Porphobilinogen deaminase

Overview
NamePorphobilinogen deaminase
Smed IDSMED30023355
Length (bp)1256
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Porphobilinogen deaminase (SMED30023355) t-SNE clustered cells

Violin plots show distribution of expression levels for Porphobilinogen deaminase (SMED30023355) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Porphobilinogen deaminase (SMED30023355) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Porphobilinogen deaminase (SMED30023355) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023355

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30023355SMESG000024741.1 SmedASXL_002843SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30023355SMESG000024741.1 SmedASXL_002843SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30023355SMESG000024741.1 dd_Smed_v4_626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023355SMESG000024741.1 dd_Smed_v4_626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30023355SMESG000024741.1 dd_Smed_v4_626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023355SMESG000024741.1 Contig38703newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023355SMESG000024741.1 Contig38703uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30023355SMESG000024741.1 SMU15000117SMUPMID:27240733
Stubenhaus et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
pigment cellSMED30023355SMESG000024741.1 SMU15000117SMUPMID:27240733
Stubenhaus et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30023355SMESG000024741.1 dd_Smed_v6_626_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30023355SMESG000001671.1 SMESG000001665.1 SMESG000001662.1 SMESG000001654.1 SMESG000001642.1 Contig4713GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30023355SMESG000024741.1 Contig4713GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 292.352 bits (747), Expect = 1.228e-95
Identity = 141/284 (49.65%), Postives = 197/284 (69.37%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            R++RVG+R S LA  QT  ++  LK   P ++F +I M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKD+PT++   F IG+I  RE+  DAVV       K LE+LPE SV+GTSS+RR +QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AIILA AGL+R+ W++R+ ++L  E+  YAVGQGAL  E R  D ++  ++  ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S+
Sbjct:   19 RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 291          
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 291.582 bits (745), Expect = 1.648e-95
Identity = 141/284 (49.65%), Postives = 197/284 (69.37%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            R++RVG+R S LA  QT  ++  LK   P ++F +I M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKD+PT++   F IG+I  RE+  DAVV       K LE+LPE SV+GTSS+RR +QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AIILA AGL+R+ W++R+ ++L  E+  YAVGQGAL  E R  D ++  ++  ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S+
Sbjct:    2 RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 274          
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 291.582 bits (745), Expect = 1.648e-95
Identity = 141/284 (49.65%), Postives = 197/284 (69.37%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            R++RVG+R S LA  QT  ++  LK   P ++F +I M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKD+PT++   F IG+I  RE+  DAVV       K LE+LPE SV+GTSS+RR +QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AIILA AGL+R+ W++R+ ++L  E+  YAVGQGAL  E R  D ++  ++  ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S+
Sbjct:    2 RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 274          
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 291.582 bits (745), Expect = 1.648e-95
Identity = 141/284 (49.65%), Postives = 197/284 (69.37%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            R++RVG+R S LA  QT  ++  LK   P ++F +I M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKD+PT++   F IG+I  RE+  DAVV       K LE+LPE SV+GTSS+RR +QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AIILA AGL+R+ W++R+ ++L  E+  YAVGQGAL  E R  D ++  ++  ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S+
Sbjct:    2 RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 274          
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Match: HMBS (hydroxymethylbilane synthase [Source:HGNC Symbol;Acc:HGNC:4982])

HSP 1 Score: 276.559 bits (706), Expect = 1.614e-89
Identity = 138/293 (47.10%), Postives = 197/293 (67.24%), Query Frame = 3
Query:   30 SSMESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            ++ E+    R++RVG+R S LA  QT  ++  LK   P ++F +       DKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKD+PT++   F IG+I  RE+  DAVV       K LE+LPE SV+GTSS+RR +QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AIILA AGL+R+ W++R+ ++L  E+  YAVGQGAL  E R  D ++  ++  ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S+
Sbjct:   10 TAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEI------RDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 285          
BLAST of Porphobilinogen deaminase vs. Ensembl Fly
Match: l(3)02640 (gene:FBgn0010786 transcript:FBtr0072679)

HSP 1 Score: 248.825 bits (634), Expect = 1.022e-75
Identity = 134/291 (46.05%), Postives = 181/291 (62.20%), Query Frame = 3
Query:   54 KRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLK---------ENKFILKGCLLNLEGS 899
            ++++RVGSR S LA+ QT  +I  L+   P  +F + TM T GD++LN  L +IG+ +LFT++LE AL    VDFVVHSLKD+PT +     IG++  RE   DA+VL+ N K   + SLP+GSVIGTSS+RR +Q++R YPHL    IRGNLNTRL KLD            + K+  IILA+AGL R+ W  RIS+VL   D  YAVGQGALA ECR ND ++  +L  +   ++    +AER+F+  L GGCS P+ V S LK         E    L G + +L+G+
Sbjct:    5 EKVIRVGSRKSELALIQTKHVIGRLQKLYPKQKFEIHTMSTFGDRVLNVSLPKIGEKSLFTRDLEDALRNGGVDFVVHSLKDLPTALPTGMAIGAVLEREDARDALVLRENFKGHTIASLPKGSVIGTSSLRRTAQIRRMYPHLTVCDIRGNLNTRLAKLD----------AADSKFSGIILAQAGLVRMGWMSRISQVLEPTDLLYAVGQGALAVECRANDDQVLAMLQKLMCLNTTCRILAERSFLKTLGGGCSAPVAVWSNLKGEPLNGNSQEVGLSLTGAVWSLDGA 285          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsb (hydroxymethylbilane synthase, b [Source:ZFIN;Acc:ZDB-GENE-050522-491])

HSP 1 Score: 294.664 bits (753), Expect = 1.151e-96
Identity = 145/284 (51.06%), Postives = 201/284 (70.77%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            R++RVG+R S LA  QT  +++ LK   PD+ F ++ M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKD+PT++   F IG++  RE+  DAVVL   +K K L+SL   SVIGTSS+RR +QLK+++PHL+F  IRGNLNTRL KLD           +N  + AIILA AGL+R+ W +RIS++L  ED  YAVGQGALA E R  D+++ ++++ +ND  + L+C+AERAF+  LEGGCS P+ V S +K ++  L G + +L+GS+S+
Sbjct:   16 RVIRVGTRKSQLARIQTDSVVEKLKELYPDVLFEIVAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDLPTVLPGGFTIGAVLKRENPHDAVVLHPKNKGKRLDSLSNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENNDFSAIILAAAGLKRMGWENRISQILGPEDCMYAVGQGALAVEVRARDLDILEMVSVLNDSDTALSCIAERAFLKHLEGGCSVPVAVHSEVKNSQLYLTGAVYSLDGSDSL 288          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsb (hydroxymethylbilane synthase, b [Source:ZFIN;Acc:ZDB-GENE-050522-491])

HSP 1 Score: 281.182 bits (718), Expect = 1.534e-92
Identity = 139/268 (51.87%), Postives = 190/268 (70.90%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENK 860
            R++RVG+R S LA  QT  +++ LK   PD+ F ++ M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKD+PT++   F IG++  RE+  DAVVL   +K K L+SL   SVIGTSS+RR +QLK+++PHL+F  IRGNLNTRL KLD           +N  + AIILA AGL+R+ W +RIS++L  ED  YAVGQGALA E R  D+++ ++++ +ND  + L+C+AERAF+  LEGGCS P+ V S +K ++
Sbjct:   30 RVIRVGTRKSQLARIQTDSVVEKLKELYPDVLFEIVAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDLPTVLPGGFTIGAVLKRENPHDAVVLHPKNKGKRLDSLSNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENNDFSAIILAAAGLKRMGWENRISQILGPEDCMYAVGQGALAVEVRARDLDILEMVSVLNDSDTALSCIAERAFLKHLEGGCSVPVAVHSEVKNSQ 286          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsa (hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZDB-GENE-040426-1375])

