  +L++AKE+AQ EIE  +   E+EFK K+    GS      ++++ T ++MT +      N+++ +  LL  V DI  ++H N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCSSEVEKETREKMTVLQNYFEQNRDEVLDNLLAFVCDIRPEIHENYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Mouse
Match: Atp6v1g2 (ATPase, H+ transporting, lysosomal V1 subunit G2 [Source:MGI Symbol;Acc:MGI:1913487])

HSP 1 Score: 57.3806 bits (137), Expect = 4.925e-11
Identity = 29/89 (32.58%), Postives = 56/89 (62.92%), Query Frame = 3
Query:  156 KANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT 422
            KA +L++AKE+AQ E+E  +   E+EF++KQ+   GS+ +   ++++ T +Q+  +      N+E+ + +LL +V ++   VH N+R T
Sbjct:    4 KARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCEVRPQVHPNYRVT 92          
BLAST of V-type proton ATPase subunit G vs. Ensembl Mouse
Match: Atp6v1g2 (ATPase, H+ transporting, lysosomal V1 subunit G2 [Source:MGI Symbol;Acc:MGI:1913487])

HSP 1 Score: 43.5134 bits (101), Expect = 5.306e-6
Identity = 21/75 (28.00%), Postives = 44/75 (58.67%), Query Frame = 3
Query:  198 EIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT 422
            E+E  +   E+EF++KQ+   GS+ +   ++++ T +Q+  +      N+E+ + +LL +V ++   VH N+R T
Sbjct:    2 EVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCEVRPQVHPNYRVT 76          
BLAST of V-type proton ATPase subunit G vs. UniProt/SwissProt
Match: sp|Q617N0|VATG_CAEBR (Probable V-type proton ATPase subunit G OS=Caenorhabditis briggsae OX=6238 GN=vha-10 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.325e-19
Identity = 52/114 (45.61%), Postives = 81/114 (71.05%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNF 413
            M S+  GIQ+LLAAEK AA+K+NEARK+K  + ++AK++AQ E+E  K   E+EFK  +++  G++ED E KI+ +T+ Q+  + + V +NK+  I RLL+LV DI+ ++H N 
Sbjct:    1 MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREQEFKGFEQQYLGTKEDIESKIRRDTEDQINGMKQSVASNKQAVIVRLLQLVCDIKPELHHNL 114          
BLAST of V-type proton ATPase subunit G vs. UniProt/SwissProt
Match: sp|P91303|VATG_CAEEL (Probable V-type proton ATPase subunit G OS=Caenorhabditis elegans OX=6239 GN=vha-10 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 8.423e-19
Identity = 52/114 (45.61%), Postives = 80/114 (70.18%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNF 413
            M S+  GIQ+LLAAEK AA+K+NEARK+K  + ++AK++AQ E+E  K   E EFK  +++  G++ED E KI+ +T+ Q++ + + V  NK+  I RLL+LV DI+ ++H N 
Sbjct:    1 MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQQYLGTKEDIESKIRRDTEDQISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHNL 114          
BLAST of V-type proton ATPase subunit G vs. UniProt/SwissProt
Match: sp|Q25532|VATG_MANSE (V-type proton ATPase subunit G OS=Manduca sexta OX=7130 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.641e-17
Identity = 56/115 (48.70%), Postives = 79/115 (68.70%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S+  GIQ+LLAAEK AA+KV+EARK+KA +L++AKE+AQ E+E  +   ER+FK  + K  G+RE    KI   T  ++ E+ +MV T KE  IK +L LV DI+ ++H N+R
Sbjct:    1 MASQTHGIQQLLAAEKRAAEKVSEARKRKAKRLKQAKEEAQDEVEKYRQERERQFKEFEAKHMGTREGVAAKIDAETRIKIDEMNKMVQTQKEAVIKDVLNLVYDIKPELHINYR 115          
BLAST of V-type proton ATPase subunit G vs. UniProt/SwissProt
Match: sp|Q8BMC1|VATG3_MOUSE (V-type proton ATPase subunit G 3 OS=Mus musculus OX=10090 GN=Atp6v1g3 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.423e-16
Identity = 49/117 (41.88%), Postives = 77/117 (65.81%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT 422
            MTS++ GIQ+LL AEK A  K++EA+K+K  +LR+AKE+A  E +  +  ME++F+ KQ KI GS+     +I+E T +++ E+        E  IK+LL +V D++ +VH N+R T
