Vang-1

Overview
NameVang-1 (ADZ58513.1)
Smed IDSMED30023352
Length (bp)2299
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vang-1 (SMED30023352) t-SNE clustered cells

Violin plots show distribution of expression levels for Vang-1 (SMED30023352) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vang-1 (SMED30023352) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vang-1 (SMED30023352) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023352

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023352SMESG000029281.1 dd_Smed_v4_9100_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023352SMESG000029281.1 dd_Smed_v4_9100_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023352SMESG000029281.1 dd_Smed_v4_9100_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023352SMESG000029281.1 Contig39944newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023352SMESG000029281.1 Contig39944uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30023352SMESG000029281.1 dd_Smed_v6_9100_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30023352SMESG000029281.1 Smed-vang-1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30023352SMESG000029281.1 Smed-vang-1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30023352SMESG000029281.1 Smed-vang-1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30023352SMESG000029281.1 Smed-vang-1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30023352SMESG000029281.1 Smed-vang-1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30023352SMESG000029281.1 JN100094smed_ncbi_20200123PMID:22339734
Beane et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30023352SMESG000029281.1 JN100094smed_ncbi_20200123PMID:22339734
Beane et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023352SMESG000029281.1 JN100094smed_ncbi_20200123PMID:22339734
Beane et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vang-1 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 231.491 bits (589), Expect = 1.320e-66
Identity = 183/551 (33.21%), Postives = 296/551 (53.72%), Query Frame = 3
Query:  393 NNGYGDYPNIVSKP------INDDFNNGEKIQVQILPQDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLS--WILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
             +G G   ++  +P      + +D    E++Q      D+NWG +T TA+T  S+   S E+IA ++  M + V       DC R +G ++   L ++   +PIA ++LP I L   E+  C   CEG  IS+  KL+IL++GTWALFFR+++  + RV +FRA +L + F+ V +YWLFY VRILD + +++ GIV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + ++V RS DG SRFY +G LSIQ AA+ VL+NY  DF  YN +L+   K +  K     + +  +  + N T   +                                    +  +  +   YEE+E E++ +KR+ RL+VAVEEAF H+   +  ++ +   ++  M   EAA+ I P++ + LQK LR++R+   +S   ++ H+A C++  ++PK  ++++             +A P  + +   KD  LS  W L+ ++ ++  L + I F LK   C   D  L+  V K+PF  L E+  +  + +F L   SETSV
Sbjct:   37 KDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQ------DDNWG-ETTTAITGTSEHSISQEDIARISKDMEDSVG-----LDCKRYLGLTVASFLGLLVFLTPIAFILLPPI-LWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAA----------------------------AARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEV--MDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERY------------LSAGPTLQYD---KDRWLSTQWRLVSDEAVTNGLRDGIVFVLK---CL--DFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          
BLAST of Vang-1 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 231.491 bits (589), Expect = 1.320e-66
Identity = 183/551 (33.21%), Postives = 296/551 (53.72%), Query Frame = 3
Query:  393 NNGYGDYPNIVSKP------INDDFNNGEKIQVQILPQDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLS--WILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
             +G G   ++  +P      + +D    E++Q      D+NWG +T TA+T  S+   S E+IA ++  M + V       DC R +G ++   L ++   +PIA ++LP I L   E+  C   CEG  IS+  KL+IL++GTWALFFR+++  + RV +FRA +L + F+ V +YWLFY VRILD + +++ GIV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + ++V RS DG SRFY +G LSIQ AA+ VL+NY  DF  YN +L+   K +  K     + +  +  + N T   +                                    +  +  +   YEE+E E++ +KR+ RL+VAVEEAF H+   +  ++ +   ++  M   EAA+ I P++ + LQK LR++R+   +S   ++ H+A C++  ++PK  ++++             +A P  + +   KD  LS  W L+ ++ ++  L + I F LK   C   D  L+  V K+PF  L E+  +  + +F L   SETSV
Sbjct:   37 KDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQ------DDNWG-ETTTAITGTSEHSISQEDIARISKDMEDSVG-----LDCKRYLGLTVASFLGLLVFLTPIAFILLPPI-LWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAA----------------------------AARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEV--MDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERY------------LSAGPTLQYD---KDRWLSTQWRLVSDEAVTNGLRDGIVFVLK---CL--DFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          
BLAST of Vang-1 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 231.491 bits (589), Expect = 1.320e-66
Identity = 183/551 (33.21%), Postives = 296/551 (53.72%), Query Frame = 3
Query:  393 NNGYGDYPNIVSKP------INDDFNNGEKIQVQILPQDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLS--WILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
             +G G   ++  +P      + +D    E++Q      D+NWG +T TA+T  S+   S E+IA ++  M + V       DC R +G ++   L ++   +PIA ++LP I L   E+  C   CEG  IS+  KL+IL++GTWALFFR+++  + RV +FRA +L + F+ V +YWLFY VRILD + +++ GIV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + ++V RS DG SRFY +G LSIQ AA+ VL+NY  DF  YN +L+   K +  K     + +  +  + N T   +                                    +  +  +   YEE+E E++ +KR+ RL+VAVEEAF H+   +  ++ +   ++  M   EAA+ I P++ + LQK LR++R+   +S   ++ H+A C++  ++PK  ++++             +A P  + +   KD  LS  W L+ ++ ++  L + I F LK   C   D  L+  V K+PF  L E+  +  + +F L   SETSV
Sbjct:   37 KDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQ------DDNWG-ETTTAITGTSEHSISQEDIARISKDMEDSVG-----LDCKRYLGLTVASFLGLLVFLTPIAFILLPPI-LWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAA----------------------------AARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEV--MDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERY------------LSAGPTLQYD---KDRWLSTQWRLVSDEAVTNGLRDGIVFVLK---CL--DFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          
BLAST of Vang-1 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 229.95 bits (585), Expect = 4.028e-66
Identity = 177/514 (34.44%), Postives = 283/514 (55.06%), Query Frame = 3
Query:  486 QDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLS--WILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            +D+NWG +T TA+T  S+   S E+IA ++  M + V       DC R +G ++   L ++   +PIA ++LP I L   E+  C   CEG  IS+  KL+IL++GTWALFFR+++  + RV +FRA +L + F+ V +YWLFY VRILD + +++ GIV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + ++V RS DG SRFY +G LSIQ AA+ VL+NY  DF  YN +L+   K +  K     + +  +  + N T   +                                    +  +  +   YEE+E E++ +KR+ RL+VAVEEAF H+   +  ++ +   ++  M   EAA+ I P++ + LQK LR++R+   +S   ++ H+A C++  ++PK  ++++             +A P  + +   KD  LS  W L+ ++ ++  L + I F LK   C   D  L+  V K+PF  L E+  +  + +F L   SETSV
Sbjct:   66 EDDNWG-ETTTAITGTSEHSISQEDIARISKDMEDSVG-----LDCKRYLGLTVASFLGLLVFLTPIAFILLPPI-LWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAA----------------------------AARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEV--MDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERY------------LSAGPTLQYD---KDRWLSTQWRLVSDEAVTNGLRDGIVFVLK---CL--DFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 522          
BLAST of Vang-1 vs. Ensembl Human
Match: VANGL2 (VANGL planar cell polarity protein 2 [Source:HGNC Symbol;Acc:HGNC:15511])

HSP 1 Score: 145.976 bits (367), Expect = 2.308e-36
Identity = 89/184 (48.37%), Postives = 126/184 (68.48%), Query Frame = 3
Query:  717 EITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLV----QCLKRKC--YKRYQARQNHGSNHNT 1250
            E+  C  ACEG  IS+  KL+IL++G+WALFFRR + S+ RV + RA ++ + F++V +YWLFY VRILD + + + G+V F+VSLVD LLFVHYLA+V+LE+ Q+Q  + +KV RS DG SRFY VG LSIQ  A+ +L+ Y  DFP YN  L+      L +K   +K Y   + + +N++T
Sbjct:  137 ELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLVVSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNST 320          

HSP 2 Score: 72.0182 bits (175), Expect = 1.801e-12
Identity = 46/181 (25.41%), Postives = 90/181 (49.72%), Query Frame = 3
Query: 1470 AVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            AVEEAF+H+   +  ++    N    M   EAA+ I  ++ + +QK LR +++   ++   ++ H+  C+++ ++PK  ++++              A P  + + + + L   W L+  + ++  L + I F LK      +D  L+ +  KVPFF L E+  +  + +F +   SETSV
Sbjct:  362 AVEEAFTHIKRLQEEEQ---KNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLA------------AGPTIQYHKE-RWLAKQWTLVSEEPVTNGLKDGIVFLLKR-----QDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-1 vs. Ensembl Celegans
Match: vang-1 (Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q95ZZ6])