HSP 1 Score: 261.536 bits (667), Expect = 1.051e-83
Identity = 159/358 (44.41%), Postives = 224/358 (62.57%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDK 1130
            R++R+G+R S LA  QT  +   LK   PD+   ++ M T+GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG+I  RE+  DAVVL   +    L+SLPE SVIGTSS+RR +QLK+++P L+F +IRGNLNTRL KLD+ +            Y AIILA AGL+R+ W  RIS+VL  ED  YAVGQGALA E R  D ++ ++++ ++   ++L C++ERAF+ +LEGGCS P+ V + +K +   L G + +L+G++   +KD +       +    L N  N+++  + +   T   I        + S ++A  KLGL LA N LLN G K
Sbjct:   20 RVIRMGTRKSQLARIQTDSVAGTLKQLYPDVHLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDIVVHSLKDLPTSLPPGFTIGAILERENPHDAVVLHPKNAGLTLDSLPEKSVIGTSSLRRAAQLKKRFPQLEFENIRGNLNTRLKKLDEKD-----------DYAAIILAAAGLKRMGWESRISQVLGPEDCMYAVGQGALAVEVRAQDKDILEMVSVLHHPDTVLRCISERAFLKQLEGGCSVPVAVHTEVKGSMLYLTGAVYSLDGADC--LKDTM-------QTCVELDNKVNESTQRSANVGVTACNI--------SSSALEAAEKLGLDLA-NVLLNKGAK 348          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsa (hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZDB-GENE-040426-1375])

HSP 1 Score: 260.381 bits (664), Expect = 2.588e-83
Identity = 159/358 (44.41%), Postives = 224/358 (62.57%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDK 1130
            R++R+G+R S LA  QT  +   LK   PD+   ++ M T+GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG+I  RE+  DAVVL   +    L+SLPE SVIGTSS+RR +QLK+++P L+F +IRGNLNTRL KLD+ +            Y AIILA AGL+R+ W  RIS+VL  ED  YAVGQGALA E R  D ++ ++++ ++   ++L C++ERAF+ +LEGGCS P+ V + +K +   L G + +L+G++   +KD +       +    L N  N+++  + +   T   I        + S ++A  KLGL LA N LLN G K
Sbjct:   17 RVIRMGTRKSQLARIQTDSVAGTLKQLYPDVHLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDIVVHSLKDLPTSLPPGFTIGAILERENPHDAVVLHPKNAGLTLDSLPEKSVIGTSSLRRAAQLKKRFPQLEFENIRGNLNTRLKKLDEKD-----------DYAAIILAAAGLKRMGWESRISQVLGPEDCMYAVGQGALAVEVRAQDKDILEMVSVLHHPDTVLRCISERAFLKQLEGGCSVPVAVHTEVKGSMLYLTGAVYSLDGADC--LKDTM-------QTCVELDNKVNESTQRSANVGVTACNI--------SSSALEAAEKLGLDLA-NVLLNKGAK 345          
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Match: hmbsb (hydroxymethylbilane synthase, b [Source:ZFIN;Acc:ZDB-GENE-050522-491])

HSP 1 Score: 235.343 bits (599), Expect = 2.444e-75
Identity = 120/224 (53.57%), Postives = 158/224 (70.54%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEM 728
            R++RVG+R S LA  QT  +++ LK   PD+ F ++ M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKD+PT++   F IG++  RE+  DAVVL   +K K L+SL   SVIGTSS+RR +QLK+++PHL+F  IRGNLNTRL KLD           +N  + AIILA AGL+R+ W +RIS++L  ED  YAVGQGALA E R  D+++
Sbjct:   18 RVIRVGTRKSQLARIQTDSVVEKLKELYPDVLFEIVAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDLPTVLPGGFTIGAVLKRENPHDAVVLHPKNKGKRLDSLSNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENNDFSAIILAAAGLKRMGWENRISQILGPEDCMYAVGQGALAVEVRARDLDI 230          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 282.337 bits (721), Expect = 8.284e-92
Identity = 156/367 (42.51%), Postives = 223/367 (60.76%), Query Frame = 3
Query:   42 SELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV--FVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKIL 1136
            +E  K ++RVG+R S LA  QT  ++++L  + P   F ++ M T GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE SVIGTSS+RR +QLK+K+PHL+F  IRGNLNTR+ KLD+ E            + AIILA AGL R+ W +RI ++L+ ++  YAVGQGALA E R  D ++  +++ + D  ++L C+AERAFM  LEGGCS P+ V + +K+++  L G + +L+GS+S+   ++  I+ P+ E         G N         D  + GI   G   V++  +++   LG  LA   L  G  +IL
Sbjct:    4 AEENKHVIRVGTRKSQLARIQTDSVVEMLSKRFPSTHFDIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDSLKETMQSCINFPQQE-------VEGPN--------DDVQHVGITALG---VSHQALESAECLGTGLADLLLSKGAKEIL 341          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 282.337 bits (721), Expect = 8.583e-92
Identity = 156/367 (42.51%), Postives = 223/367 (60.76%), Query Frame = 3
Query:   42 SELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV--FVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKIL 1136
            +E  K ++RVG+R S LA  QT  ++++L  + P   F ++ M T GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE SVIGTSS+RR +QLK+K+PHL+F  IRGNLNTR+ KLD+ E            + AIILA AGL R+ W +RI ++L+ ++  YAVGQGALA E R  D ++  +++ + D  ++L C+AERAFM  LEGGCS P+ V + +K+++  L G + +L+GS+S+   ++  I+ P+ E         G N         D  + GI   G   V++  +++   LG  LA   L  G  +IL
Sbjct:   11 AEENKHVIRVGTRKSQLARIQTDSVVEMLSKRFPSTHFDIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDSLKETMQSCINFPQQE-------VEGPN--------DDVQHVGITALG---VSHQALESAECLGTGLADLLLSKGAKEIL 348          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 250.366 bits (638), Expect = 4.586e-80
Identity = 144/324 (44.44%), Postives = 197/324 (60.80%), Query Frame = 3
Query:  168 MDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLS-NGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKIL 1136
            M T GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE SVIGTSS+RR +QLK+K+PHL+F  IRGNLNTR+ KLD+ E            + AIILA AGL R+ W +RI ++L+ ++  YAVGQGALA E R  D ++  +++ + D  ++L C+AERAFM  LEGGCS P+ V + +K+++  L G + +L+GS+S        L E  +R + SL   G N         D  + GI   G   V++  +++   LG  LA   L  G  +IL
Sbjct:    1 MSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDS--------LKETMQRKLISLEVEGPN--------DDVQHVGITALG---VSHQALESAECLGTGLADLLLSKGAKEIL 294          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 233.417 bits (594), Expect = 1.157e-73
Identity = 132/308 (42.86%), Postives = 186/308 (60.39%), Query Frame = 3
Query:  213 IGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKIL 1136
            IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE SVIGTSS+RR +QLK+K+PHL+F  IRGNLNTR+ KLD+ E            + AIILA AGL R+ W +RI ++L+ ++  YAVGQGALA E R  D ++  +++ + D  ++L C+AERAFM  LEGGCS P+ V + +K+++  L G + +L+GS+S+            K  +QS  N   +  +   + D  + GI   G   V++  +++   LG  LA   L  G  +IL
Sbjct:    2 IGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDSL------------KETMQSCIN-FPQQEVEGPNDDVQHVGITALG---VSHQALESAECLGTGLADLLLSKGAKEIL 282          
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Match: neurl1b (neuralized E3 ubiquitin protein ligase 1B [Source:Xenbase;Acc:XB-GENE-6469687])

HSP 1 Score: 229.18 bits (583), Expect = 4.387e-72
Identity = 130/303 (42.90%), Postives = 182/303 (60.07%), Query Frame = 3
Query:  228 LFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKIL 1136
            LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVV         L +LPE SVIGTSS+RR +QLK+K+PHL+F  IRGNLNTR+ KLD+ E            + AIILA AGL R+ W +RI ++L+ ++  YAVGQGALA E R  D ++  +++ + D  ++L C+AERAFM  LEGGCS P+ V + +K+++  L G + +L+GS+S+            K  +QS  N   +  +   + D  + GI   G   V++  +++   LG  LA   L  G  +IL
Sbjct:    2 LFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVIGTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKE-----------DFSAIILAAAGLRRMGWENRIGQILTSDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVKDSQLYLTGAVYSLDGSDSL------------KETMQSCIN-FPQQEVEGPNDDVQHVGITALG---VSHQALESAECLGTGLADLLLSKGAKEIL 277          
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Match: Hmbs (hydroxymethylbilane synthase [Source:MGI Symbol;Acc:MGI:96112])