Sbjct:    1 MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQMEKDFRLKQAKIMGSQSHLSDEIEEQTLEKIKELNGSYNKCMESVIKQLLSMVCDMKPEVHVNYRAT 117          
BLAST of V-type proton ATPase subunit G vs. UniProt/SwissProt
Match: sp|Q9TSV6|VATG2_PIG (V-type proton ATPase subunit G 2 OS=Sus scrofa OX=9823 GN=ATP6V1G2 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.123e-15
Identity = 46/115 (40.00%), Postives = 78/115 (67.83%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV +ARK+KA +L++AKE+AQ E+E  +   E+EF++KQ+   GS+ +   ++++ T +Q+  +      N+E+ + +LL +V D+   VH N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYR 115          
BLAST of V-type proton ATPase subunit G vs. TrEMBL
Match: A0A267DRM6 (V-type proton ATPase subunit G OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008207g1 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.765e-22
Identity = 58/116 (50.00%), Postives = 86/116 (74.14%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRK 419
            MT+++ GIQ LL AEK+A +K++EARK K  +L++AK++A  EI+T K   EREFK  + +I GSR D E+ ++E T ++++E+   VG NKE+AIKRLLELV D++  VH NF++
Sbjct:    1 MTTQSGGIQMLLQAEKKAKEKIDEARKNKQRRLKQAKQEAAAEIDTFKKEREREFKEHEARILGSRTDSEKLVQEETRQRLSELETSVGQNKEEAIKRLLELVFDVQPKVHDNFKR 116          
BLAST of V-type proton ATPase subunit G vs. TrEMBL
Match: R7TGP4 (V-type proton ATPase subunit G OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_150810 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.801e-19
Identity = 56/115 (48.70%), Postives = 83/115 (72.17%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S+N  IQ+LL AEK AA+KV+EARK+K  +L++AKE+AQ EIE  K   ER+++  +++I GS+ D E KI + T  +M E+ + +  NKEKA++RLL LV DI+ ++H N+R
Sbjct:    1 MASQNTAIQQLLNAEKRAAEKVSEARKRKGKRLKQAKEEAQNEIEGYKQERERQYRQHEQQILGSKGDMESKIDQTTHVKMQELEQNMAANKEKAMQRLLMLVCDIKPELHENYR 115          
BLAST of V-type proton ATPase subunit G vs. TrEMBL
Match: A0A0N4T9B1 (V-type proton ATPase subunit G OS=Brugia pahangi OX=6280 GN=BPAG_LOCUS4761 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.850e-19
Identity = 56/115 (48.70%), Postives = 84/115 (73.04%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S+  GIQ+LLAAEK AA+K+NEARK+KA +L++AK++AQ EIE  +A  ER+FK  + K  G +ED E KIK+ T++ + ++ + V  NK++ I RLL+LV DI+ ++H N +
Sbjct:    1 MASQTHGIQQLLAAEKRAAEKINEARKRKAQRLKQAKQEAQAEIEKYRAERERQFKEYEHKYLGKKEDIEMKIKQETEESIKQMEKSVAKNKQQVIVRLLQLVCDIQPELHMNLQ 115          
BLAST of V-type proton ATPase subunit G vs. TrEMBL
Match: A0A3P6S7F7 (V-type proton ATPase subunit G OS=Litomosoides sigmodontis OX=42156 GN=NLS_LOCUS1567 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.264e-19
Identity = 57/114 (50.00%), Postives = 82/114 (71.93%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNF 413
            M S+  GIQ+LLAAEK AA+K+NEARK+KA +L++AK++AQ EIE  +   EREFK  ++K  G +ED E KIK++T+  + +I + V  NK++ I RLL+LV DI  ++H N 
Sbjct:    1 MASQTQGIQQLLAAEKRAAEKINEARKRKAQRLKQAKQEAQAEIEKYRTEREREFKEYEQKYLGKKEDIEMKIKQDTEDNIRQIEKSVAKNKQQVILRLLQLVCDIRPELHINL 114          
BLAST of V-type proton ATPase subunit G vs. TrEMBL
Match: A0A0V0XJI7 (V-type proton ATPase subunit G OS=Trichinella pseudospiralis OX=6337 GN=T4A_10031 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.569e-19
Identity = 55/115 (47.83%), Postives = 84/115 (73.04%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S+  GIQ+LLAAEK+AA++VNEARK+KA +L++AKE+AQ+EIE  +   ER+F+  + K  GSR+D  +KI+    ++M  I ++V  NKE+ I+ LL+LV D++ ++H N R
Sbjct:    1 MASQTTGIQQLLAAEKKAAEQVNEARKRKARRLKQAKEEAQQEIEKYREQRERQFRQYESKHLGSRDDVAQKIETEASQKMERIEKLVSVNKEQVIQLLLKLVCDVKPEIHRNVR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Cavefish
Match: ENSAMXT00000006945.2 (ATPase H+ transporting V1 subunit G1 [Source:NCBI gene;Acc:103024358])