HSP 1 Score: 155.992 bits (393), Expect = 3.304e-40
Identity = 149/525 (28.38%), Postives = 257/525 (48.95%), Query Frame = 3
Query:  474 QILPQDENWGADTC--TAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKL---MEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVH--VYEGSDEV-RVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPR----DCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            +I P +E+W  +T   T +T+D+    E +     +G  +  +     C R +      +LCIIS+ S   M  LP I            C+  CEG L  +  K I L++    L++R+    + R+   RA + F+   I+FA+WLFY VRI+ +++ ++  IV +S SL+D LL+ HYL++V+LE+ +++  + + + R PDG      +G  SIQ AA  +L+ Y   F  +N  L    +    K  Q+    G+              +K+YNI+  G     ++ N           +       G +  + EE ++EK+ +KR+ RL+ A E+AFSHV      G+++   + NQM +   L AA+ +   I++PL K L+ +R    + SG V  HI +CL+ +LS +  +Q+F            S+  P  ++  + K     W +IC++ +S  + +     LK      DC V+   L+CT+  +PFF+L E+     N +F+L  ++E++V
Sbjct:   55 KIAPPNEDWADNTTVLTGMTTDSFTMEEKVIYTPPIGRVIGRR-----CSRFVWLLASSLLCIISVVSAPIMCSLPIIAPRFGFSMPAIQCDVDCEGLLFLMAIKTIFLVIAIGVLYWRKAMADMPRLYFVRAALTFLVMFILFAFWLFYIVRIMFERYDNYKYIVSYSTSLLDALLWTHYLSVVLLELRRLRAQFIVTIVRDPDGEMHTLNIGAGSIQEAATEILRFYTTRFSSFNIHLDNARQTAVAK--QSGMQGGT------------AGFKMYNIEQFGGQETVSEVNTRALMEAAARRRIG-----GYAEVMQEELDFEKRLKKRKYRLIAAAEDAFSHVQNTAESGTNQKPGINNQMDS---LTAAQNVFTWIVRPLTKYLKTTRLQSRHPSGEVTRHIERCLTLKLSHRTFLQRF-----------FSDRIPQREIVGESK-----WSVICDEAVSSGVQHGTYLVLKSHNPDIDCGVQ---LVCTISSIPFFNLTEQA-KPGNEKFSLKISNESAV 532          
BLAST of Vang-1 vs. Ensembl Celegans
Match: vang-1 (Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q95ZZ6])

HSP 1 Score: 153.295 bits (386), Expect = 3.251e-39
Identity = 127/436 (29.13%), Postives = 221/436 (50.69%), Query Frame = 3
Query:  726 NCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVH--VYEGSDEV-RVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPR----DCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
             C+  CEG L  +  K I L++    L++R+    + R+   RA + F+   I+FA+WLFY VRI+ +++ ++  IV +S SL+D LL+ HYL++V+LE+ +++  + + + R PDG      +G  SIQ AA  +L+ Y   F  +N  L    +    K  Q+    G+              +K+YNI+  G     ++ N           +       G +  + EE ++EK+ +KR+ RL+ A E+AFSHV      G+++   + NQM +   L AA+ +   I++PL K L+ +R    + SG V  HI +CL+ +LS +  +Q+F            S+  P  ++  + K     W +IC++ +S  + +     LK      DC V+   L+CT+  +PFF+L E+     N +F+L  ++E++V
Sbjct:  136 QCDVDCEGLLFLMAIKTIFLVIAIGVLYWRKAMADMPRLYFVRAALTFLVMFILFAFWLFYIVRIMFERYDNYKYIVSYSTSLLDALLWTHYLSVVLLELRRLRAQFIVTIVRDPDGEMHTLNIGAGSIQEAATEILRFYTTRFSSFNIHLDNARQTAVAK--QSGMQGGT------------AGFKMYNIEQFGGQETVSEVNTRALMEAAARRRIG-----GYAEVMQEELDFEKRLKKRKYRLIAAAEDAFSHVQNTAESGTNQKPGINNQMDS---LTAAQNVFTWIVRPLTKYLKTTRLQSRHPSGEVTRHIERCLTLKLSHRTFLQRF-----------FSDRIPQREIVGESK-----WSVICDEAVSSGVQHGTYLVLKSHNPDIDCGVQ---LVCTISSIPFFNLTEQA-KPGNEKFSLKISNESAV 529          
BLAST of Vang-1 vs. Ensembl Fly
Match: Vang (gene:FBgn0015838 transcript:FBtr0330624)

HSP 1 Score: 240.736 bits (613), Expect = 1.509e-69
Identity = 186/572 (32.52%), Postives = 305/572 (53.32%), Query Frame = 3
Query:  387 LQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNI-------------KLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKK---------FKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVL---EAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV*NFRN 2027
             Q      Y   V+   +   +  E I+VQILPQDENWG +T TAVT +T   + ++  +  M +  S K   F C R + +S + +L   +  SP+AM+V+P +             + +  ++  C+  C+GQL+SL ++L++L +G WA+F RR   ++ R+ L+RA +L +  +  FAYWLFY V++ +             D+  +V ++ + VDTLLF+HY+A+V+LE+   Q  YYIK+ RSPDG+SR Y +G+LSIQ AA+ VLQ+Y +DFP +N      L+R      ++++N  SN             +K Y +D   N  + + +     +          +  +  + R YEE E+E++ +KR+ RL+ A EEAF+H+         R+ N+      L   EAA  + P++ + LQK LRV+R+   ++   ++ H+A CL + LSP+  ++ +     VM S              + +    SW LIC++++S+ + N+ TFQL        D+ LM TVHK+P F+L E++ +  + +F L  NSETSV +  N
Sbjct:   65 FQRGDMAPYQTSVNMTGDGSHDGQEVIEVQILPQDENWGENT-TAVTGNTSEQSISMEDINNMWHRESDKGFSFACRRYVESSFYFLLGCGAFFSPVAMVVMPYVGFFPSAFDHPEITQTVRTQLLACSEQCKGQLVSLAARLLLLAIGLWAVFMRRTSATMPRIFLYRALVLLLVTICTFAYWLFYIVQVTNGAKIVVETGGDAVDYKSLVGYATNFVDTLLFIHYVAVVLLELRHQQPCYYIKIIRSPDGVSRSYMLGQLSIQRAAVWVLQHYYVDFPIFN----PYLERIPISVSKSQRNKISN------------SFKYYEVDGVSNSQQQSQSRAVLAANAR-------RRDSSHNERFYEEHEYERRVKKRRARLITAAEEAFTHIK--------RIHNEPAPALPLDPQEAASAVFPSMARALQKYLRVTRQQPRHTFESILKHLAHCLKHDLSPRAFLEPYLTESPVMQS-------------EKERRWVQSWSLICDEIVSRPIGNECTFQLIQ-----NDVSLMVTVHKLPHFNLAEEVVDPKSNKFVLKLNSETSVXHHHN 586          
BLAST of Vang-1 vs. Ensembl Fly
Match: Vang (gene:FBgn0015838 transcript:FBtr0088566)

HSP 1 Score: 239.58 bits (610), Expect = 1.884e-69
Identity = 185/567 (32.63%), Postives = 303/567 (53.44%), Query Frame = 3
Query:  387 LQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNI-------------KLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKK---------FKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVL---EAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
             Q      Y   V+   +   +  E I+VQILPQDENWG +T TAVT +T   + ++  +  M +  S K   F C R + +S + +L   +  SP+AM+V+P +             + +  ++  C+  C+GQL+SL ++L++L +G WA+F RR   ++ R+ L+RA +L +  +  FAYWLFY V++ +             D+  +V ++ + VDTLLF+HY+A+V+LE+   Q  YYIK+ RSPDG+SR Y +G+LSIQ AA+ VLQ+Y +DFP +N      L+R      ++++N  SN             +K Y +D   N  + + +     +          +  +  + R YEE E+E++ +KR+ RL+ A EEAF+H+         R+ N+      L   EAA  + P++ + LQK LRV+R+   ++   ++ H+A CL + LSP+  ++ +     VM S              + +    SW LIC++++S+ + N+ TFQL        D+ LM TVHK+P F+L E++ +  + +F L  NSETSV
Sbjct:   65 FQRGDMAPYQTSVNMTGDGSHDGQEVIEVQILPQDENWGENT-TAVTGNTSEQSISMEDINNMWHRESDKGFSFACRRYVESSFYFLLGCGAFFSPVAMVVMPYVGFFPSAFDHPEITQTVRTQLLACSEQCKGQLVSLAARLLLLAIGLWAVFMRRTSATMPRIFLYRALVLLLVTICTFAYWLFYIVQVTNGAKIVVETGGDAVDYKSLVGYATNFVDTLLFIHYVAVVLLELRHQQPCYYIKIIRSPDGVSRSYMLGQLSIQRAAVWVLQHYYVDFPIFN----PYLERIPISVSKSQRNKISN------------SFKYYEVDGVSNSQQQSQSRAVLAANAR-------RRDSSHNERFYEEHEYERRVKKRRARLITAAEEAFTHIK--------RIHNEPAPALPLDPQEAASAVFPSMARALQKYLRVTRQQPRHTFESILKHLAHCLKHDLSPRAFLEPYLTESPVMQS-------------EKERRWVQSWSLICDEIVSRPIGNECTFQLIQ-----NDVSLMVTVHKLPHFNLAEEVVDPKSNKFVLKLNSETSV 581          
BLAST of Vang-1 vs. Ensembl Zebrafish
Match: vangl1 (VANGL planar cell polarity protein 1 [Source:ZFIN;Acc:ZDB-GENE-040621-2])