HSP 1 Score: 292.352 bits (747), Expect = 1.093e-95
Identity = 151/310 (48.71%), Postives = 209/310 (67.42%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSES----------VFVKDEIDLPEYEKRLV 956
            R++RVG+R S LA  QT  ++ +LK   P I+F +I M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKDVPTI+   F IG+I  RE+  DAVV       K LE+LPE S +GTSS+RR++QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AI+LA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D ++  +++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S          V V+ E D PE + +LV
Sbjct:   19 RVIRVGTRKSQLARIQTDTVVAMLKALYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------ELQEFSAIVLAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVSVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQATIQVPVQQE-DGPEDDPQLV 316          
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Match: Hmbs (hydroxymethylbilane synthase [Source:MGI Symbol;Acc:MGI:96112])

HSP 1 Score: 291.582 bits (745), Expect = 1.261e-95
Identity = 151/310 (48.71%), Postives = 209/310 (67.42%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSES----------VFVKDEIDLPEYEKRLV 956
            R++RVG+R S LA  QT  ++ +LK   P I+F +I M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKDVPTI+   F IG+I  RE+  DAVV       K LE+LPE S +GTSS+RR++QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AI+LA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D ++  +++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S          V V+ E D PE + +LV
Sbjct:    2 RVIRVGTRKSQLARIQTDTVVAMLKALYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------ELQEFSAIVLAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVSVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQATIQVPVQQE-DGPEDDPQLV 299          
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Match: Hmbs (hydroxymethylbilane synthase [Source:MGI Symbol;Acc:MGI:96112])

HSP 1 Score: 110.538 bits (275), Expect = 7.338e-29
Identity = 47/107 (43.93%), Postives = 76/107 (71.03%), Query Frame = 3
Query:  588 AIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            AI+LA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D ++  +++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S+
Sbjct:    2 AIVLAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVSVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSM 108          
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Match: Hmbs (hydroxymethylbilane synthase [Source:MGI Symbol;Acc:MGI:96112])

HSP 1 Score: 51.6026 bits (122), Expect = 1.795e-8
Identity = 25/50 (50.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKL 206
            R++RVG+R S LA  QT  ++ +LK   P I+F +I M T GDKIL+T L
Sbjct:    2 RVIRVGTRKSQLARIQTDTVVAMLKALYPGIQFEIIAMSTTGDKILDTAL 51          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|P08397|HEM3_HUMAN (Porphobilinogen deaminase OS=Homo sapiens OX=9606 GN=HMBS PE=1 SV=2)

HSP 1 Score: 292.352 bits (747), Expect = 5.898e-95
Identity = 141/284 (49.65%), Postives = 197/284 (69.37%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            R++RVG+R S LA  QT  ++  LK   P ++F +I M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKD+PT++   F IG+I  RE+  DAVV       K LE+LPE SV+GTSS+RR +QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AIILA AGL+R+ W++R+ ++L  E+  YAVGQGAL  E R  D ++  ++  ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S+
Sbjct:   19 RVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-----------EQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSI 291          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|P22907|HEM3_MOUSE (Porphobilinogen deaminase OS=Mus musculus OX=10090 GN=Hmbs PE=1 SV=2)

HSP 1 Score: 292.352 bits (747), Expect = 7.647e-95
Identity = 151/310 (48.71%), Postives = 209/310 (67.42%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSES----------VFVKDEIDLPEYEKRLV 956
            R++RVG+R S LA  QT  ++ +LK   P I+F +I M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKDVPTI+   F IG+I  RE+  DAVV       K LE+LPE S +GTSS+RR++QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AI+LA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D ++  +++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S          V V+ E D PE + +LV
Sbjct:   19 RVIRVGTRKSQLARIQTDTVVAMLKALYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------ELQEFSAIVLAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVSVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQATIQVPVQQE-DGPEDDPQLV 316          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|P19356|HEM3_RAT (Porphobilinogen deaminase OS=Rattus norvegicus OX=10116 GN=Hmbs PE=1 SV=2)

HSP 1 Score: 291.197 bits (744), Expect = 2.161e-94
Identity = 151/310 (48.71%), Postives = 207/310 (66.77%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSES----------VFVKDEIDLPEYEKRLV 956
            R++RVG+R S LA  QT  ++ +LK   P I+F +I M T GDKIL+T L +IG+ +LFTKELE AL +NEVD VVHSLKDVPTI+   F IG+I  RE+  DAVV       K LE+LPE S +GTSS+RR++QL+RK+PHL+F SIRGNLNTRL KLD           +  ++ AIILA AGL+R+ W +R+ ++L  E+  YAVGQGALA E R  D ++  ++  ++D  ++L C+AERAF+  LEGGCS P+ V + +K+ +  L G + +L+GS+S          V V+ E D PE + +LV
Sbjct:   19 RVIRVGTRKSQLARIQTDTVVAMLKTLYPGIQFEIIAMSTTGDKILDTALSKIGEKSLFTKELENALEKNEVDLVVHSLKDVPTILPPGFTIGAICKRENPCDAVVFHPKFIGKTLETLPEKSAVGTSSLRRVAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------EQLEFSAIILAVAGLQRMGWQNRVGQILHPEECMYAVGQGALAVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQATIQVPVQQE-DGPEDDPQLV 316          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|Q2KIN5|HEM3_BOVIN (Porphobilinogen deaminase OS=Bos taurus OX=9913 GN=HMBS PE=2 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 4.527e-92
Identity = 147/310 (47.42%), Postives = 204/310 (65.81%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSES----------VFVKDEIDLPEYEKRLV 956
            R++RVG+R S LA  QT  ++  LK   P ++F +I M T GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT++   F IG++  RES  DAVV       K LE+LPE SV+GTSS+RR +QL+RK+PHL+F SIRGNLNTRL KLD           + Q++ AIILA AGL+R+ W +R+ ++L  E+  YAVGQGAL  E R  D ++  ++  ++D  ++L C+AER+F+  LEGGCS P+ V + +K+ +  L G + +L G+E+          V V+ E D PE + +LV
Sbjct:   19 RVIRVGTRKSQLARIQTDSVVATLKALYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALERNEVDLVVHSLKDLPTVLPPGFTIGAVCKRESPYDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFKSIRGNLNTRLRKLD-----------ELQEFSAIILATAGLQRMGWQNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERSFLRHLEGGCSVPVAVHTAIKDGQLYLTGGVWSLNGAETMQDTMQTTIHVPVQHE-DGPEDDPQLV 316          
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Match: sp|Q8YVU6|HEM3_NOSS1 (Porphobilinogen deaminase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=hemC PE=3 SV=2)

HSP 1 Score: 268.855 bits (686), Expect = 2.691e-86
Identity = 132/292 (45.21%), Postives = 190/292 (65.07%), Query Frame = 3
Query:   51 TKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEI 926
             +R +R+GSR S LA+ QT+ + + L+N  PDI F + TM T GDKIL+  L +IGD  LFTKELE+ ++  E+DF VHSLKD+PT + +   + +I+ RE+  DA+V+  N K K +++LP G+VIGTSS+RR++QL+ ++PHL F  +RGNLNTRL KLD  E            Y+ +ILA AGL+RL    R+ ++L  E + +AVGQGAL  ECR +D E+  +L  I    +   C+AER+F+  LEGGC  PIGV + +  N+ IL G + +++G     VKD +
Sbjct:    8 ARRTIRIGSRKSQLALVQTYWVREQLQNSFPDINFEVHTMSTQGDKILDVALAKIGDKGLFTKELEVGMINEEIDFAVHSLKDLPTNLPEGLALAAITERENPADALVVHENFKDKQIDTLPAGAVIGTSSLRRLAQLRNQFPHLTFKDVRGNLNTRLAKLDAGE------------YDGLILAAAGLQRLGMGDRVHQILPKEISLHAVGQGALGIECRADDAELITVLKAIEHPETRDRCLAERSFLRSLEGGCQVPIGVNTEINGNELILTGVVASVDGQN--LVKDTV 285          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: A0A2R4LGK7 (Porphobilinogen deaminase OS=Dugesia japonica OX=6161 GN=PBGD PE=2 SV=1)