HSP 1 Score: 68.1662 bits (165), Expect = 4.703e-15
Identity = 48/115 (41.74%), Postives = 74/115 (64.35%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            M S++ GIQ+LL AEK AA+KV +ARK+K  +L++AKE+AQ EIE  +   E+EFKTK+    GS  +   ++ + T  +M  I      N+E  +  LL++V DI+ ++H N+R
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVADARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKTKEAAALGSHGNSAVEVDKETLDKMKRIETSYHQNREAVLNNLLKMVCDIKPEIHVNYR 115          
BLAST of V-type proton ATPase subunit G vs. Ensembl Sea Lamprey
Match: ATP6V1G3 (ATPase H+ transporting V1 subunit G3 [Source:HGNC Symbol;Acc:HGNC:18265])

HSP 1 Score: 74.7146 bits (182), Expect = 3.027e-18
Identity = 49/116 (42.24%), Postives = 79/116 (68.10%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRK 419
            MTS++ GIQ+LL AEK A++KV+EARK+K  +L++AKE+AQ EI+  +   E EF+ KQ+ I GS+ +   KI E T  ++  +     TN+E  +K+LL ++ DI+ ++H N+ +
Sbjct:    1 MTSQSQGIQQLLQAEKRASEKVSEARKRKTRRLKQAKEEAQAEIDQYRLQRENEFRKKQDSIMGSQGNMSTKIDEETRTRIQTVRGNYQTNREMVLKQLLAIISDIKPEIHQNYHR 116          
BLAST of V-type proton ATPase subunit G vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001946.1 (pep scaffold:Pmarinus_7.0:GL491154:964:3249:1 gene:ENSPMAG00000001767.1 transcript:ENSPMAT00000001946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.108e-13
Identity = 30/89 (33.71%), Postives = 55/89 (61.80%), Query Frame = 3
Query:  156 KANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT 422
            KA +LR+AKE+AQ EIE  +   + EF+ KQ+ + GS+ D   +I+E T  ++  +       ++  ++RLL +V D+  ++H N+R++
Sbjct:    1 KARRLRQAKEEAQAEIEQYRQQRDAEFRGKQDTVLGSQGDVSARIQEETRGRVHAMHARQREARDPVLRRLLTIVWDVRPEIHGNYRQS 89          
BLAST of V-type proton ATPase subunit G vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001947.1 (pep scaffold:Pmarinus_7.0:GL491154:964:1756:1 gene:ENSPMAG00000001767.1 transcript:ENSPMAT00000001947.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.762e-12
Identity = 29/86 (33.72%), Postives = 52/86 (60.47%), Query Frame = 3
Query:  156 KANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNF 413
            KA +LR+AKE+AQ EIE  +   + EF+ KQ+ + GS+ D   +I+E T  ++  +       ++  ++RLL +V D+  ++H N+
Sbjct:    1 KARRLRQAKEEAQAEIEQYRQQRDAEFRGKQDTVLGSQGDVSARIQEETRGRVHAMHARQREARDPVLRRLLTIVWDVRPEIHANY 86          
BLAST of V-type proton ATPase subunit G vs. Ensembl Nematostella
Match: EDO34520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP62])

HSP 1 Score: 78.5666 bits (192), Expect = 1.665e-19
Identity = 52/116 (44.83%), Postives = 82/116 (70.69%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRK 419
            M S++ GIQ+LL AEK+AA  V +ARK+K  KL++AKEQA  EI+  K+  E++F   Q++  GS++D++ KI+E T  Q+ ++ + V  +K+  I+RLL LV DI+ ++H NFR+
Sbjct:    1 MASQSQGIQQLLVAEKKAADLVADARKRKTKKLKQAKEQAVAEIDNYKSEREKQFLEYQKEHMGSKDDFQAKIEEATKSQLDQMEDDVNQHKDLVIERLLSLVYDIKPELHQNFRQ 116          
BLAST of V-type proton ATPase subunit G vs. Ensembl Medaka
Match: atp6v1g1 (V-type proton ATPase subunit G 1 [Source:NCBI gene;Acc:101172700])