HSP 1 Score: 214.927 bits (546), Expect = 9.262e-61
Identity = 162/511 (31.70%), Postives = 264/511 (51.66%), Query Frame = 3
Query:  486 QDENWGADTCTAVT--SDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            QD+NWG +T TAVT  SD   S E++A   G G        K +CIR +  ++ ++L ++ + +P++ L+LP +   E  +  C  ACEG  +SL  KL+IL++  WALF R  + S+ R+++FRA +  +  +++ +YWLF+ VRILD +  ++ GIV F+VSLVD LLF+HYLA+V+LE+  +Q  + + V RS DG +  Y +G+LSIQ AA+ +L++Y  DF  +N  L+   K +  K     + +  +    +D    +++ K+                               +  T  +   YEE+E +++ RKR+ RL+VAVEEAF+HV   +  DE +       M   EAA+ I P++ + LQK LR +R+   +S   +  H+A C++  ++PK  ++ +              A P  +   +       W L+    ++  L N   FQLK       D  L+ T   +P   L E+  +  + +F L   SETSV
Sbjct:   69 QDDNWG-ETTTAVTGTSDHSLSQEDLA---GFGKDTEGPVEKLNCIRFLPLALTLLLGLLVLVTPLSFLILPQLMWPE-RLQTCGTACEGLFLSLAFKLLILLLAGWALFMRPTRASLPRIAVFRALLGLLTLLLLLSYWLFFGVRILDSQDDNYQGIVQFAVSLVDALLFIHYLAVVLLEIRHLQPCFSLCVVRSTDGETHHYNMGQLSIQRAALVILEHYYKDFTVHNPALLTAAKSRAAKHLAGLKVYNVD-GAGSDAATAQSRAKMAAAAR--------------------------QRDTSHNELYYEEAEHDRRVRKRKARLVVAVEEAFTHVRRLQ--DEEKKKPPGDEMDPREAAQAIFPSMARALQKYLRTTRQQHCHSMDSIQAHLAFCITNNMTPKAFLESY------------LTAGPTLQYGRESSQTR-HWTLVSEASVTSPLRNGSEFQLKS-----SDFSLVVTSKTIPHLKLSEEYVHPKSHKFVLQLQSETSV 527          
BLAST of Vang-1 vs. Ensembl Zebrafish
Match: vangl2 (VANGL planar cell polarity protein 2 [Source:NCBI gene;Acc:245949])

HSP 1 Score: 190.66 bits (483), Expect = 4.106e-52
Identity = 135/432 (31.25%), Postives = 225/432 (52.08%), Query Frame = 3
Query:  729 CNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNH--GSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRN-MGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            C   CEG  +SL  KL++L++ +WALF R  + ++ R  +FR  ++ + F+ V +YWLFY VR+L+ + +D+ GIV ++VSLVD LLF+ YLALV+LEV  ++  + +KV R+ DG SRFY VG LSIQ AA+ VL +Y  DFP YN  L+   K    K+    + +  G  ++T N T   +                                    +     +   YEE+E +++ RKR+ RL+VAVEEAF+H+   +  +        R  M   EAA+ I   + + +QK LR +R+   +S   +++H+  C+++ ++PK  ++++ +P  T+            ++ N + +     W L+  + ++ AL   + F L+       D  L+ TV  +PF +L E+  +  + +F +   SETSV
Sbjct:  142 CGTPCEGLYVSLAFKLLVLLISSWALFLRPSRSTLPRFFVFRCLLMALVFLFVASYWLFYGVRVLEPRERDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLRPAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDHYYTDFPVYNPALLNLPKSILSKKMSGFKVYSLGEENSTNNSTGQSRAMIAA----------------------------AARRRDNSHNEYYYEEAEMDRRVRKRKARLVVAVEEAFTHIKRLQDDEAAASPKHPREVMDPREAAQAIFAPMARAMQKYLRTTRQQPYHSMESIISHLQFCITHNMTPKAFLERYLTPGPTMQ----------YQRENGRGRQ----WTLVSEEPVTAALRQGLVFSLRRL-----DFALVVTVTPLPFLNLGEEFIDPKSHKFVMRLQSETSV 526          
BLAST of Vang-1 vs. Ensembl Xenopus
Match: krt12.2 (keratin 12, gene 2 [Source:Xenbase;Acc:XB-GENE-6492280])

HSP 1 Score: 203.756 bits (517), Expect = 1.115e-56
Identity = 158/472 (33.47%), Postives = 254/472 (53.81%), Query Frame = 3
Query:  603 KFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHG-SNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            K DC R +G  I   L ++S  +PIA ++LP I L   ++  C  ACEG  IS+  KL+IL++G+WALFFRR +    RV +FRA ++ + F++V +YWLFY VRIL+ + K++ GIV ++VSLVD LLFVHYLA+V+LE+ Q+Q  + +KV RS DG SRFY +G LSIQ  A+ +L+NY  DFP YN  L+   K    K+    + +     NT N++  +                                     +     +   YEE+E E++ RKR+ RL+VAVEEAF+H+   +  D+    N    M   EAA+ I  ++ + +QK LR +++   ++   ++ H+  C+++ ++PK  ++++  P  T+                ++ + L   W L+  + ++  L + + F LK      +D  L+ +  K+PFF L E+  +  + +F +   SETSV
Sbjct:  100 KLDCSRHLGVVIGGALALLSFLTPIAFMLLPQI-LWREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFVFRALLMVLVFLLVVSYWLFYGVRILESRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQFTVKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSKKMSGFKVYSLGEENTTNNSTGQSRAVIA---------------------------AAARRRDNSHNEYYYEEAEHERRVRKRKARLVVAVEEAFTHIKRLQDEDQ---KNPREIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILHHLEFCITHDMTPKAFLERYLGPGPTIQ--------------YHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKR-----QDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-1 vs. Ensembl Mouse
Match: Vangl1 (VANGL planar cell polarity 1 [Source:MGI Symbol;Acc:MGI:2159344])

HSP 1 Score: 229.18 bits (583), Expect = 6.510e-66
Identity = 180/514 (35.02%), Postives = 281/514 (54.67%), Query Frame = 3
Query:  486 QDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLS--WILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            QD+NWG +T TA+T  S+   S E+IA ++  M + V       DC R +G ++   L ++   +PIA ++LP I L   E+  C   CEG LIS+  KL+IL++GTWALFFR+++  V RV +FRA +L + F+ V +YWLFY VRILD + +++  IV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + ++V RS DG SRFY +G LSIQ AA+ VL+NY  DF  YN +L+   K +  K     + +  +  + N T   +                                    +  +  +   YEE+E E++ +KR+ RL+VAVEEAF H+   +  ++ +   ++  M   EAA+ I P++ + LQK LR +R+   +S   ++ H+A C++  ++PK  ++++             +A P  + +   KD  LS  W LI  + ++  L + I F LK   C   D  L+  V K+PF  L E+  +  + +F L   SETSV
Sbjct:   70 QDDNWG-ETTTAITGTSEHSISQEDIARISKDMEDSVG-----LDCKRYLGLTVASFLGLLVFLTPIAFILLPQI-LWREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRADVPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDQNYKDIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAA----------------------------AARRRDSSHNELYYEEAEHERRVKKRRARLVVAVEEAFIHIQRLQAEEQQKSPGEV--MDPREAAQAIFPSMARALQKYLRTTRQQHYHSMESILQHLAFCITNSMTPKAFLERY------------LSAGPTLQYD---KDRWLSTQWRLISEEAVTNGLRDGIVFVLK---CL--DFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV 526          
BLAST of Vang-1 vs. Ensembl Mouse
Match: Vangl1 (VANGL planar cell polarity 1 [Source:MGI Symbol;Acc:MGI:2159344])

HSP 1 Score: 157.532 bits (397), Expect = 1.848e-41
Identity = 113/244 (46.31%), Postives = 162/244 (66.39%), Query Frame = 3
Query:  486 QDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYK 1208
            QD+NWG +T TA+T  S+   S E+IA ++  M + V       DC R +G ++   L ++   +PIA ++LP I L   E+  C   CEG LIS+  KL+IL++GTWALFFR+++  V RV +FRA +L + F+ V +YWLFY VRILD + +++  IV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + ++V RS DG SRFY +G LSIQ AA+ VL+NY  DF  YN +L+   K +  K
Sbjct:   70 QDDNWG-ETTTAITGTSEHSISQEDIARISKDMEDSVG-----LDCKRYLGLTVASFLGLLVFLTPIAFILLPQI-LWREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRADVPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDQNYKDIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAK 306          
BLAST of Vang-1 vs. Ensembl Mouse
Match: Vangl1 (VANGL planar cell polarity 1 [Source:MGI Symbol;Acc:MGI:2159344])

HSP 1 Score: 156.762 bits (395), Expect = 1.309e-40
Identity = 113/244 (46.31%), Postives = 162/244 (66.39%), Query Frame = 3
Query:  486 QDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYK 1208
            QD+NWG +T TA+T  S+   S E+IA ++  M + V       DC R +G ++   L ++   +PIA ++LP I   E E+  C   CEG LIS+  KL+IL++GTWALFFR+++  V RV +FRA +L + F+ V +YWLFY VRILD + +++  IV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + ++V RS DG SRFY +G LSIQ AA+ VL+NY  DF  YN +L+   K +  K
Sbjct:   70 QDDNWG-ETTTAITGTSEHSISQEDIARISKDMEDSVG-----LDCKRYLGLTVASFLGLLVFLTPIAFILLPQILWRE-ELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRADVPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDQNYKDIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAK 306          