HSP 1 Score: 525.013 bits (1351), Expect = 0.000e+0
Identity = 248/378 (65.61%), Postives = 309/378 (81.75%), Query Frame = 3
Query:   36 MESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIKFNRLKSG 1169
            ME+   KRIVRVGSRTS LA+TQT+MIIDLL+ KN D+EF+L+ MDT+GD ILN  LY+IG+++LFTKELELALL +EVDFVVHSLKDVPT +S +F+IGS+S+RE+CDDAVV K+NS+YK+L SLP GS++GTSSVRR +QLK+K+P L+F+SIRGNLNTRLLKLDDPEKAF+M KGDNQKY+AIILAKAGLERL W +RISE LSY+DT YAVGQGALACECR NDIE RK+LATINDE+S+LTC+ ER F+H+L+GGCSTPIGVR+ LKEN+ I +GCL++L+GS ++  K EI+LP   K   ++  NGH     +NG S   +TGI+IYG++     +I+ C  LG+ LA + L  GGDKILNEIK  +  S 
Sbjct:    1 MENGNEKRIVRVGSRTSTLAVTQTNMIIDLLREKNNDVEFKLVIMDTIGDTILNMNLYKIGNSSLFTKELELALLADEVDFVVHSLKDVPTSISNEFIIGSVSMRETCDDAVVFKINSEYKSLSSLPNGSIVGTSSVRRTAQLKKKFPQLEFVSIRGNLNTRLLKLDDPEKAFKMRKGDNQKYDAIILAKAGLERLNWAYRISETLSYDDTLYAVGQGALACECRYNDIETRKLLATINDEYSILTCIVERTFLHKLDGGCSTPIGVRTYLKENQLIFQGCLMSLDGSNTITNKIEIELPNTTKSSSEAPKNGHKSNQKMNGVSHLNFTGIDIYGIDSQTKIKIETCAILGVNLANSILFQGGDKILNEIKLKQSNSA 378          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: A0A183PT84 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS17571 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 9.309e-102
Identity = 178/384 (46.35%), Postives = 251/384 (65.36%), Query Frame = 3
Query:   54 KRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMN---KGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRS------TLKENKFILKGCLLNLEG------SESVFVKDEI---DLPEYEKRLVQSLSNGHNKTSMING-DSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIK 1148
            + +VRVGSR S LA+ QT M ++LL+ +NP + F ++ M T+GDKIL+  L +IGD +LFTKELE ALL  EVD VVHSLKDVP+I+    V+G +  R S DD V++  + + + L  LP GS IGTS+VRR++ L RKYPHLKF+SIRGNLNTRL KLD P  A + N      +Q Y+AIILAKAG+ER+ W+HRI +VL+  D+FYAV QGALACECR+ D  +  +L+ I+DE + LT +AER+ M +L+GGCS PIGVRS       L  ++  L   +L+++G      S SV   D++   D  E   +LVQ  S+G++   +    D+ + + G+ +   + ++  R+     LG  +A + LL+G D+IL EI+
Sbjct:    7 RTVVRVGSRRSNLALLQTGMAVNLLQKQNPHVLFEVVEMATVGDKILDVSLSKIGDKSLFTKELENALLSGEVDLVVHSLKDVPSILPSGLVLGCVFARASPDDVVLMAPHYRGRKLSDLPIGSTIGTSAVRRVATLTRKYPHLKFVSIRGNLNTRLAKLDTP-PAPKDNCCLTNPSQSYDAIILAKAGVERMGWSHRIDQVLT--DSFYAVSQGALACECRQIDNFIMNLLSGIHDESAALTTIAERSLMRQLDGGCSIPIGVRSDLVLKGDLNYSQLTLHANILSVDGGKSVERSASVVFPDKVPINDCVESSCKLVQK-SSGYDDDELKAALDAASIFMGVLVTPSSEISRLRMAIAQSLGCVVAQSLLLSGADEILYEIR 386          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: A0A094ZR90 (Porphobilinogen deaminase OS=Schistosoma haematobium OX=6185 GN=MS3_04981 PE=4 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 1.954e-98
Identity = 187/404 (46.29%), Postives = 254/404 (62.87%), Query Frame = 3
Query:   54 KRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMN---KGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRS------TLKENKFILKGCLLNLEG------SESVFVKDEI---DLPEYEKRLVQSLSNGHNKTSM------INGDSDTTYTGIEI-YGLNPVA------------YSRIKACI--KLGLQLATNTLLNGGDKILNEIK 1148
            + +VRVGSR S LA+ QT M ++LL+ +NP I F ++ M T+GDKIL+  L +IGD +LFTKELE ALL  EVD VVHSLKDVP+I+    V+G +  R S DD V++  + + + L  LP GS IGTS+VRR++ L RKYPHLKF+SIRGNLNTRL KLD P  A + N      +Q Y+AIILAKAG+ER+ W+HRI +VL+  D+FYAV QGALACECR+ D  +  +L+ I+DE + LT +AER+ M +L+GGCS PIGVRS       L  ++  L   +L+++G      S SV   D++   D  E   +LVQ  S+G++  S         G S T+ T  E+   LN  +             SR++  I   LG  +A + LL+G D+IL EI+
Sbjct:    7 RTVVRVGSRRSNLALLQTEMAVNLLQKQNPHILFEVVEMATVGDKILDVSLSKIGDKSLFTKELENALLSGEVDLVVHSLKDVPSILPSGLVLGCVFARASPDDVVLMAPHYRGRKLSDLPIGSTIGTSAVRRVATLTRKYPHLKFVSIRGNLNTRLAKLDTP-PASKDNCCLTNPSQSYDAIILAKAGVERMGWSHRIDQVLT--DSFYAVSQGALACECRQIDNFIMNLLSGIHDESAALTTIAERSLMRQLDGGCSIPIGVRSDLVLKGDLNYSQLTLHANILSVDGGKSVERSASVVFPDKMPINDCMESSCKLVQK-SSGYDDVSTNTPIIESRGKSLTSPTKDELKAALNAASIFMGVLVTPSSEISRLRMAIAQSLGCVVAQSLLLSGADEILYEIR 406          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: A0A183N2W6 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS22641 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 3.378e-98
Identity = 182/408 (44.61%), Postives = 249/408 (61.03%), Query Frame = 3
Query:   54 KRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMN---KGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLL-----------------NLEGSESVFVKDEI---DLPEYEKRLVQSL--------------SNGHNKTSMING------DSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIK 1148
            + +VRVGSR S LA+ QT M +DLL+ +NP I F ++ M T+GDKIL+  L +IGD +LFTKELE ALL   VD VVHSLKDVP+I+    V+G +  R S DD V++  + + + L  LP GS IGTS+VRR++ L RKYPHLKF+SIRGNLNTRL KLD P  A + N      +  Y+AIILAKAG+ER+ W+HRI +VL+  D+FYAV QGALACECR+ D  +  +L+ I+DE + LT +AER+ M +L+GGCS PIGVRS L     +LKG L+                 ++E S SV   D+    D  E+  +LVQ                SNG + TS+         D+ + + G+ +   + ++  R+     LG  +A +  L+G D+IL EI+
Sbjct:    7 RTVVRVGSRRSNLALLQTGMAVDLLQKQNPHILFEVVEMTTVGDKILDVSLSKIGDKSLFTKELENALLSGNVDLVVHSLKDVPSILPSGLVLGCVFARASPDDVVLMAPHYRGRKLSDLPIGSTIGTSAVRRVATLTRKYPHLKFVSIRGNLNTRLAKLDTP-PASKDNCCLTNPSPSYDAIILAKAGVERMGWSHRIDQVLT--DSFYAVSQGALACECRQIDNFIMNLLSGIHDESAALTTIAERSLMRQLDGGCSIPIGVRSDL-----VLKGDLIYSQLTLHANILSVDGGKSIERSASVVFPDKTPVNDCVEFSCKLVQKSSGYDDVSTNTPIIESNGTSLTSITKDELKAALDATSIFMGVLVTPSSEISRLRMAIAQSLGCVVAQSLRLSGADEILYEIR 406          
BLAST of Porphobilinogen deaminase vs. TrEMBL
Match: A0A430QIA4 (Hydroxymethylbilane synthase OS=Schistosoma bovis OX=6184 GN=DC041_0002550 PE=4 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 6.466e-98
Identity = 179/404 (44.31%), Postives = 253/404 (62.62%), Query Frame = 3
Query:   54 KRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMN---KGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRS------TLKENKFILKGCLLNLEG------SESVFVKDEI---DLPEYEKRLVQSLSNGHN----KTSMING-----------------DSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIK 1148
            + +VRVGSR S LA+ QT M ++LL+ +NP + F ++ M T+GDKIL+  L +IGD +LFTKELE ALL  EVD VVHSLKDVP+I+    V+G +  R S DD V++  + + + L  LP GS IGTS+VRR++ L RKYPHLKF+SIRGNLNTRL KLD P  A + N      +Q Y+AIILAKAG+ER+ W++RI +VL+  D+FYAV QGALACECR+ D  +  +L+ I+DE + LT +AER+ M +L+GGCS PIGVRS       L  ++  L   +L+++G      S SV   D++   D  E   +LVQ  S+G++     T +I                   D+ + + G+ +   + ++  R+     LG  +A + LL+G D+IL EI+
Sbjct:    7 RTVVRVGSRRSNLALLQTEMAVNLLQKQNPHVLFEVVEMATVGDKILDVSLSKIGDKSLFTKELENALLSGEVDLVVHSLKDVPSILPSGLVLGCVFARASPDDVVLMAPHYRGRKLSDLPIGSTIGTSAVRRVATLTRKYPHLKFVSIRGNLNTRLAKLDTP-PASKDNCCLTNPSQSYDAIILAKAGVERMGWSYRIDQVLT--DSFYAVSQGALACECRQIDNFVMNLLSGIHDESAALTTIAERSLMRQLDGGCSIPIGVRSDLVLKGDLNYSQLTLHANILSVDGGKSVERSASVVFPDKMPINDCVESNCKLVQK-SSGYDDVSTNTPIIESRGTSPTSPTKDELKAALDAASIFMGVLVTPSSEISRLRMAIAQSLGCVVAQSLLLSGADEILYEIR 406          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsb (porphobilinogen deaminase-like [Source:NCBI gene;Acc:103033329])

