SMED30023360

Overview
NameSMED30023360
Smed IDSMED30023360
Length (bp)1235
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30023360 (SMED30023360) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30023360 (SMED30023360) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30023360 (SMED30023360) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30023360 (SMED30023360) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Alignments
SMED30023360 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.021677:5396..6629 +6023
v31.028166:1..1183 -5780
v31.017018:8500..9595 -4188
v31.003358:31008..32254 -4184
v31.023886:3457..4551 +4182
v31.000572:124254..125349 -4175
v31.002526:35789..36883 +4173
v31.000368:131567..132756 -4168
v31.001120:29579..30693 -4164
v31.000036:46407..47526 +4159
v31.001660:45243..46490 -4156
v31.000123:119731..120817 -4142
v31.000536:135810..136979 -4141
v31.000088:77228..78318 +4134
v31.000752:117945..119084 -4132
v31.030628:3509..4668 +4110
v31.000491:138158..139436 +4107
v31.002437:9314..10522 -4085
v31.000005:199359..200490 -4080
v31.001935:28036..29125 +4067
v31.015847:3410..4569 +4065
v31.000753:136556..137640 +4055
v31.016653:7579..11196 -4052
v31.002851:21680..22762 +4037
v31.005061:29016..30110 -4009
v31.000166:73838..74970 -3979
v31.015556:14256..15496 -3970
v31.003032:37241..38484 -3970
v31.003227:24324..25413 -3954
v31.008311:12794..13890 +3945
v31.013351:13443..14531 +3936
v31.001304:11292..12366 -3911
v31.003078:42627..43702 -3884
v31.002072:65910..67007 +3881
v31.004641:46741..47816 +3840
v31.000002:79797..80883 +3839
v31.000982:101347..102459 -3804
v31.000797:4829..5903 -3775
v31.000610:18519..19630 -3701
v31.003462:19171..20307 +3321
v31.003512:63253..64280 -3144
v31.015793:2982..3963 +3123
v31.000490:35641..36676 -3105
v31.004683:36313..37336 +3059
v31.002447:41617..42617 +3003
v31.009212:5151..6510 +2988
v31.020906:9524..10574 +2689
v31.005185:42526..43677 +2662
v31.004523:25615..26813 +2553
v31.002850:48002..49049 -2438
v31.009677:3803..4850 -2416
v31.015681:9024..10193 -1903
v31.029749:257..1312 -1841
Homology
BLAST of SMED30023360 vs. TrEMBL
Match: A0A183BUT1 (Uncharacterized protein OS=Globodera pallida OX=36090 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.292e-7
Identity = 38/104 (36.54%), Postives = 51/104 (49.04%), Query Frame = 1
Query:  391 GPVEFTDFMSEFYMYATAYRWTQAATVQRLPLYLKGAAREAWQQLDKRNIGNDWSKLKDELANKLIGGDIKRIMRQKFYNRVQRSDE*VSEFAHYLTTLADKAF 702
            G  +F  ++  F   ATA+ W  A   Q LPLYL+GAA+  ++ L      N W  L D LA KL         RQK   R QR  E + EFA  ++ L  +A+
Sbjct:   34 GSEDFQQYLKNFNTLATAHSWPPARCTQILPLYLRGAAKAVYEGLCDAERTN-WMSLVDALAGKLKRMSSSLTARQKLAQRKQRPGETLEEFAQAVSELVARAY 136          
BLAST of SMED30023360 vs. TrEMBL
Match: V3ZGP0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_164300 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.867e-6
Identity = 41/137 (29.93%), Postives = 69/137 (50.36%), Query Frame = 1
Query:  367 LLLNHYGGGPVEFTDFMSEFYMYATAYRWTQAATVQRLPLYLKGAAREAWQQLDKRNIGNDWSKLKDELANKLIGGDIKRIMRQKFYNRVQRSDE*VSEFAHYLTTLADKAFEIKQEQPDTVKQIIELLQDQFLMGV 777
            +L + + G   EF D +  F   A   +WT     Q + + LKG+AR+ +  ++      +W  L+DEL  +L G     + + +F  R+++SDE   +F++ L  LA K + I      +V    EL +DQFL G+
Sbjct:   37 VLPDTFTGEEEEFIDLLESFEACAAVNKWTDEEKCQFVAIKLKGSARKVFNDIEP-GAKREWILLEDELKRRLDGTRRPDLYKSEFLTRIKKSDEGYLDFSNALRILARKEYPIV-----SVGIRDELARDQFLRGL 167          
BLAST of SMED30023360 vs. Planmine SMEST
Match: SMESG000018010.1 (SMESG000018010.1)