HSP 2 Score: 56.225 bits (134), Expect = 1.042e-7
Identity = 42/142 (29.58%), Postives = 70/142 (49.30%), Query Frame = 3
Query: 1593 KPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLS--WILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            + LQK LR +R+   +S   ++ H+A C++  ++PK  ++++             +A P  + +   KD  LS  W LI  + ++  L + I F LK   C   D  L+  V K+PF  L E+  +  + +F L   SETSV
Sbjct:  355 RALQKYLRTTRQQHYHSMESILQHLAFCITNSMTPKAFLERYL------------SAGPTLQYD---KDRWLSTQWRLISEEAVTNGLRDGIVFVLK---CL--DFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV 476          
BLAST of Vang-1 vs. Ensembl Mouse
Match: Vangl2 (VANGL planar cell polarity 2 [Source:MGI Symbol;Acc:MGI:2135272])

HSP 1 Score: 145.591 bits (366), Expect = 1.789e-36
Identity = 89/184 (48.37%), Postives = 126/184 (68.48%), Query Frame = 3
Query:  717 EITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLV----QCLKRKC--YKRYQARQNHGSNHNT 1250
            E+  C  ACEG  IS+  KL+IL++G+WALFFRR + S+ RV + RA ++ + F++V +YWLFY VRILD + + + G+V F+VSLVD LLFVHYLA+V+LE+ Q+Q  + +KV RS DG SRFY VG LSIQ  A+ +L+ Y  DFP YN  L+      L +K   +K Y   + + +N++T
Sbjct:  137 ELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLVISYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNST 320          

HSP 2 Score: 72.0182 bits (175), Expect = 1.373e-12
Identity = 46/181 (25.41%), Postives = 90/181 (49.72%), Query Frame = 3
Query: 1470 AVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            AVEEAF+H+   +  ++    N    M   EAA+ I  ++ + +QK LR +++   ++   ++ H+  C+++ ++PK  ++++              A P  + + + + L   W L+  + ++  L + I F LK      +D  L+ +  KVPFF L E+  +  + +F +   SETSV
Sbjct:  362 AVEEAFTHIKRLQEEEQ---KNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLA------------AGPTIQYHKE-RWLAKQWTLVSEEPVTNGLKDGIVFLLKR-----QDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-1 vs. Ensembl Mouse
Match: Vangl2 (VANGL planar cell polarity 2 [Source:MGI Symbol;Acc:MGI:2135272])

HSP 1 Score: 145.591 bits (366), Expect = 1.789e-36
Identity = 89/184 (48.37%), Postives = 126/184 (68.48%), Query Frame = 3
Query:  717 EITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLV----QCLKRKC--YKRYQARQNHGSNHNT 1250
            E+  C  ACEG  IS+  KL+IL++G+WALFFRR + S+ RV + RA ++ + F++V +YWLFY VRILD + + + G+V F+VSLVD LLFVHYLA+V+LE+ Q+Q  + +KV RS DG SRFY VG LSIQ  A+ +L+ Y  DFP YN  L+      L +K   +K Y   + + +N++T
Sbjct:  137 ELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLVISYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNST 320          

HSP 2 Score: 72.0182 bits (175), Expect = 1.373e-12
Identity = 46/181 (25.41%), Postives = 90/181 (49.72%), Query Frame = 3
Query: 1470 AVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            AVEEAF+H+   +  ++    N    M   EAA+ I  ++ + +QK LR +++   ++   ++ H+  C+++ ++PK  ++++              A P  + + + + L   W L+  + ++  L + I F LK      +D  L+ +  KVPFF L E+  +  + +F +   SETSV
Sbjct:  362 AVEEAFTHIKRLQEEEQ---KNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLA------------AGPTIQYHKE-RWLAKQWTLVSEEPVTNGLKDGIVFLLKR-----QDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-1 vs. UniProt/SwissProt
Match: sp|Q8TAA9|VANG1_HUMAN (Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1 PE=1 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 6.341e-66
Identity = 183/551 (33.21%), Postives = 296/551 (53.72%), Query Frame = 3
Query:  393 NNGYGDYPNIVSKP------INDDFNNGEKIQVQILPQDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLS--WILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
             +G G   ++  +P      + +D    E++Q      D+NWG +T TA+T  S+   S E+IA ++  M + V       DC R +G ++   L ++   +PIA ++LP I L   E+  C   CEG  IS+  KL+IL++GTWALFFR+++  + RV +FRA +L + F+ V +YWLFY VRILD + +++ GIV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + ++V RS DG SRFY +G LSIQ AA+ VL+NY  DF  YN +L+   K +  K     + +  +  + N T   +                                    +  +  +   YEE+E E++ +KR+ RL+VAVEEAF H+   +  ++ +   ++  M   EAA+ I P++ + LQK LR++R+   +S   ++ H+A C++  ++PK  ++++             +A P  + +   KD  LS  W L+ ++ ++  L + I F LK   C   D  L+  V K+PF  L E+  +  + +F L   SETSV
Sbjct:   37 KDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQ------DDNWG-ETTTAITGTSEHSISQEDIARISKDMEDSVG-----LDCKRYLGLTVASFLGLLVFLTPIAFILLPPI-LWRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAA----------------------------AARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEV--MDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERY------------LSAGPTLQYD---KDRWLSTQWRLVSDEAVTNGLRDGIVFVLK---CL--DFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          
BLAST of Vang-1 vs. UniProt/SwissProt
Match: sp|Q80Z96|VANG1_MOUSE (Vang-like protein 1 OS=Mus musculus OX=10090 GN=Vangl1 PE=1 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 4.553e-65
Identity = 180/514 (35.02%), Postives = 281/514 (54.67%), Query Frame = 3
Query:  486 QDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLS--WILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            QD+NWG +T TA+T  S+   S E+IA ++  M + V       DC R +G ++   L ++   +PIA ++LP I L   E+  C   CEG LIS+  KL+IL++GTWALFFR+++  V RV +FRA +L + F+ V +YWLFY VRILD + +++  IV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + ++V RS DG SRFY +G LSIQ AA+ VL+NY  DF  YN +L+   K +  K     + +  +  + N T   +                                    +  +  +   YEE+E E++ +KR+ RL+VAVEEAF H+   +  ++ +   ++  M   EAA+ I P++ + LQK LR +R+   +S   ++ H+A C++  ++PK  ++++             +A P  + +   KD  LS  W LI  + ++  L + I F LK   C   D  L+  V K+PF  L E+  +  + +F L   SETSV
Sbjct:   70 QDDNWG-ETTTAITGTSEHSISQEDIARISKDMEDSVG-----LDCKRYLGLTVASFLGLLVFLTPIAFILLPQI-LWREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRADVPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDQNYKDIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAA----------------------------AARRRDSSHNELYYEEAEHERRVKKRRARLVVAVEEAFIHIQRLQAEEQQKSPGEV--MDPREAAQAIFPSMARALQKYLRTTRQQHYHSMESILQHLAFCITNSMTPKAFLERY------------LSAGPTLQYD---KDRWLSTQWRLISEEAVTNGLRDGIVFVLK---CL--DFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV 526          
BLAST of Vang-1 vs. UniProt/SwissProt
Match: sp|Q90X64|VNG2A_XENLA (Vang-like protein 2-A OS=Xenopus laevis OX=8355 GN=vangl2-a PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.548e-56
Identity = 159/472 (33.69%), Postives = 254/472 (53.81%), Query Frame = 3
Query:  603 KFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHG-SNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            K DC R +G  I   L ++S  +PIA ++LP I L   ++  C  ACEG  IS+  KL+IL++G+WALFFRR +    RV +FRA ++ + F++V +YWLFY VRIL+ + K++ GIV ++VSLVD LLFVHYLA+V+LE+ Q+Q  + IKV RS DG SRFY +G LSIQ  A+ +L+NY  DFP YN  L+   K    K+    + +     NT N++  +                                     +     +   YEE+E E++ RKR+ RL+VAVEEAF+H+   +  D+    N    M   EAA+ I  ++ + +QK LR +++   ++   ++ H+  C+++ ++PK  ++++  P  T+                ++ + L   W L+  + ++  L + + F LK      +D  L+ +  K+PFF L E+  +  + +F +   SETSV
Sbjct:  100 KLDCSRHLGVVIGGALALLSFLTPIAFMLLPQI-LWREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFVFRALLMVLVFLLVVSYWLFYGVRILESRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQFTIKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSKKMSGFKVYSLGEENTTNNSTGQSRAVIA---------------------------AAARRRDNSHNEYYYEEAEHERRVRKRKARLVVAVEEAFTHIKRLQDEDQ---KNPREIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILHHLEFCITHDMTPKAFLERYLGPGPTIQ--------------YHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKR-----QDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-1 vs. UniProt/SwissProt
Match: sp|Q4VBG5|VANG2_XENTR (Vang-like protein 2 OS=Xenopus tropicalis OX=8364 GN=vangl2 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 5.905e-56
Identity = 158/472 (33.47%), Postives = 254/472 (53.81%), Query Frame = 3
Query:  603 KFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHG-SNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            K DC R +G  I   L ++S  +PIA ++LP I L   ++  C  ACEG  IS+  KL+IL++G+WALFFRR +    RV +FRA ++ + F++V +YWLFY VRIL+ + K++ GIV ++VSLVD LLFVHYLA+V+LE+ Q+Q  + +KV RS DG SRFY +G LSIQ  A+ +L+NY  DFP YN  L+   K    K+    + +     NT N++  +                                     +     +   YEE+E E++ RKR+ RL+VAVEEAF+H+   +  D+    N    M   EAA+ I  ++ + +QK LR +++   ++   ++ H+  C+++ ++PK  ++++  P  T+                ++ + L   W L+  + ++  L + + F LK      +D  L+ +  K+PFF L E+  +  + +F +   SETSV
Sbjct:  100 KLDCSRHLGVVIGGALALLSFLTPIAFMLLPQI-LWREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFVFRALLMVLVFLLVVSYWLFYGVRILESRDKNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQFTVKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSKKMSGFKVYSLGEENTTNNSTGQSRAVIA---------------------------AAARRRDNSHNEYYYEEAEHERRVRKRKARLVVAVEEAFTHIKRLQDEDQ---KNPREIMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILHHLEFCITHDMTPKAFLERYLGPGPTIQ--------------YHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKR-----QDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-1 vs. UniProt/SwissProt
Match: sp|Q8UVJ6|VANG2_DANRE (Vang-like protein 2 OS=Danio rerio OX=7955 GN=vangl2 PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 3.099e-51
Identity = 135/432 (31.25%), Postives = 225/432 (52.08%), Query Frame = 3
Query:  729 CNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNH--GSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRN-MGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            C   CEG  +SL  KL++L++ +WALF R  + ++ R  +FR  ++ + F+ V +YWLFY VR+L+ + +D+ GIV ++VSLVD LLF+ YLALV+LEV  ++  + +KV R+ DG SRFY VG LSIQ AA+ VL +Y  DFP YN  L+   K    K+    + +  G  ++T N T   +                                    +     +   YEE+E +++ RKR+ RL+VAVEEAF+H+   +  +        R  M   EAA+ I   + + +QK LR +R+   +S   +++H+  C+++ ++PK  ++++ +P  T+            ++ N + +     W L+  + ++ AL   + F L+       D  L+ TV  +PF +L E+  +  + +F +   SETSV
Sbjct:  142 CGTPCEGLYVSLAFKLLVLLISSWALFLRPSRSTLPRFFVFRCLLMALVFLFVASYWLFYGVRVLEPRERDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLRPAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDHYYTDFPVYNPALLNLPKSILSKKMSGFKVYSLGEENSTNNSTGQSRAMIAA----------------------------AARRRDNSHNEYYYEEAEMDRRVRKRKARLVVAVEEAFTHIKRLQDDEAAASPKHPREVMDPREAAQAIFAPMARAMQKYLRTTRQQPYHSMESIISHLQFCITHNMTPKAFLERYLTPGPTMQ----------YQRENGRGRQ----WTLVSEEPVTAALRQGLVFSLRRL-----DFALVVTVTPLPFLNLGEEFIDPKSHKFVMRLQSETSV 526          
BLAST of Vang-1 vs. TrEMBL
Match: F2WMR6 (Vang-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1129.01 bits (2919), Expect = 0.000e+0
Identity = 642/643 (99.84%), Postives = 643/643 (100.00%), Query Frame = 3
Query:   84 MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSXXXXXXXXXXXXXXXSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSNNNNYPNNAMPVYNPSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRIIGNSIFIILCIISIASPIAMLVLPNIKLMEWEITNCNPACEGQLISLVSKLIILIVGTWALFFRRKQHSVTRVSLFRAFILFIAFVIVFAYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYNIDNEGNPGENNDNNNNNNSGNLISNQNTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDS+ILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV
Sbjct:    1 MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSNNNNYPNNAMPVYNPSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRIIGNSIFIILCIISIASPIAMLVLPNIKLMEWEITNCNPACEGQLISLVSKLIILIVGTWALFFRRKQHSVTRVSLFRAFILFIAFVIVFAYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYNIDNEGNPGENNDNNNNNNSGNLISNQNTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSMILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 643          
BLAST of Vang-1 vs. TrEMBL
Match: I0AYW2 (Vang-1 OS=Schmidtea mediterranea OX=79327 GN=vang-1 PE=2 SV=1)