HSP 1 Score: 291.582 bits (745), Expect = 1.655e-95
Identity = 162/376 (43.09%), Postives = 232/376 (61.70%), Query Frame = 3
Query:    9 TE*KSQISSMESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKIL 1136
            +E KS++   E +++ R++R+G+R S LA  QT  + + LK   PD+   ++ M T GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PTI+   F IG++  RES  DAVVL   +  K+L+ LP  SVIGTSS+RR +QLK+++PHL+F  IRGNLNTRL KLD           +N  + AIILA AGL R+ W+ RIS++L  ED  YAVGQGALA E R +D ++ ++++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K ++  L G + +L+GS+S+            K  +Q+  +  N+      D      G+    ++  A     A  KLG+ LA   L  G  +IL
Sbjct:    7 SETKSEVKDEEGKVS-RVIRIGTRKSQLARIQTDSVAEKLKELYPDVLLEIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTILPVGFTIGAVLKRESPYDAVVLHPKNAGKSLDLLPNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENSDFSAIILAAAGLRRMGWDSRISQILGPEDCMYAVGQGALAIEVRASDQDILEMVSVLHDPDTVLRCIAERAFLRHLEGGCSVPVAVHTEVKNSQLYLTGAVYSLDGSDSL------------KDTMQTTVSSDNQEEQEKVDEKVQRVGVTALKVSGAAQD---AAEKLGVDLANLLLSKGAKEIL 355          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsb (porphobilinogen deaminase-like [Source:NCBI gene;Acc:103033329])

HSP 1 Score: 286.574 bits (732), Expect = 4.484e-93
Identity = 158/361 (43.77%), Postives = 222/361 (61.50%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILN 1139
            R++R+G+R S LA  QT  + + LK   PD+   ++ M T GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PTI+   F IG++  RES  DAVVL   +  K+L+ LP  SVIGTSS+RR +QLK+++PHL+F  IRGNLNTRL KLD           +N  + AIILA AGL R+ W+ RIS++L  ED  YAVGQGALA E R +D ++ ++++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K ++  L G + +L+GS+S+            K  +Q+  +  N+      D      G+    ++  A     A  KLG+ LA   L  G  +IL 
Sbjct:   61 RVIRIGTRKSQLARIQTDSVAEKLKELYPDVLLEIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTILPVGFTIGAVLKRESPYDAVVLHPKNAGKSLDLLPNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENSDFSAIILAAAGLRRMGWDSRISQILGPEDCMYAVGQGALAIEVRASDQDILEMVSVLHDPDTVLRCIAERAFLRHLEGGCSVPVAVHTEVKNSQLYLTGAVYSLDGSDSL------------KDTMQTTVSSDNQEEQEKVDEKVQRVGVTALKVSGAAQD---AAEKLGVDLANLLLSKGAKEILT 395          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsb (porphobilinogen deaminase-like [Source:NCBI gene;Acc:103033329])

HSP 1 Score: 286.574 bits (732), Expect = 4.484e-93
Identity = 158/361 (43.77%), Postives = 222/361 (61.50%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILN 1139
            R++R+G+R S LA  QT  + + LK   PD+   ++ M T GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PTI+   F IG++  RES  DAVVL   +  K+L+ LP  SVIGTSS+RR +QLK+++PHL+F  IRGNLNTRL KLD           +N  + AIILA AGL R+ W+ RIS++L  ED  YAVGQGALA E R +D ++ ++++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K ++  L G + +L+GS+S+            K  +Q+  +  N+      D      G+    ++  A     A  KLG+ LA   L  G  +IL 
Sbjct:   61 RVIRIGTRKSQLARIQTDSVAEKLKELYPDVLLEIVAMSTTGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTILPVGFTIGAVLKRESPYDAVVLHPKNAGKSLDLLPNKSVIGTSSLRRAAQLKKRFPHLEFKDIRGNLNTRLKKLD-----------ENSDFSAIILAAAGLRRMGWDSRISQILGPEDCMYAVGQGALAIEVRASDQDILEMVSVLHDPDTVLRCIAERAFLRHLEGGCSVPVAVHTEVKNSQLYLTGAVYSLDGSDSL------------KDTMQTTVSSDNQEEQEKVDEKVQRVGVTALKVSGAAQD---AAEKLGVDLANLLLSKGAKEILT 395          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsa (hydroxymethylbilane synthase [Source:NCBI gene;Acc:103032521])

HSP 1 Score: 251.906 bits (642), Expect = 3.834e-80
Identity = 137/282 (48.58%), Postives = 194/282 (68.79%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSE 902
            R++R+G+R S LA  QT  + + LK    D++  ++ M T+GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +    L+SLPE SVIGTSS+RR +QLK+++P L+F +IRGNLNTRL KLD+ E            + AIILA AGL+R+ W  RIS+VL  ED  YAVGQGALA E R  D ++ ++++ ++   ++L C+AERAF+ +LEGGCS P+ V + +K++   L G + +L+G++
Sbjct:   17 RVIRMGTRKSQLARIQTDSVAEKLKELYADLQLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVLERENPHDAVVLHPKNAGLTLDSLPEKSVIGTSSLRRAAQLKKRFPQLEFENIRGNLNTRLKKLDEKE-----------DFAAIILAAAGLKRMGWESRISQVLGPEDCMYAVGQGALAIEVRARDRDILEMVSILHHPDTVLRCIAERAFLKQLEGGCSVPVAVYTEVKDSVLYLTGAVYSLDGAD 287          
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Match: hmbsa (hydroxymethylbilane synthase [Source:NCBI gene;Acc:103032521])

HSP 1 Score: 245.358 bits (625), Expect = 7.670e-78
Identity = 135/278 (48.56%), Postives = 190/278 (68.35%), Query Frame = 3
Query:   69 VGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSE 902
            +G+R S LA  QT  + + LK    D++  ++ M T+GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +    L+SLPE SVIGTSS+RR +QLK+++P L+F +IRGNLNTRL KLD+ E            + AIILA AGL+R+ W  RIS+VL  ED  YAVGQGALA E R  D ++ ++++ ++   ++L C+AERAF+ +LEGGCS P+ V + +K++   L G + +L+G++
Sbjct:    1 MGTRKSQLARIQTDSVAEKLKELYADLQLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVLERENPHDAVVLHPKNAGLTLDSLPEKSVIGTSSLRRAAQLKKRFPQLEFENIRGNLNTRLKKLDEKE-----------DFAAIILAAAGLKRMGWESRISQVLGPEDCMYAVGQGALAIEVRARDRDILEMVSILHHPDTVLRCIAERAFLKQLEGGCSVPVAVYTEVKDSVLYLTGAVYSLDGAD 267          
BLAST of Porphobilinogen deaminase vs. Ensembl Sea Lamprey
Match: hmbsa (hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZDB-GENE-040426-1375])