HSP 1 Score: 258.455 bits (659), Expect = 2.232e-93
Identity = 126/151 (83.44%), Postives = 132/151 (87.42%), Query Frame = 1
Query:  331 VRDTNDYASFQKLLLNHYGGGPVEFTDFMSEFYMYATAYRWTQAATVQRLPLYLKGAAREAWQQLDKRNIGNDWSKLKDELANKLIGGDIKRIMRQKFYNRVQRSDE*VSEFAHYLTTLADKAFEIKQEQPDTVKQIIELLQDQFLMGVEK 783
            VRDTN YAS QKL +N Y G  VEFTDFM E+YMYATAY WTQ   VQRLPLYLK  A+EA QQLDKRNIGNDWSKLKDELANKLI GDIKRIMRQKFYNRVQRS+E VSEFAHYLTTLADKAFE+KQEQPDTVKQI ELLQDQFLMG +K
Sbjct:   23 VRDTNYYASCQKLPVNQYRGDAVEFTDFMGEYYMYATAYGWTQPVMVQRLPLYLKRTAQEAGQQLDKRNIGNDWSKLKDELANKLISGDIKRIMRQKFYNRVQRSEESVSEFAHYLTTLADKAFEVKQEQPDTVKQIRELLQDQFLMGADK 173          

HSP 2 Score: 103.605 bits (257), Expect = 2.232e-93
Identity = 59/87 (67.82%), Postives = 65/87 (74.71%), Query Frame = 3
Query:  780 KKAMQIEYNLQITEKKEQSFAGNSERRDRSLTPVKNDQFQRTISPSPKFRNKFDFKRSIGNVQSSN--KCLKCH-TERKLII*IKVS 1031
            KKAMQIE NL+ TEKK QSFA   ++RDRSLTPVKNDQFQRTISP PKFR KFDF  SI NVQSSN  K ++C   ER  I+ I V 
Sbjct:  192 KKAMQIELNLKNTEKKAQSFAVIYKKRDRSLTPVKNDQFQRTISPLPKFRYKFDFNGSIANVQSSNNGKTIQCDIVERWDIMPISVG 278          
BLAST of SMED30023360 vs. Planmine SMEST
Match: SMESG000067075.1 (SMESG000067075.1)

HSP 1 Score: 228.024 bits (580), Expect = 3.899e-83
Identity = 110/133 (82.71%), Postives = 117/133 (87.97%), Query Frame = 1
Query:  331 VRDTNDYASFQKLLLNHYGGGPVEFTDFMSEFYMYATAYRWTQAATVQRLPLYLKGAAREAWQQLDKRNIGNDWSKLKDELANKLIGGDIKRIMRQKFYNRVQRSDE*VSEFAHYLTTLADKAFEIKQEQPDT 729
            VRDTNDYAS QKL +N Y G PVEF DFM E+YMYATAYRWTQA  VQRL L+LK AAREA QQLDKRNIGNDW KLKD+LANKL+G DIKRIMRQ+FYNRVQRSDE VSEFAHYLTTLADKAFE+KQEQ DT
Sbjct:   23 VRDTNDYASCQKLPVNQYKGDPVEFADFMGEYYMYATAYRWTQAVMVQRLLLHLKEAAREALQQLDKRNIGNDWLKLKDKLANKLVGSDIKRIMRQQFYNRVQRSDESVSEFAHYLTTLADKAFEVKQEQSDT 155          

HSP 2 Score: 100.138 bits (248), Expect = 3.899e-83
Identity = 52/67 (77.61%), Postives = 56/67 (83.58%), Query Frame = 3
Query:  816 TEKKEQSFAGNSERRDRSLTPVKNDQFQRTISPSPKFRNKFDFKRSIGNVQSSN--KCLKCHTERKL 1010
            TEKK QSFA  SERRDRS+TPVKNDQFQRTISPSPKFRNKFDF RSI NVQSSN  K ++C   RK+
Sbjct:  157 TEKKAQSFAVISERRDRSITPVKNDQFQRTISPSPKFRNKFDFNRSIPNVQSSNNGKIMQCDICRKM 223          
BLAST of SMED30023360 vs. Planmine SMEST
Match: SMESG000053640.1 (SMESG000053640.1)