HSP 1 Score: 1127.85 bits (2916), Expect = 0.000e+0
Identity = 642/643 (99.84%), Postives = 642/643 (99.84%), Query Frame = 3
Query:   84 MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSXXXXXXXXXXXXXXXSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSNNNNYPNNAMPVYNPSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRIIGNSIFIILCIISIASPIAMLVLPNIKLMEWEITNCNPACEGQLISLVSKLIILIVGTWALFFRRKQHSVTRVSLFRAFILFIAFVIVFAYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYNIDNEGNPGENNDNNNNNNSGNLISNQNTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDS ILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV
Sbjct:    1 MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSNNNNYPNNAMPVYNPSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRIIGNSIFIILCIISIASPIAMLVLPNIKLMEWEITNCNPACEGQLISLVSKLIILIVGTWALFFRRKQHSVTRVSLFRAFILFIAFVIVFAYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYNIDNEGNPGENNDNNNNNNSGNLISNQNTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSXILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 643          
BLAST of Vang-1 vs. TrEMBL
Match: A0A0L8FGX6 (Vang-like protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021207mg PE=3 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 2.361e-81
Identity = 195/520 (37.50%), Postives = 297/520 (57.12%), Query Frame = 3
Query:  459 EKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKK--FKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            E+I+VQILPQD+NWG D  TA+T +T  +A ++  +      +      FDC R +G ++   L +   ASPI M++LP + +M W+   C P CEG LIS   KLIIL++GT ALFFR  + ++ RV +FRA +LF+ FV+ FA+WLFY VRI  +K    ++Y IV FSVSLVD LLF+HYL++++LE+ Q+Q  Y +KV RSPDG+S+ Y +G LSIQ AA+ VL+NY  DFP +N  L    KR                        K T  K+Y++D     G            +        +  T  + R YEE E+E++ RKR+ RL+++ +EAF+H+   +      +      M   EAA+ + P++ + LQK LRV+R+   Y+   V+ H+A C+S+ +SPK  V+++     +    ++ N K  + L          W+L+C+ LL++ +++ I FQL+       +L L+C+VHK+P FSL E++ +  + +F L  NSETSV
Sbjct:   78 ERIEVQILPQDDNWG-DNTTAITGNTSETAFSMEDMHKFSKDLDDS-IGFDCTRYVGTALATFLSLFGFASPIIMVILPKLGIMTWDAGPCKPECEGLLISFTFKLIILLMGTMALFFRHPKATMPRVYVFRAVVLFLVFVLTFAFWLFYGVRIFKRKDAKTEYYNIVQFSVSLVDALLFIHYLSIIVLEIRQLQPQYVVKVVRSPDGLSQNYNIGILSIQRAAVSVLENYYKDFPVFNPYLENVHKRSS----------------------KVTSLKIYDVDGVNTSGPQGRQRAVFAPNSR-------RRDTSHNERFYEEQEYERRVRKRKARLIMSADEAFTHIKRMQDEQGPAIP-----MDPYEAAQAVFPSMARALQKYLRVTRQQPRYTMEAVLQHLATCISHDVSPKAFVEKY-----LTQGAVIMNEKDYKGLEK--------WVLVCDHLLTREIEHGIVFQLRQ-----GELSLLCSVHKLPHFSLTEEVIDPKHNKFVLRLNSETSV 543          
BLAST of Vang-1 vs. TrEMBL
Match: A0A0F6N0Q3 (Vang-like protein OS=Terebratalia transversa OX=34513 GN=str PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 2.690e-79
Identity = 198/540 (36.67%), Postives = 307/540 (56.85%), Query Frame = 3
Query:  459 EKIQVQILPQDENWGADTC--TAVTSDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEI----------------TNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYN---YDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            ++I+VQILPQD+NWG +T   T  TS+TG S E+++ +   M + +      FDC R IG+ +  IL  ++  SPI M++LP + +  WE                 +NC P CEG LISL  KL+IL++GTWALFFR+ + ++ R+ +FRA ILF+ FV+ FA+WLFY+VRIL KK KD+Y I+ F+VSL D+LLF+HYL++++LE+ QMQ  Y ++V RSPDG SR Y +G+LSIQ AA+ +L+ Y  DFP YN     +    +RK    ++     G  H TP+           +                              +     + R YEE E+E++ RKR+ RL+VA +EAF+H+          +      M   EAA+ I P++ + LQK LRV+R+   YS   ++ H+A CLS+ +SP+  ++++         +   N   N++ +++P     +W+LIC+ LLS+A+++   FQL+       D+ ++C+V K+P F++ E++ N  + +F L  NSETSV
Sbjct:   59 DRIEVQILPQDDNWGDNTTAITGATSETGISMEDVSRIEKDMDDSMG-----FDCARYIGSVLAAILGFLAFVSPIVMVLLPKLNIDGWETVPCEASCIVDTKTDTGSNCEPKCEGLLISLAFKLLILLIGTWALFFRKPKATMPRIFIFRAAILFLVFVLTFAFWLFYAVRILQKKEKDYYSIISFAVSLADSLLFIHYLSIILLEIRQMQPMYVVRVVRSPDGESRSYNIGQLSIQRAAVTILEQYYKDFPVYNPYLDSIPGSSRRKNLTNFKFYDVDGVTHQTPHGRSRAIFAAAAH------------------------------RRDRSHNDRFYEEQEYERRLRKRRARLIVAADEAFTHIRRLHEEQGPAIP-----MDPQEAAQAIFPSMARALQKYLRVTRQQPRYSMENILEHLAACLSHDMSPRSFIERY---------MSQGNVIHNDR-DHRPTQ---TWVLICDTLLSRAVEDGTLFQLRQ-----GDIAILCSVRKIPHFNITEEVINPKDNKFVLRLNSETSV 540          
BLAST of Vang-1 vs. TrEMBL
Match: R7U2Q5 (Vang-like protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_198451 PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 3.042e-79
Identity = 197/550 (35.82%), Postives = 310/550 (56.36%), Query Frame = 3
Query:  375 PVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTC--TAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQAR-QNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            P S +   G G     +S+PI  D + GE+I+VQILPQD+NWG  T   T  TS+TG S E+++ +    N    +   F+C R +G+ +  +L +++  SPIAM+VLP + L  W    C P CEG LIS   KL+IL++G+WALFFR+ + ++ R+ +FRA +LF+ FV+ FAYWLFY VRI D+  +D+  IV F+VS  D LLF+HY+A+++LE+ Q+Q  Y +K+ RSPDG SR Y VG+LSIQ  A+  L+ Y  DF  YN   ++ + RK  K  + +  +   N  +PN   + +++  +                               +  T  + R YEE E+E++  KR+ RLLVA EEAF+H+   +  DE+        +G  EAA+ I P++ + LQK LR++R+   Y+   ++ H+A CL++ +SPK  ++++ S   T+               N++       W+L+C++LLS+ +++   FQL+  D  V     + +V K+P F++ E + +    +F L  NSETSV
Sbjct:   31 PSSTVMIGGPG-----ISEPI--DSSAGERIEVQILPQDDNWGETTTAITGATSETGFSMEDMSRI----NKDLEESIGFNCARYVGSILAGLLGLVAFLSPIAMVVLPKLHLKPWPQQECLPDCEGLLISFAFKLLILLIGSWALFFRKPKATMPRIFIFRALVLFLIFVLTFAYWLFYGVRIFDQAIEDYKSIVAFAVSYADALLFIHYVAIILLEIRQLQPQYVVKLVRSPDGESRSYHVGQLSIQRMAVWCLEQYYRDFQSYN-PYLEHIPRKAPKISEFKFYDIDGNVTSPNAGHNSRSRALL--------------------------AAAARRRDTSHNDRFYEEQEYERRVHKRKARLLVAAEEAFTHIKRMQ--DEL---GPAIPLGPKEAAQAIFPSLARALQKYLRITRQQPRYTMDGIMDHLATCLAHDMSPKAFLERYLSQGATIW--------------NDKDHRATQKWVLVCDQLLSREVEDGTLFQLRQGDVSV-----LASVRKMPHFNVTEDVLDPKTNKFVLRLNSETSV 518          
BLAST of Vang-1 vs. Ensembl Cavefish
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:NCBI gene;Acc:103034531])