HSP 1 Score: 194.897 bits (494), Expect = 1.557e-60
Identity = 98/211 (46.45%), Postives = 137/211 (64.93%), Query Frame = 3
Query:  270 VDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSE 902
            VD VVHSLKD+PT +   F +G+I  RE+  DA+VL        LESLP+ SVIGTSS+RR +QLKR +PHL F  +RGNLNTRL KLD           +  +Y A++LA AGL R+ W+ RIS+++      YAVGQGALA E R  D  + ++L+ ++   ++L C+AERAF+  LEGGCS P+ V S ++  +  L G + +L+G++
Sbjct:    1 VDLVVHSLKDLPTTLPPGFTVGAILQRENPQDALVLTPQLAGHTLESLPDKSVIGTSSLRRAAQLKRNFPHLAFKDVRGNLNTRLRKLD-----------ELGEYSALVLAAAGLSRMGWDDRISQIIDPGVCLYAVGQGALAVEVRAEDRHVLELLSFLHHRDTVLRCVAERAFLRTLEGGCSVPVAVHSHMEGKELSLTGAVYSLDGAD 200          
BLAST of Porphobilinogen deaminase vs. Ensembl Yeast
Match: HEM3 (Porphobilinogen deaminase; catalyzes the conversion of 4-porphobilinogen to hydroxymethylbilane, the third step in heme biosynthesis; localizes to the cytoplasm and nucleus; expression is regulated by Hap2p-Hap3p, but not by levels of heme; human homolog HMBS can complement yeast mutant and allow growth of haploid null after sporulation of a heterozygous diploid [Source:SGD;Acc:S000002364])

HSP 1 Score: 254.603 bits (649), Expect = 1.622e-82
Identity = 148/373 (39.68%), Postives = 221/373 (59.25%), Query Frame = 3
Query:   63 VRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENE----VDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKE--NKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIKFNRLK 1163
            + +G R S LA+ Q++ ++ L++ K PD + ++ T+ T+GD+I    LY  G  AL+TKELE  L  ++    +D +VHSLKD+PT++ + F +G I+ R    D +V+   S YK+L+ LP+G ++GTSSVRR +QLKRKYPHLKF S+RGN+ TRL KLDDP+  +Q           IILA AGL R+   +RI++    +  ++AVGQGAL  E R+ D +M KIL  I D ++ + C++ERA M  LEGGCS PIGV S   E   K +LK  ++++EG+E+  V+DEI++      L++++     + SM                          AC K+   LA   + +G  KIL+EI  +R+K
Sbjct:    6 LHIGGRKSKLAVIQSNHVLKLIEEKYPDYDCKVFTLQTLGDQIQFKPLYSFGGKALWTKELEDHLYHDDPSKKLDLIVHSLKDMPTLLPEGFELGGITKRVDPTDCLVMPFYSAYKSLDDLPDGGIVGTSSVRRSAQLKRKYPHLKFESVRGNIQTRLQKLDDPKSPYQ----------CIILASAGLMRMGLENRITQRFHSDTMYHAVGQGALGIEIRKGDTKMMKILDEICDLNATICCLSERALMRTLEGGCSVPIGVESKYNEETKKLLLKAIVVDVEGTEA--VEDEIEM------LIENV----KEDSM--------------------------ACGKI---LAERMIADGAKKILDEINLDRIK 327          
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Match: hmbsb (hydroxymethylbilane synthase [Source:NCBI gene;Acc:101164176])

HSP 1 Score: 268.47 bits (685), Expect = 1.235e-86
Identity = 143/284 (50.35%), Postives = 194/284 (68.31%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            R++R+G+R S LA  QT  +   L+   PD+   ++ M T+GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +  K L SLP+ SV+GTSS+RR +QLKR++PHL+F  IRGNLNTRL KLDD E            + AIILA AGL+R+ W  RIS VL  ED  YAVGQGALA E R  D ++  +++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K+++  L G + +L+GSES+
Sbjct:   16 RVIRIGTRKSQLARIQTDSVAAKLQELYPDVRLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPAGFTIGAVLRRENPHDAVVLHPKNAGKTLASLPKNSVVGTSSLRRAAQLKRRFPHLEFKDIRGNLNTRLKKLDDKE-----------DFAAIILAAAGLKRMGWEDRISAVLQPEDCMYAVGQGALAVEVRAKDTDILDMVSVLHDPDTVLRCIAERAFLKRLEGGCSVPVAVHTYIKDSQLYLTGAVYSLDGSESL 288          
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Match: hmbsb (hydroxymethylbilane synthase [Source:NCBI gene;Acc:101164176])

HSP 1 Score: 268.085 bits (684), Expect = 1.855e-86
Identity = 143/284 (50.35%), Postives = 194/284 (68.31%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            R++R+G+R S LA  QT  +   L+   PD+   ++ M T+GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +  K L SLP+ SV+GTSS+RR +QLKR++PHL+F  IRGNLNTRL KLDD E            + AIILA AGL+R+ W  RIS VL  ED  YAVGQGALA E R  D ++  +++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K+++  L G + +L+GSES+
Sbjct:   18 RVIRIGTRKSQLARIQTDSVAAKLQELYPDVRLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPAGFTIGAVLRRENPHDAVVLHPKNAGKTLASLPKNSVVGTSSLRRAAQLKRRFPHLEFKDIRGNLNTRLKKLDDKE-----------DFAAIILAAAGLKRMGWEDRISAVLQPEDCMYAVGQGALAVEVRAKDTDILDMVSVLHDPDTVLRCIAERAFLKRLEGGCSVPVAVHTYIKDSQLYLTGAVYSLDGSESL 290          
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Match: hmbsb (hydroxymethylbilane synthase [Source:NCBI gene;Acc:101164176])

HSP 1 Score: 268.085 bits (684), Expect = 1.855e-86
Identity = 143/284 (50.35%), Postives = 194/284 (68.31%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESV 908
            R++R+G+R S LA  QT  +   L+   PD+   ++ M T+GDKIL+T L +IG+ +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +  K L SLP+ SV+GTSS+RR +QLKR++PHL+F  IRGNLNTRL KLDD E            + AIILA AGL+R+ W  RIS VL  ED  YAVGQGALA E R  D ++  +++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K+++  L G + +L+GSES+
Sbjct:   18 RVIRIGTRKSQLARIQTDSVAAKLQELYPDVRLEIVAMSTIGDKILDTALSKIGEKSLFTKELENALERNEVDLVVHSLKDLPTSLPAGFTIGAVLRRENPHDAVVLHPKNAGKTLASLPKNSVVGTSSLRRAAQLKRRFPHLEFKDIRGNLNTRLKKLDDKE-----------DFAAIILAAAGLKRMGWEDRISAVLQPEDCMYAVGQGALAVEVRAKDTDILDMVSVLHDPDTVLRCIAERAFLKRLEGGCSVPVAVHTYIKDSQLYLTGAVYSLDGSESL 290          
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Match: hmbsb (hydroxymethylbilane synthase [Source:NCBI gene;Acc:101164176])

HSP 1 Score: 237.269 bits (604), Expect = 1.191e-74
Identity = 141/299 (47.16%), Postives = 192/299 (64.21%), Query Frame = 3
Query:   57 RIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRL 953
            R++R+G+R S LA  QT  +   L+   PD+  RL   +T       T L    + +LFTKELE AL  NEVD VVHSLKD+PT +   F IG++  RE+  DAVVL   +  K L SLP+ SV+GTSS+RR +QLKR++PHL+F  IRGNLNTRL KLDD E            + AIILA AGL+R+ W  RIS VL  ED  YAVGQGALA E R  D ++  +++ ++D  ++L C+AERAF+  LEGGCS P+ V + +K+++  L G + +L+GSES  +K+ +   E ++RL
Sbjct:   18 RVIRIGTRKSQLARIQTDSVAAKLQELYPDV--RLEIGETFRLGFCQTTLSTC-NKSLFTKELENALERNEVDLVVHSLKDLPTSLPAGFTIGAVLRRENPHDAVVLHPKNAGKTLASLPKNSVVGTSSLRRAAQLKRRFPHLEFKDIRGNLNTRLKKLDDKE-----------DFAAIILAAAGLKRMGWEDRISAVLQPEDCMYAVGQGALAVEVRAKDTDILDMVSVLHDPDTVLRCIAERAFLKRLEGGCSVPVAVHTYIKDSQLYLTGAVYSLDGSES--LKETMQTKEVDERL 300          
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Match: SMESG000024741.1 (SMESG000024741.1)