HSP 1 Score: 196.438 bits (498), Expect = 2.089e-74
Identity = 96/118 (81.36%), Postives = 99/118 (83.90%), Query Frame = 1
Query:  430 MYATAYRWTQAATVQRLPLYLKGAAREAWQQLDKRNIGNDWSKLKDELANKLIGGDIKRIMRQKFYNRVQRSDE*VSEFAHYLTTLADKAFEIKQEQPDTVKQIIELLQDQFLMGVEK 783
            MYATAY WTQA  VQRLPLYLKGAARE WQ L+K NI N+WSKLKDELANKLIGGD K I RQK YNRVQR DE  SEF  YLTTLADKAFE+KQEQPDTVK I E LQDQFLMGVEK
Sbjct:    1 MYATAYGWTQAVMVQRLPLYLKGAARETWQNLNKINIRNEWSKLKDELANKLIGGDKKHITRQKIYNRVQRLDESFSEFPFYLTTLADKAFEVKQEQPDTVKHIREFLQDQFLMGVEK 118          

HSP 2 Score: 102.834 bits (255), Expect = 2.089e-74
Identity = 57/79 (72.15%), Postives = 62/79 (78.48%), Query Frame = 3
Query:  780 KKAMQIEYNLQITEKKEQSFAGNSERRDRSLTPVKNDQFQRTISPSPKFRNKFDFKRSIGNVQSSN--KCLKCHTERKL 1010
            KKA +IE NL+ TEKK QSFA  SERRDRSLT VKNDQFQRTISPS KFRNKF F RSI NVQSSN  K ++C   RK+
Sbjct:  137 KKATRIELNLKSTEKKAQSFAVISERRDRSLTLVKNDQFQRTISPSSKFRNKFYFNRSIANVQSSNNEKTIQCDICRKM 215          
BLAST of SMED30023360 vs. Planmine SMEST
Match: SMESG000080881.1 (SMESG000080881.1)

HSP 1 Score: 236.498 bits (602), Expect = 1.746e-73
Identity = 113/148 (76.35%), Postives = 126/148 (85.14%), Query Frame = 1
Query:  340 TNDYASFQKLLLNHYGGGPVEFTDFMSEFYMYATAYRWTQAATVQRLPLYLKGAAREAWQQLDKRNIGNDWSKLKDELANKLIGGDIKRIMRQKFYNRVQRSDE*VSEFAHYLTTLADKAFEIKQEQPDTVKQIIELLQDQFLMGVEK 783
            +NDYAS QKL +  YGG PVEF DF +++YMYATAY W+Q+  VQRLPLYLKGAAREAWQQ+DKR I NDW+KLKD LA KLIGGDIKRIMRQKFYNRVQR DE VSEFA++LTTLA+KAFEIK EQ D VKQ+ ELLQDQFL GV K
Sbjct: 1563 SNDYASCQKLPVQQYGGDPVEFVDFKADYYMYATAYGWSQSIMVQRLPLYLKGAAREAWQQIDKRLIANDWTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAEKAFEIKPEQVDVVKQVKELLQDQFLTGVRK 1710          

HSP 2 Score: 59.3066 bits (142), Expect = 1.746e-73
Identity = 29/52 (55.77%), Postives = 39/52 (75.00%), Query Frame = 3
Query:  780 KKAMQIEYNLQITEKKEQSFAGNSERRDRSLTPVKNDQFQRTISPSPKFRNK 935
            KKAM+IE NL+ T+ K +SF    E RDRS++ +KN+ FQ++ SPSPKFR K
Sbjct: 1729 KKAMKIELNLKTTQPKAESFTTIDESRDRSVSRIKNNLFQKSTSPSPKFRVK 1780          
BLAST of SMED30023360 vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 226.868 bits (577), Expect = 2.430e-72
Identity = 110/148 (74.32%), Postives = 123/148 (83.11%), Query Frame = 1
Query:  340 TNDYASFQKLLLNHYGGGPVEFTDFMSEFYMYATAYRWTQAATVQRLPLYLKGAAREAWQQLDKRNIGNDWSKLKDELANKLIGGDIKRIMRQKFYNRVQRSDE*VSEFAHYLTTLADKAFEIKQEQPDTVKQIIELLQDQFLMGVEK 783
            +NDYAS QKL +  YGG PV+F DFM+++YMYATAY W+Q+  VQRL L LKGAAREAWQQ+DKR I NDW+KLKD LA KLIGGDIKRIMRQKFYNRVQR DE VSEFA++LTTLA KAFEIK EQ D  KQ+ ELLQDQFL GV K
Sbjct:   32 SNDYASCQKLPVQQYGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIANDWTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRK 179          