HSP 1 Score: 215.698 bits (548), Expect = 3.588e-61
Identity = 172/530 (32.45%), Postives = 274/530 (51.70%), Query Frame = 3
Query:  435 INDDFNNGEKIQVQILPQDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLN-NQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            + D    GE++Q      D+NWG +T TAVT  S+   S E+I  ++  + + V       DC   +  S  +IL ++ + +P+A LVLP++ L    +  C  ACEG  IS+  KL+IL++  WALFFR  +  + R+ +FRA +  + F+ V +YWLFY VRI D K +D+ GIV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + + VTRS DG +R Y +G+LSIQ AA+ VL+NY  DFP +N  L+   K +  K     + +  +    N+      + +                         +      +  T  +   YEE+E E++ RKR+ RL+VAVEEAF+H+   +  ++ +   ++  M   EAA+ I P++ + LQK LR +R+   +S   +  H+A C+++ ++PK  ++ +                P   L   + + L   W LI    ++  L     F LK       D  L+ T  K+P+  L E+  +  + +F L   SETSV
Sbjct:   56 LGDQSMRGEEMQ------DDNWG-ETTTAVTGTSEHSLSQEDIVRISKDLDDSVG-----LDCKHYLSVSFSVILGLLVLLTPLAFLVLPHL-LWPERLRVCGTACEGLFISVAFKLLILLLAVWALFFRPPRAGMPRIFVFRALLSTLVFLFVLSYWLFYGVRIFDTKDEDYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPCFSLCVTRSTDGETRHYNLGQLSIQRAAVAVLENYYRDFPVHNPALLTASKSRAAKHLAGLKVYNVDGPGGNNAAAGIAQSQ----------------------SRAMIAAAARRRDTSHNELYYEEAEHERRVRKRKARLVVAVEEAFTHIRRLQEEEQKKSPGEI--MDPREAAQAIFPSMARALQKYLRTTRQQHCHSMESIQQHLAFCITHNMTPKAFLESY--------------LMPGPTLQYGRERWLAHQWTLISEASVTSGLKEGTVFLLK-----CIDFSLVVTTKKIPYIKLSEEFIDPKSHKFVLRLQSETSV 529          
BLAST of Vang-1 vs. Ensembl Cavefish
Match: vangl2 (VANGL planar cell polarity protein 2 [Source:NCBI gene;Acc:103047256])

HSP 1 Score: 191.43 bits (485), Expect = 1.816e-52
Identity = 137/432 (31.71%), Postives = 224/432 (51.85%), Query Frame = 3
Query:  729 CNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNH--GSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRN-MGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            C   CEG  +SL  KL++L++ +WALF R  + ++ R  +FR  ++ + F+ V +YWLFY VR+L+ K KD+ GIV ++VSLVD LLF+ YLALV+LEV  ++  + +KV R+ DG SRFY VG LSIQ AA+ VL  Y  DFP YN  L+   K    K+    + +  G  ++T N T   +                                    +     +   YEE+E +++ RKR+ RL+VAVEEAF+H+   +  ++       R  M   EAA+ I   + + +QK LR +R+   +S   ++ H+  C+++ ++PK  ++++ +P  T+            ++ N + +     W L+  + ++ AL   + F L+       D  L+ TV  +PF +L E+  +  + +F +   SETSV
Sbjct:  140 CGTPCEGLYVSLAFKLLVLLISSWALFLRPPRATLPRFFVFRCLLMALVFLFVASYWLFYGVRVLEPKEKDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLRPAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDQYYSDFPVYNPALLNLPKSILSKKMSGFKVYSLGEENSTNNSTGQSRAMIAA----------------------------AARRRDNSHNEYYYEEAEMDRRVRKRKARLVVAVEEAFTHIKRLQEDEQATSPKHPREVMDPREAAQAIFAPMARAMQKYLRTTRQQPYHSMESIIAHLQFCITHNMTPKAFLERYLTPGPTMQ----------YQRENGRGRQ----WTLVSEEPVTSALRQGLVFSLRRL-----DFSLVVTVTSLPFLNLGEEFIDPKSHKFVMRLQSETSV 524          
BLAST of Vang-1 vs. Ensembl Cavefish
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:103036576])

HSP 1 Score: 173.711 bits (439), Expect = 3.247e-46
Identity = 157/515 (30.49%), Postives = 260/515 (50.49%), Query Frame = 3
Query:  483 PQDENWGADTCTAVT--SDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEW--EITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTP-NDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            PQD+NW A+T TAVT  SD   S E++A   G  +    +R  +     +      +  ++ +   +  L    +  + W   +  C  ACEG  +SL  KL+IL++  WA+F RR + ++ R+++F+A +  +  +++ +YWLF+ VRILD + +++ GIV F+VSLVD LLF HYLA+V+LEV  +Q  + + V RS DG  R Y +G+LSIQ AA+ VL+ Y  DF  +N  L+   K +  K   A + +  N + P +D    +++ K+                                  T  S   YEE++ E++ RKR+ RL+VAVEEAF+HV   +  ++ +    +  M   EAA+ I P++ + LQK LR +R+   ++   + TH+A C++  ++PK  ++ +           LS+  P  +   +     L W L+    ++  L +   FQLK       D  L+ +   +P   + E   +  + +F L   SETSV
Sbjct:   65 PQDDNW-AETTTAVTGTSDHSLSQEDLAGF-GKDSEAPVQRQSW-----LAFLPLALTLLLGVLVLVTPLAFLLLPQLLWPERLQACGTACEGLFLSLAFKLLILLLAGWAVFLRRPRAALPRLAIFKALLALLTLLLLLSYWLFFGVRILDSQDENYQGIVQFAVSLVDALLFTHYLAVVLLEVRHLQPCFCLCVIRSTDGERRHYNLGQLSIQRAAVVVLEQYYKDFSVHNAALLTAAKSRTAKHLAALKVY--NVDGPGSDGGASQSRAKMAAAARHK--------------------------DTSHSELYYEEADHERRVRKRRARLVVAVEEAFTHVQRLQEEEKKKPPGDV--MDPREAAQAIFPSMARALQKYLRTTRQQHCHTMDSIQTHLAFCITNNMTPKAFLESY-----------LSSG-PTLQYGRECWQA-LQWTLVSEAAVTSPLRDGTEFQLKN-----ADFSLVVSTKSIPHLKISEVYVHPKSHKFVLLLQSETSV 524          
BLAST of Vang-1 vs. Ensembl Cavefish
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:103036576])