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 378/382 (98.95%), Postives = 380/382 (99.48%), Query Frame = 3
Query:   36 MESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIKFNRLKSGTNQA 1181
            MESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKF SIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRST KENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSL+NGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIKFNRLKSGTN+A
Sbjct:    1 MESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFSSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTFKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLTNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIKFNRLKSGTNRA 382          
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Match: SMESG000071507.1 (SMESG000071507.1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 276/380 (72.63%), Postives = 322/380 (84.74%), Query Frame = 3
Query:   36 MESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIKFNRLKSGTN 1175
            M +   KRIV+VGSR SLLA TQT M+IDLL+N+NPD+EF+L+TMD +GDK+LN KL Q  DT+LFTKELELAL+ NEVDFVVHSLKDVPT++SKQFVIGSIS RESCDDAVVL+LNS+Y+NLESLPEGS+IGTSS RRI+QLKRKYPHLKF S+RGNL TRL+KLDDPEKAFQMNKGDNQK+EAIILAKAGLERL W+HRISEVLSYEDTFYAVGQGALACECRRNDI++RK+LA INDE SMLTC+AER+F+ EL+ G S P GVRSTLKEN+ +L+GCLLN EG+ESV VK EIDL E      Q LS   N+    NGDS   +TG+EIYG+  +AYS+++AC++LGLQ+A N LL GGDKIL E K  R+K  TN
Sbjct:    1 MNNSSMKRIVKVGSRMSLLAKTQTQMVIDLLENRNPDMEFQLVTMDKIGDKLLNLKLSQTVDTSLFTKELELALMANEVDFVVHSLKDVPTVISKQFVIGSISARESCDDAVVLRLNSEYQNLESLPEGSMIGTSSARRIAQLKRKYPHLKFSSMRGNLTTRLMKLDDPEKAFQMNKGDNQKFEAIILAKAGLERLAWDHRISEVLSYEDTFYAVGQGALACECRRNDIDIRKLLADINDETSMLTCIAERSFICELKVGYSAPFGVRSTLKENRLVLQGCLLNGEGTESVIVKSEIDLVEKSN---QFLSKTCNRMQAANGDSGVRFTGVEIYGIGSLAYSKMEACVELGLQMAANILLGGGDKILKEFKPIRVKPATN 377          
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Match: SMESG000024670.1 (SMESG000024670.1)

HSP 1 Score: 345.125 bits (884), Expect = 8.489e-116
Identity = 181/391 (46.29%), Postives = 259/391 (66.24%), Query Frame = 3
Query:   54 KRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTL-KENKFILKGCLLNLEGSESVFVKDEIDLP-EYEKRLVQSLSNGHNKTS------------------------MINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNEIK 1148
            +R +R+GSRTS LA+ QTH+I++LL   + +I+F+++TMDT+GD IL+ +L +IGD +LFTKELELAL+  EVDFVVHSLKDVPT +S +FVIG I LRES +DAVV+K NS YK LE LP  SV+GTSSVRRI+QLK +Y HLKF S+RGNLNTRL KLD          GD   Y A+ILAKAGLER+  + RIS+VLS+E + YAVGQGALACECR +D+   K+L++I+D+ S +T +AER+ M  L+GGCSTPI VRS + K+    L+  ++N +G+E +  +    LP E+ +  ++ +++  ++T                         ++  D ++ + G  ++ +  +   R+    +LG ++A   L  G  +IL+ I+
Sbjct:   10 RRTIRIGSRTSELALKQTHLIMNLLSKAHSEIDFKVVTMDTIGDIILDKELSKIGDKSLFTKELELALMAKEVDFVVHSLKDVPTALSDEFVIGCICLRESPEDAVVMKKNSIYKTLEELPTDSVVGTSSVRRIAQLKNRYSHLKFSSVRGNLNTRLKKLDAISIEEISGTGDVPSYSALILAKAGLERIGLSFRISQVLSHEGSLYAVGQGALACECRADDLSTLKLLSSIHDDESGITSIAERSLMRYLDGGCSTPIAVRSKVNKDGSLTLRAAVMNTDGTECISDEMTTRLPEEHIQEFLEKINSSESETEDNCPPSKKMKTNQSNYGEITEKEILLGKDPNSIFLGTRVFPICEIGRMRMAISQRLGAEVARRLLAAGAKQILDSIQ 400          
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Match: SMESG000025072.1 (SMESG000025072.1)