HSP 2 Score: 65.0846 bits (157), Expect = 2.430e-72
Identity = 31/58 (53.45%), Postives = 44/58 (75.86%), Query Frame = 3
Query:  780 KKAMQIEYNLQITEKKEQSFAGNSERRDRSLTPVKNDQFQRTISPSPKFRNKFDFKRS 953
            KK M+IE NL+ T+ K +SF    E RDRS++P+KN+ FQ++ SPSPKFR KF+ ++S
Sbjct:  198 KKTMKIELNLKTTQPKAESFTTIDESRDRSVSPIKNNLFQKSTSPSPKFRVKFEPRKS 255          
The following BLAST results are available for this feature:
BLAST of SMED30023360 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A183BUT15.292e-736.54Uncharacterized protein OS=Globodera pallida OX=36... [more]
V3ZGP01.867e-629.93Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of SMED30023360 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023360 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018010.12.232e-9383.44SMESG000018010.1[more]
SMESG000067075.13.899e-8382.71SMESG000067075.1[more]
SMESG000053640.12.089e-7481.36SMESG000053640.1[more]
SMESG000080881.11.746e-7376.35SMESG000080881.1[more]
SMESG000057446.12.430e-7274.32SMESG000057446.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023360 ID=SMED30023360|Name=SMED30023360|organism=Schmidtea mediterranea sexual|type=transcript|length=1235bp
TGTCTTATTGATTATTAAACACGATGAGTGGGATCGAGAGACTTATTCAT
CGACGAATTTTTAATATCCCAACAATTTGGTGAGCCCGACGTGATCTGAA
TCGTCGGTGAGAAGCATCTAAAGAGCAACCAAAGCTTTGTGAAAACTGTA
GTATATTGAGAAAGAGAAATCGAAACTTTGAAAAGTGTTAATATCAGACG
TTCTACATTGGAAAATAAACGAAAACCGTACAATTTACGAAGCAAGCAAC
GAATAGAGATTACTATGAGCAGCAATAATTCAACTACTTCGACAACTACC
GCACCAATAGTTTCAACATCAGCAGTAACCGTCAGAGATACAAATGATTA
TGCAAGTTTTCAAAAGTTACTATTAAACCATTACGGAGGAGGTCCTGTAG
AATTCACTGACTTCATGAGCGAATTTTACATGTATGCAACGGCCTATAGA
TGGACTCAAGCGGCGACGGTACAGCGATTGCCACTTTATCTCAAAGGGGC
AGCACGAGAGGCATGGCAGCAGTTGGACAAAAGAAACATTGGAAATGACT
GGTCAAAGTTAAAAGATGAACTTGCAAATAAATTAATCGGTGGCGATATA
AAGCGCATAATGAGACAAAAATTTTACAACAGAGTTCAAAGATCAGACGA
ATAGGTAAGTGAATTTGCTCATTACTTAACAACACTTGCAGATAAAGCGT
TTGAAATCAAACAGGAACAACCAGATACTGTAAAACAAATCATAGAGTTG
TTACAAGACCAATTTCTAATGGGCGTTGAAAAAAGGCAATGCAAATCGAA
TATAATCTACAGATCACCGAAAAGAAAGAGCAATCTTTTGCAGGGAATTC
TGAAAGACGAGACAGATCATTAACGCCAGTGAAAAATGACCAATTTCAAA
GAACTATCAGTCCATCGCCGAAGTTCAGAAATAAATTTGACTTCAAGAGA
TCAATAGGTAATGTTCAGAGTTCCAACAAGTGTCTTAAATGCCACACGGA
AAGAAAATTAATCATCTAAATCAAGGTTTCCCAATTTTTTTCGATTTCAG
TCACCCCAAGTCAAAAAATTGGTCTATTGGATAGACCCATGGTGGCAAAT
GGTAACAACGAATGAATATAGATCTGACTTGCAACTGTGTTACGCACCAA
AGCAGAGGTGGACAAACTATAGACCACACATGCGTTTTTACCGGCGCTAA
AATTCTCAGCAGATAGCAAACAAATTTGGATCTTG
back to top

protein sequence of SMED30023360-orf-1

>SMED30023360-orf-1 ID=SMED30023360-orf-1|Name=SMED30023360-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
MSSNNSTTSTTTAPIVSTSAVTVRDTNDYASFQKLLLNHYGGGPVEFTDF
MSEFYMYATAYRWTQAATVQRLPLYLKGAAREAWQQLDKRNIGNDWSKLK
DELANKLIGGDIKRIMRQKFYNRVQRSDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR005162Retrotrans_gag_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005162Retrotransposon gag domainPFAMPF03732Retrotrans_gagcoord: 23..77
e-value: 5.8E-5
score: 23.3