HSP 1 Score: 174.096 bits (440), Expect = 3.474e-46
Identity = 160/514 (31.13%), Postives = 262/514 (50.97%), Query Frame = 3
Query:  483 PQDENWGADTCTAVT--SDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEW--EITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            PQD+NW A+T TAVT  SD   S E++A   G  +    +R  +     +      +  ++ +   +  L    +  + W   +  C  ACEG  +SL  KL+IL++  WA+F RR + ++ R+++F+A +  +  +++ +YWLF+ VRILD + +++ GIV F+VSLVD LLF HYLA+V+LEV  +Q  + + V RS DG  R Y +G+LSIQ AA+ VL+ Y  DF  +N  L+   K +  K   A + +  +          K K K Y  D  G+ G  + +     +             T  S   YEE++ E++ RKR+ RL+VAVEEAF+HV   +  ++ +    +  M   EAA+ I P++ + LQK LR +R+   ++   + TH+A C++  ++PK  ++ +           LS+  P  +   +     L W L+    ++  L +   FQLK       D  L+ +   +P   + E   +  + +F L   SETSV
Sbjct:   65 PQDDNW-AETTTAVTGTSDHSLSQEDLAGF-GKDSEAPVQRQSW-----LAFLPLALTLLLGVLVLVTPLAFLLLPQLLWPERLQACGTACEGLFLSLAFKLLILLLAGWAVFLRRPRAALPRLAIFKALLALLTLLLLLSYWLFFGVRILDSQDENYQGIVQFAVSLVDALLFTHYLAVVLLEVRHLQPCFCLCVIRSTDGERRHYNLGQLSIQRAAVVVLEQYYKDFSVHNAALLTAAKSRTAKHLAALKVYNVDAF--------KAKLKTYLSDCPGSDGGASQSRAKMAAAARHK-------DTSHSELYYEEADHERRVRKRRARLVVAVEEAFTHVQRLQEEEKKKPPGDV--MDPREAAQAIFPSMARALQKYLRTTRQQHCHTMDSIQTHLAFCITNNMTPKAFLESY-----------LSSG-PTLQYGRECWQA-LQWTLVSEAAVTSPLRDGTEFQLKN-----ADFSLVVSTKSIPHLKISEVYVHPKSHKFVLLLQSETSV 536          
BLAST of Vang-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010728.1 (pep scaffold:Pmarinus_7.0:GL486594:2920:5521:1 gene:ENSPMAG00000009715.1 transcript:ENSPMAT00000010728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 2.631e-21
Identity = 58/186 (31.18%), Postives = 100/186 (53.76%), Query Frame = 3
Query: 1458 RLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            RL+VA EEAF+HV   +  +E R G  +  M   EAA+ I P++ + LQK LR +++   +S   ++ H+A C+++ ++ +  ++++ SP  TV         +P++ L++Q       W L+  + ++ AL +   F L        DLCL+ TV + P F+L E   +  + +F L   SETSV
Sbjct:    1 RLVVAAEEAFTHVRRLQ-EEEQRAGTGL-TMDPQEAAQAIFPSMARALQKYLRATKQQPFHSMEGILKHLAHCIAHDMTARAFLEKYLSPGPTV-------QYEPDKWLSSQ-------WRLLSAEPVTSALRDGTAFSLA-----RADLCLVVTVSRAPRFTLSETFLDPKSHKFVLRLQSETSV 165          
BLAST of Vang-1 vs. Ensembl Nematostella
Match: EDO38357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD40])

HSP 1 Score: 217.238 bits (552), Expect = 8.751e-63
Identity = 163/517 (31.53%), Postives = 271/517 (52.42%), Query Frame = 3
Query:  486 QDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTP-DKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHL-------SWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            QD+NWG    T   + T     +   L+ +G+    K   F   R        I+ +I++ASPI  LV+P   ++ W+   C   C+G  +SL  K +IL+VG WAL+FR+ + ++ RV + R  +L +AF+++  YWLFY +RI+ K+ +DF  I+ F+V+LVD+LLF+HYL++++L + Q +  + +KV RS DG+++FY VG LSIQ AAI+VL+ Y  DFPEYN  ++    R   K++   + +  +    +++  + +T+  +                               +   G + R YEE+E+E+K ++R+ RL+   EEAF H+   +      V      M   E A+++ P+  +PLQK LR  ++H  ++   ++ H+A CL++ +SPK  ++++                    LN+QP   +        SW L+C + ++  L N   FQLK      E L L+ TV+ +P F ++E  F+  N +F L  NSETSV
Sbjct:    1 QDDNWGETATTITETATSIVTLSEGDLSEIGDE--KKGLAFGVCRHFKLIPAAIISLIALASPILFLVIP---VVLWKPPMCGIECDGLFLSLAVKELILVVGIWALYFRKSRVTMPRVFVLRVGVLVLAFLVLVCYWLFYGLRIIAKRGQDFGEILKFAVTLVDSLLFLHYLSVIVLWLRQSEPMFTLKVIRSTDGVNKFYNVGLLSIQRAAIYVLEQYYKDFPEYNPYMMSVPARSSAKQFSTLKFYDIDGKLQDNSKVNPRTRAIITASSQG-------------------------RRNPGRNDRFYEEAEFERKLKRRKARLVATCEEAFGHIKRVQLERGPSVP-----MDPEETAQSLFPSFARPLQKYLRTVKQHHRHNMDAILKHLAHCLTFDMSPKAFLERY--------------------LNDQPCIEYTGASVGPQSWSLVCEEQVTSGLSNSTVFQLK-----TEVLSLVVTVNNIPHFVVDEDEFDFENNKFVLKLNSETSV 457          
BLAST of Vang-1 vs. Ensembl Nematostella
Match: EDO27076 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA95])

HSP 1 Score: 83.1889 bits (204), Expect = 6.089e-19
Identity = 50/162 (30.86%), Postives = 82/162 (50.62%), Query Frame = 3
Query: 1548 MGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHL-------SWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            M   E A+++ P+  +PLQK LR  ++H  ++   ++ H+A CL++ +SPK  ++++                    LN+QP   +        SW L+C + ++  L N   FQLK      E L L+ TV+ +P F ++E  F+  N +F L  NSETSV
Sbjct:    1 MDPEETAQSLFPSFARPLQKYLRTVKQHHRHNMDAILKHLAHCLTFDMSPKAFLERY--------------------LNDQPCIEYTGASVGPQSWSLVCEEQVTSGLSNSTVFQLK-----TEVLSLVVTVNNIPHFVVDEDEFDFENNKFVLKLNSETSV 137          
BLAST of Vang-1 vs. Ensembl Medaka
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:NCBI gene;Acc:101165035])

HSP 1 Score: 217.238 bits (552), Expect = 1.074e-61
Identity = 168/530 (31.70%), Postives = 276/530 (52.08%), Query Frame = 3
Query:  435 INDDFNNGEKIQVQILPQDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            + D    GE +Q      D+NWG +T TA+T  S+   S E+I  +T  + + V       +C R +   + +IL ++ + +P+A LVLP++ L   ++ NC  ACEG  IS+  KL+IL++  W LFFR  + S+ RV  FRA +  +  + V +YWLFY+VRIL+ +  D+ GIV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + + VTRS DG +R Y +G+LSIQ AA+ ++++Y  DFP +N  L+   K +  K     + +  +   P + P     +                          +      +  T  +   YEE+E E++ RKR+ RL+VAVEEAF+H+   +  ++ +    +  M   EAA+ I P++ + LQK LR +++   +S   +  H+A C++  ++PK  ++ + +P  T+  S              + + L   W LI    ++  L +   F LK       D  L+    K+PF  + E+  +  + +F L   SETSV
Sbjct:   55 LGDSSVRGEPVQ------DDNWG-ETTTAITGTSEHSLSQEDIVRITKDLEDSVG-----LNCRRYLTRILAVILGVLVLLTPLAFLVLPHL-LWPDKLQNCGTACEGLYISIAFKLLILLLAVWGLFFRPPRASLPRVFAFRALLSVLVLLFVISYWLFYAVRILEAQDADYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPCFSVCVTRSTDGETRHYNLGQLSIQQAALAIIEHYYSDFPVHNPALLSASKSRAAKHLAGLKVYNVDGPGPGNNPAAGLAHS---------------------QSRAMIAAAARRRDTSHNELYYEEAEHERRVRKRKARLVVAVEEAFTHIKRMQEEEQKKSPGDV--MDPREAAQAIFPSMTRALQKYLRTTKQQHCHSMESIQQHLAFCITNNMTPKAFLESYLTPGPTLQYS--------------RDRWLARQWTLISEASVTSGLRDGTVFLLK-----CVDFSLVIAAKKIPFVQMSEEYIDPKSHKFVLRLQSETSV 529          
BLAST of Vang-1 vs. Ensembl Medaka
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:NCBI gene;Acc:101165035])