HSP 1 Score: 282.722 bits (722), Expect = 6.056e-92
Identity = 153/371 (41.24%), Postives = 244/371 (65.77%), Query Frame = 3
Query:   33 SMESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGDKILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIGSISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHLKFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQK-YEAIILAKAGLERLTWNHRISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAERAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLPEYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKLGLQLATNTLLNGGDKILNE 1142
            ++ S+ +K+  R+G+R+S LA+ QT+ I++LLK+K+ ++E++++T + + +K+   +L  I D + + K   +AL  +E+D +VHS+KDV   +S +FVIG I +R+SC+D VV++++ + K LE LP GSVIGTSS+RRIS+LKRKYPH   + I+G+L+ R+ KLDD     Q + G ++K Y A+ILAKAG+ RL   HRIS+ L + DTFYAVGQGALACECR +D E R++L+ INDE SML+C+ ER+F+   +   S  + V+S   E+ + LK C+ + +GS+ +         E EK L  +L +   ++   +   +  +TGI I+G++ +  ++++ C  LG  +A     +  D ILNE
Sbjct:   19 NLSSKFSKKTFRIGTRSSPLALAQTNRIVELLKSKDANLEYQILTPENITEKLTMKELANIEDLS-YKKLSHIALNLHELDIIVHSMKDVSKKLSPEFVIGCICMRDSCEDVVVMRVDLQGKTLEELPIGSVIGTSSLRRISKLKRKYPHFDIIPIKGDLDKRIQKLDDQ----QTDPGASRKPYSALILAKAGIIRLNLEHRISQELIFTDTFYAVGQGALACECRTDDPETRELLSVINDEKSMLSCIGERSFLKAFDCRASEAVAVQSVFTESDYTLKACVSSNDGSKCI---------EKEKTL--TLCDNLVESEKNDLPENENFTGILIWGIDKLTLTKMQKCRNLGENVAKLLKSSDADIILNE 373          
The following BLAST results are available for this feature:
BLAST of Porphobilinogen deaminase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMBS1.228e-9549.65hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
HMBS1.648e-9549.65hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
HMBS1.648e-9549.65hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
HMBS1.648e-9549.65hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
HMBS1.614e-8947.10hydroxymethylbilane synthase [Source:HGNC Symbol;A... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
l(3)026401.022e-7546.05gene:FBgn0010786 transcript:FBtr0072679[more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmbsb1.151e-9651.06hydroxymethylbilane synthase, b [Source:ZFIN;Acc:Z... [more]
hmbsb1.534e-9251.87hydroxymethylbilane synthase, b [Source:ZFIN;Acc:Z... [more]
hmbsa1.051e-8344.41hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZD... [more]
hmbsa2.588e-8344.41hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZD... [more]
hmbsb2.444e-7553.57hydroxymethylbilane synthase, b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
neurl1b8.284e-9242.51neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
neurl1b8.583e-9242.51neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
neurl1b4.586e-8044.44neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
neurl1b1.157e-7342.86neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
neurl1b4.387e-7242.90neuralized E3 ubiquitin protein ligase 1B [Source:... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Hmbs1.093e-9548.71hydroxymethylbilane synthase [Source:MGI Symbol;Ac... [more]
Hmbs1.261e-9548.71hydroxymethylbilane synthase [Source:MGI Symbol;Ac... [more]
Hmbs7.338e-2943.93hydroxymethylbilane synthase [Source:MGI Symbol;Ac... [more]
Hmbs1.795e-850.00hydroxymethylbilane synthase [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Porphobilinogen deaminase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08397|HEM3_HUMAN5.898e-9549.65Porphobilinogen deaminase OS=Homo sapiens OX=9606 ... [more]
sp|P22907|HEM3_MOUSE7.647e-9548.71Porphobilinogen deaminase OS=Mus musculus OX=10090... [more]
sp|P19356|HEM3_RAT2.161e-9448.71Porphobilinogen deaminase OS=Rattus norvegicus OX=... [more]
sp|Q2KIN5|HEM3_BOVIN4.527e-9247.42Porphobilinogen deaminase OS=Bos taurus OX=9913 GN... [more]
sp|Q8YVU6|HEM3_NOSS12.691e-8645.21Porphobilinogen deaminase OS=Nostoc sp. (strain PC... [more]
back to top
BLAST of Porphobilinogen deaminase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R4LGK70.000e+065.61Porphobilinogen deaminase OS=Dugesia japonica OX=6... [more]
A0A183PT849.309e-10246.35Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A094ZR901.954e-9846.29Porphobilinogen deaminase OS=Schistosoma haematobi... [more]
A0A183N2W63.378e-9844.61Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A430QIA46.466e-9844.31Hydroxymethylbilane synthase OS=Schistosoma bovis ... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmbsb1.655e-9543.09porphobilinogen deaminase-like [Source:NCBI gene;A... [more]
hmbsb4.484e-9343.77porphobilinogen deaminase-like [Source:NCBI gene;A... [more]
hmbsb4.484e-9343.77porphobilinogen deaminase-like [Source:NCBI gene;A... [more]
hmbsa3.834e-8048.58hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
hmbsa7.670e-7848.56hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hmbsa1.557e-6046.45hydroxymethylbilane synthase a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HEM31.622e-8239.68Porphobilinogen deaminase; catalyzes the conversio... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Porphobilinogen deaminase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hmbsb1.235e-8650.35hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
hmbsb1.855e-8650.35hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
hmbsb1.855e-8650.35hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
hmbsb1.191e-7447.16hydroxymethylbilane synthase [Source:NCBI gene;Acc... [more]
back to top
BLAST of Porphobilinogen deaminase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000024741.10.000e+098.95SMESG000024741.1[more]
SMESG000071507.10.000e+072.63SMESG000071507.1[more]
SMESG000024670.18.489e-11646.29SMESG000024670.1[more]
SMESG000025072.16.056e-9241.24SMESG000025072.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023355 ID=SMED30023355|Name=Porphobilinogen deaminase|organism=Schmidtea mediterranea sexual|type=transcript|length=1256bp
CTTCGATCACTGAATGAAAATCACAAATCTCATCAATGGAAAGCGAATTG
ACAAAAAGAATTGTCCGAGTAGGCTCACGAACGAGTCTCCTGGCAATGAC
ACAAACCCACATGATAATAGATTTACTGAAGAATAAAAATCCTGACATTG
AGTTCCGATTAATTACAATGGATACTATGGGAGACAAGATTTTGAATACG
AAATTATATCAAATTGGAGACACGGCACTATTCACAAAGGAATTAGAATT
GGCGTTATTAGAGAATGAAGTGGACTTCGTTGTTCACTCTCTCAAGGATG
TACCGACAATTATGTCGAAGCAGTTTGTTATTGGTTCAATCTCCCTAAGG
GAAAGTTGTGATGATGCTGTGGTGTTAAAATTGAATTCAAAATACAAAAA
TCTTGAAAGCTTACCGGAAGGATCAGTGATCGGAACGAGTTCAGTGAGAA
GGATATCCCAGTTGAAAAGAAAATATCCACATTTGAAATTCTTATCGATC
CGCGGTAACTTAAACACTCGACTATTGAAATTAGATGATCCGGAAAAAGC
GTTTCAAATGAACAAGGGAGATAATCAAAAATATGAAGCAATTATTCTAG
CAAAAGCCGGCTTGGAAAGGTTAACATGGAATCATAGGATTTCCGAGGTT
TTGTCATATGAAGATACATTTTATGCCGTTGGCCAAGGAGCATTAGCATG
TGAATGCAGACGCAATGACATTGAAATGAGGAAGATTTTGGCAACCATTA
ACGACGAACACTCAATGTTAACCTGCATGGCAGAGAGGGCATTTATGCAT
GAATTAGAAGGGGGTTGCAGCACACCAATAGGTGTTCGATCGACTTTGAA
AGAAAACAAATTCATATTGAAAGGATGCTTGTTGAATCTGGAAGGTAGTG
AATCAGTTTTTGTAAAAGACGAAATAGATCTACCTGAGTATGAAAAACGG
TTGGTCCAGTCTCTTTCTAATGGTCATAATAAAACATCGATGATAAATGG
TGATTCGGACACAACATATACCGGAATAGAAATATATGGACTGAACCCAG
TTGCTTACAGCCGCATCAAAGCTTGCATCAAACTTGGACTTCAATTAGCA
ACAAACACTCTTCTCAACGGAGGCGATAAAATCCTCAATGAAATCAAATT
TAATCGGCTGAAGTCCGGTACAAATCAAGCTTGACATATTTTTACAAGTT
TAGCTATGACCTTAGGATAATGAATACATTTCTATAGTTCCCGTCTTAAA
AAAAAA
back to top

protein sequence of SMED30023355-orf-1

>SMED30023355-orf-1 ID=SMED30023355-orf-1|Name=SMED30023355-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=383bp
MESELTKRIVRVGSRTSLLAMTQTHMIIDLLKNKNPDIEFRLITMDTMGD
KILNTKLYQIGDTALFTKELELALLENEVDFVVHSLKDVPTIMSKQFVIG
SISLRESCDDAVVLKLNSKYKNLESLPEGSVIGTSSVRRISQLKRKYPHL
KFLSIRGNLNTRLLKLDDPEKAFQMNKGDNQKYEAIILAKAGLERLTWNH
RISEVLSYEDTFYAVGQGALACECRRNDIEMRKILATINDEHSMLTCMAE
RAFMHELEGGCSTPIGVRSTLKENKFILKGCLLNLEGSESVFVKDEIDLP
EYEKRLVQSLSNGHNKTSMINGDSDTTYTGIEIYGLNPVAYSRIKACIKL
GLQLATNTLLNGGDKILNEIKFNRLKSGTNQA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036803Porphobilinogen_deaminase_C_sf
IPR000860HemC
IPR022417Porphobilin_deaminase_N
IPR022418Porphobilinogen_deaminase_C
IPR022419Porphobilin_deaminase_cofac_BS
Vocabulary: biological process
TermDefinition
GO:0033014tetrapyrrole biosynthetic process
GO:0018160peptidyl-pyrromethane cofactor linkage
GO:0006779porphyrin-containing compound biosynthetic process
GO:0006782protoporphyrinogen IX biosynthetic process
GO:0006783heme biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0004418hydroxymethylbilane synthase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000860Porphobilinogen deaminasePRINTSPR00151PORPHBDMNASEcoord: 249..266
score: 59.52
coord: 131..148
score: 56.88
coord: 49..69
score: 52.61
coord: 80..99
score: 47.86
IPR000860Porphobilinogen deaminaseTIGRFAMTIGR00212TIGR00212coord: 10..292
e-value: 3.6E-91
score: 303.2
IPR000860Porphobilinogen deaminasePANTHERPTHR11557PORPHOBILINOGEN DEAMINASEcoord: 5..373
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 10..228
e-value: 4.9E-76
score: 256.6
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 107..221
e-value: 4.9E-76
score: 256.6
NoneNo IPR availableCDDcd13645PBP2_HuPBGD_likecoord: 10..292
e-value: 5.15503E-133
score: 380.044
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 8..238
IPR022417Porphobilinogen deaminase, N-terminalPFAMPF01379Porphobil_deamcoord: 10..232
e-value: 1.4E-71
score: 240.2
IPR036803Porphobilinogen deaminase, C-terminal domain superfamilyGENE3DG3DSA:3.30.160.40coord: 240..375
e-value: 5.6E-21
score: 77.0
IPR036803Porphobilinogen deaminase, C-terminal domain superfamilySUPERFAMILYSSF54782Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domaincoord: 239..304
IPR022418Porphobilinogen deaminase, C-terminalPFAMPF03900Porphobil_deamCcoord: 245..296
e-value: 7.3E-15
score: 55.1
IPR022419Porphobilinogen deaminase, dipyrromethane cofactor binding sitePROSITEPS00533PORPHOBILINOGEN_DEAMcoord: 250..266