HSP 1 Score: 67.3958 bits (163), Expect = 1.942e-14
Identity = 50/119 (42.02%), Postives = 75/119 (63.03%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT*V 428
            M S++ GIQ+LL AEK AA+KV EARK+K  +L++AKE+AQ EIE  +   E+EFKTK+    GS  +   ++  +T ++M  I +   +N+E  +  LL  V DI+ + H + R T V
Sbjct:    1 MASQSQGIQQLLQAEKRAAEKVAEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKTKEAAALGSHGNSAVEVDRDTVERMARIQDSYRSNREAVLGELLRRVCDIQPEFHNHSRSTGV 119          
BLAST of V-type proton ATPase subunit G vs. Planmine SMEST
Match: SMESG000078548.1 (SMESG000078548.1)

HSP 1 Score: 202.986 bits (515), Expect = 3.335e-68
Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 3
Query:   72 MTSENDGIQXXXXXXXXXXXXVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT 422
            MTSENDGIQKLLAAEKEAAKKVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT
Sbjct:    1 MTSENDGIQKLLAAEKEAAKKVNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFRKT 117          
BLAST of V-type proton ATPase subunit G vs. Planmine SMEST
Match: SMESG000063458.1 (SMESG000063458.1)

HSP 1 Score: 62.3882 bits (150), Expect = 5.752e-13
Identity = 37/94 (39.36%), Postives = 62/94 (65.96%), Query Frame = 3
Query:  135 VNEARKQKANKLRKAKEQAQKEIETEKALMEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLLELVLDIEMDVHTNFR 416
            +NEARK+K  +L++AKE A+ EIE  K  MER+F T +E+  G++  YE  + +  DK++ ++ + V  ++  A+  LL+ VL+IE  +H NF+
Sbjct:   26 INEARKRKQRRLKQAKEDAKSEIEAYKEEMERKFHTLEEEETGNKGQYEGFVNQMMDKELEKLEKSVQQSQHLALNILLDKVLNIETSLHQNFK 119          
The following BLAST results are available for this feature:
BLAST of V-type proton ATPase subunit G vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V1G23.054e-1640.00ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
ATP6V1G23.054e-1640.00ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
ATP6V1G23.054e-1640.00ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
ATP6V1G23.054e-1640.00ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
ATP6V1G23.054e-1640.00ATPase H+ transporting V1 subunit G2 [Source:HGNC ... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vha-106.621e-2045.61Probable V-type proton ATPase subunit G [Source:U... [more]
vha-106.621e-2045.61Probable V-type proton ATPase subunit G [Source:U... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vha132.462e-1242.11gene:FBgn0283536 transcript:FBtr0346100[more]
Vha132.462e-1242.11gene:FBgn0283536 transcript:FBtr0083804[more]
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atp6v1g14.872e-1643.48ATPase H+ transporting V1 subunit G1 [Source:ZFIN;... [more]
atp6v1g14.872e-1643.48ATPase H+ transporting V1 subunit G1 [Source:ZFIN;... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atp6v1g25.425e-1942.61ATPase H+ transporting V1 subunit G2 [Source:NCBI ... [more]
lcmt22.869e-1440.87leucine carboxyl methyltransferase 2 [Source:Xenba... [more]
ankrd523.729e-1036.52ankyrin repeat domain 52 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp6v1g34.893e-1741.88ATPase, H+ transporting, lysosomal V1 subunit G3 [... [more]
Atp6v1g21.064e-1539.32ATPase, H+ transporting, lysosomal V1 subunit G2 [... [more]
Atp6v1g13.227e-1540.87ATPase, H+ transporting, lysosomal V1 subunit G1 [... [more]
Atp6v1g24.925e-1132.58ATPase, H+ transporting, lysosomal V1 subunit G2 [... [more]
Atp6v1g25.306e-628.00ATPase, H+ transporting, lysosomal V1 subunit G2 [... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q617N0|VATG_CAEBR7.325e-1945.61Probable V-type proton ATPase subunit G OS=Caenorh... [more]
sp|P91303|VATG_CAEEL8.423e-1945.61Probable V-type proton ATPase subunit G OS=Caenorh... [more]
sp|Q25532|VATG_MANSE1.641e-1748.70V-type proton ATPase subunit G OS=Manduca sexta OX... [more]
sp|Q8BMC1|VATG3_MOUSE3.423e-1641.88V-type proton ATPase subunit G 3 OS=Mus musculus O... [more]
sp|Q9TSV6|VATG2_PIG1.123e-1540.00V-type proton ATPase subunit G 2 OS=Sus scrofa OX=... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DRM62.765e-2250.00V-type proton ATPase subunit G OS=Macrostomum lign... [more]
R7TGP41.801e-1948.70V-type proton ATPase subunit G OS=Capitella teleta... [more]
A0A0N4T9B13.850e-1948.70V-type proton ATPase subunit G OS=Brugia pahangi O... [more]
A0A3P6S7F75.264e-1950.00V-type proton ATPase subunit G OS=Litomosoides sig... [more]
A0A0V0XJI78.569e-1947.83V-type proton ATPase subunit G OS=Trichinella pseu... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000006945.24.703e-1541.74ATPase H+ transporting V1 subunit G1 [Source:NCBI ... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ATP6V1G33.027e-1842.24ATPase H+ transporting V1 subunit G3 [Source:HGNC ... [more]
ENSPMAT00000001946.12.108e-1333.71pep scaffold:Pmarinus_7.0:GL491154:964:3249:1 gene... [more]
ENSPMAT00000001947.11.762e-1233.72pep scaffold:Pmarinus_7.0:GL491154:964:1756:1 gene... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO345201.665e-1944.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v1g11.942e-1442.02V-type proton ATPase subunit G 1 [Source:NCBI gene... [more]
back to top
BLAST of V-type proton ATPase subunit G vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000078548.13.335e-68100.00SMESG000078548.1[more]
SMESG000063458.15.752e-1339.36SMESG000063458.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023364 ID=SMED30023364|Name=V-type proton ATPase subunit G|organism=Schmidtea mediterranea sexual|type=transcript|length=501bp
TTTAATTTTTCTAGAGCATTTACATTGTTTAAATTTATTAATGTATTCCT
ATTTATTTGTTTATTTTTAAAATGACCAGTGAAAATGATGGTATTCAAAA
GTTACTAGCTGCCGAAAAAGAAGCAGCAAAAAAAGTAAATGAAGCACGAA
AACAAAAAGCTAATAAATTACGTAAGGCCAAAGAACAGGCACAGAAGGAA
ATTGAAACTGAGAAGGCATTGATGGAACGAGAATTCAAAACTAAACAAGA
AAAAATTTTTGGAAGTCGTGAAGATTACGAAAGAAAAATAAAGGAAAATA
CTGACAAGCAAATGACAGAAATCGTTGAAATGGTTGGAACAAATAAAGAA
AAAGCCATTAAAAGATTATTGGAATTGGTATTAGATATTGAAATGGATGT
TCATACAAATTTTAGAAAGACCTGAGTAATTTTCGATCTTATTAAATAGC
ATAATATTGTTGATTTAATTAAAATAAATTTTCGTGTTTATTAAAAAAAA
A
back to top

protein sequence of SMED30023364-orf-1

>SMED30023364-orf-1 ID=SMED30023364-orf-1|Name=SMED30023364-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MTSENDGIQKLLAAEKEAAKKVNEARKQKANKLRKAKEQAQKEIETEKAL
MEREFKTKQEKIFGSREDYERKIKENTDKQMTEIVEMVGTNKEKAIKRLL
ELVLDIEMDVHTNFRKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:1902600hydrogen ion transmembrane transport
GO:0015992proton transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0016820hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005124V-ATPase_G
Vocabulary: cellular component
TermDefinition
GO:0016471vacuolar proton-transporting V-type ATPase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 8..61
NoneNo IPR availableGENE3DG3DSA:1.20.5.620coord: 1..60
e-value: 2.2E-17
score: 64.8
NoneNo IPR availablePANTHERPTHR12713:SF13V-TYPE PROTON ATPASE SUBUNIT G-RELATEDcoord: 1..115
IPR005124Vacuolar (H+)-ATPase G subunitPFAMPF03179V-ATPase_Gcoord: 3..106
e-value: 2.3E-28
score: 98.8
IPR005124Vacuolar (H+)-ATPase G subunitTIGRFAMTIGR01147TIGR01147coord: 1..113
e-value: 1.1E-31
score: 107.6
IPR005124Vacuolar (H+)-ATPase G subunitPANTHERPTHR12713VACUOLAR ATP SYNTHASE SUBUNIT Gcoord: 1..115