HSP 1 Score: 217.238 bits (552), Expect = 9.210e-61
Identity = 168/530 (31.70%), Postives = 276/530 (52.08%), Query Frame = 3
Query:  435 INDDFNNGEKIQVQILPQDENWGADTCTAVT--SDTGGSAENIAALT-GMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            + D    GE +Q      D+NWG +T TA+T  S+   S E+I  +T  + + V       +C R +   + +IL ++ + +P+A LVLP++ L   ++ NC  ACEG  IS+  KL+IL++  W LFFR  + S+ RV  FRA +  +  + V +YWLFY+VRIL+ +  D+ GIV ++VSLVD LLF+HYLA+V+LE+ Q+Q  + + VTRS DG +R Y +G+LSIQ AA+ ++++Y  DFP +N  L+   K +  K     + +  +   P + P     +                          +      +  T  +   YEE+E E++ RKR+ RL+VAVEEAF+H+   +  ++ +    +  M   EAA+ I P++ + LQK LR +++   +S   +  H+A C++  ++PK  ++ + +P  T+  S              + + L   W LI    ++  L +   F LK       D  L+    K+PF  + E+  +  + +F L   SETSV
Sbjct:  163 LGDSSVRGEPVQ------DDNWG-ETTTAITGTSEHSLSQEDIVRITKDLEDSVG-----LNCRRYLTRILAVILGVLVLLTPLAFLVLPHL-LWPDKLQNCGTACEGLYISIAFKLLILLLAVWGLFFRPPRASLPRVFAFRALLSVLVLLFVISYWLFYAVRILEAQDADYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPCFSVCVTRSTDGETRHYNLGQLSIQQAALAIIEHYYSDFPVHNPALLSASKSRAAKHLAGLKVYNVDGPGPGNNPAAGLAHS---------------------QSRAMIAAAARRRDTSHNELYYEEAEHERRVRKRKARLVVAVEEAFTHIKRMQEEEQKKSPGDV--MDPREAAQAIFPSMTRALQKYLRTTKQQHCHSMESIQQHLAFCITNNMTPKAFLESYLTPGPTLQYS--------------RDRWLARQWTLISEASVTSGLRDGTVFLLK-----CVDFSLVIAAKKIPFVQMSEEYIDPKSHKFVLRLQSETSV 637          
BLAST of Vang-1 vs. Ensembl Medaka
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:101170632])

HSP 1 Score: 191.815 bits (486), Expect = 1.700e-52
Identity = 171/533 (32.08%), Postives = 269/533 (50.47%), Query Frame = 3
Query:  450 NNGEKIQVQILP---------QDENWGADTCTAVT--SDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            +NGE +  +  P         QD+NW A+T TAVT  S+   S E +    G+G  +  +   F   R +  ++ + + ++ +A+P+  L+LP +   +  +  C  ACEG  +S+  KL+IL+V  WALF R  +  + RV ++RAF+  +  ++  +YWLFY VRILD + +DFYGI  F+VSLVD+ LFVHYLA+V+LE+  +Q  Y + V RS DG +R Y +G+LSIQ AA+ +L+ Y  DFP +N  ++   K +  K     + +  N + P  T   +T                     N N           +  +  +   YEE+++E++ RKR+ RL+VAVEEAF+HV      DE    + +  M V EAA  + P++ + LQK LR +RR   +S   +  H+A CL   +SPK  ++ + SP  T+                   + +   W L+    ++  L +   F LK       D  L   V  +P+  L E+  +  + +F L   SETSV
Sbjct:   58 HNGEPLPGEPAPASAENGDEAQDDNW-AETTTAVTGTSELSVSQEEV---VGLGKEIQDRTQSFR--RYLPLAVGLCVGLLVLATPLVFLLLPAVMWPD-RLQACGAACEGLFLSISFKLLILMVAIWALFLRPGRACLPRVCVYRAFLTTLTLLLTMSYWLFYGVRILDAQDEDFYGIAQFAVSLVDSQLFVHYLAVVLLELRHLQPCYSVCVIRSTDGETRHYNMGQLSIQRAALSILEYYYRDFPLHNPSILSAAKHRAAKHLAGLKVY--NVDAPGSTAAAQTS--------------------NGNQSRATVAAAAKRKDSAHNELYYEEADYERRVRKRRARLVVAVEEAFTHVRRMTKEDENAPPSDI--MDVREAALAVFPSMARSLQKYLRTTRRQHCHSMESIQKHLAFCLVNNMSPKAFLEAYLSPGPTLQ--------------YGSERWMADQWTLVSEASVTSGLKDGAEFLLK-----CLDFSLAVVVKGIPYIRLSEEYVDPKSHKFILLLQSETSV 540          
BLAST of Vang-1 vs. Ensembl Medaka
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:101170632])

HSP 1 Score: 191.815 bits (486), Expect = 1.700e-52
Identity = 171/533 (32.08%), Postives = 269/533 (50.47%), Query Frame = 3
Query:  450 NNGEKIQVQILP---------QDENWGADTCTAVT--SDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            +NGE +  +  P         QD+NW A+T TAVT  S+   S E +    G+G  +  +   F   R +  ++ + + ++ +A+P+  L+LP +   +  +  C  ACEG  +S+  KL+IL+V  WALF R  +  + RV ++RAF+  +  ++  +YWLFY VRILD + +DFYGI  F+VSLVD+ LFVHYLA+V+LE+  +Q  Y + V RS DG +R Y +G+LSIQ AA+ +L+ Y  DFP +N  ++   K +  K     + +  N + P  T   +T                     N N           +  +  +   YEE+++E++ RKR+ RL+VAVEEAF+HV      DE    + +  M V EAA  + P++ + LQK LR +RR   +S   +  H+A CL   +SPK  ++ + SP  T+                   + +   W L+    ++  L +   F LK       D  L   V  +P+  L E+  +  + +F L   SETSV
Sbjct:   58 HNGEPLPGEPAPASAENGDEAQDDNW-AETTTAVTGTSELSVSQEEV---VGLGKEIQDRTQSFR--RYLPLAVGLCVGLLVLATPLVFLLLPAVMWPD-RLQACGAACEGLFLSISFKLLILMVAIWALFLRPGRACLPRVCVYRAFLTTLTLLLTMSYWLFYGVRILDAQDEDFYGIAQFAVSLVDSQLFVHYLAVVLLELRHLQPCYSVCVIRSTDGETRHYNMGQLSIQRAALSILEYYYRDFPLHNPSILSAAKHRAAKHLAGLKVY--NVDAPGSTAAAQTS--------------------NGNQSRATVAAAAKRKDSAHNELYYEEADYERRVRKRRARLVVAVEEAFTHVRRMTKEDENAPPSDI--MDVREAALAVFPSMARSLQKYLRTTRRQHCHSMESIQKHLAFCLVNNMSPKAFLEAYLSPGPTLQ--------------YGSERWMADQWTLVSEASVTSGLKDGAEFLLK-----CLDFSLAVVVKGIPYIRLSEEYVDPKSHKFILLLQSETSV 540          
BLAST of Vang-1 vs. Ensembl Medaka
Match: VANGL2 (VANGL planar cell polarity protein 2 [Source:NCBI gene;Acc:101163605])

HSP 1 Score: 184.496 bits (467), Expect = 5.045e-50
Identity = 139/447 (31.10%), Postives = 226/447 (50.56%), Query Frame = 3
Query:  678 AMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMR-NMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQF-SPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            A L+LP + L   ++  C   CEG  +SL  KL++L++ +WALF R  + ++ R  +FR  ++ + F+ V +YWLFY VR+L+ + +D+ GIV ++ SLVD LLF+ YLALV+LEV  +Q  + +KV R+ DG S+FY VG LSIQ AA+ VL  Y  DFP YN  L+   K    K+    + +  + NT N++  +                                     +     +   YEE+E E++ RKR+ RL+VAVEEAF+H+      +        R  M   EAA+ I   + + +QK LR +R+   +S   +++H+  C+++ ++PK  ++++ +P  T+                 Q       W L+  + ++ AL   + F L+       D  L+ TV  +PF  L E+  +  + +F +   SETSV
Sbjct:  126 AFLILPQV-LWRDDLEVCGTPCEGLYVSLAFKLLVLLISSWALFLRPPRATLPRFFVFRCLLMVLVFLFVASYWLFYGVRVLEPRERDYRGIVEYAASLVDALLFIQYLALVLLEVRHLQPAFCLKVVRTADGASKFYNVGHLSIQRAAVWVLDRYYSDFPVYNPALLNLPKSILSKKITGFKVYSLDENTTNNSTGQSRAMIA---------------------------AAARRRDNSHNEYYYEEAEMERRIRKRKARLVVAVEEAFTHIKRLHKDEATSSPKHPREEMDPREAAQAIFAPMARAMQKYLRTTRQQAFHSMESIISHLQFCITHNMTPKAFLERYLTPGPTMQ--------------YQQQNGGGRQWTLVSEEPVTSALRQGLVFSLRRL-----DFSLVVTVTPLPFLRLGEEFIDPKSHKFVMRLQSETSV 525          
BLAST of Vang-1 vs. Planmine SMEST
Match: SMESG000029281.1 (SMESG000029281.1)

HSP 1 Score: 1129.39 bits (2920), Expect = 0.000e+0
Identity = 643/643 (100.00%), Postives = 643/643 (100.00%), Query Frame = 3
Query:   84 MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSXXXXXXXXXXXXXXXSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSNNNNYPNNAMPVYNPSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRIIGNSIFIILCIISIASPIAMLVLPNIKLMEWEITNCNPACEGQLISLVSKLIILIVGTWALFFRRKQHSVTRVSLFRAFILFIAFVIVFAYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYNIDNEGNPGENNDNNNNNNSGNLISNQNTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV
Sbjct:    1 MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSNNNNYPNNAMPVYNPSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVSVLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRIIGNSIFIILCIISIASPIAMLVLPNIKLMEWEITNCNPACEGQLISLVSKLIILIVGTWALFFRRKQHSVTRVSLFRAFILFIAFVIVFAYWLFYSVRILDKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYNIDNEGNPGENNDNNNNNNSGNLISNQNTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 643          
BLAST of Vang-1 vs. Planmine SMEST
Match: SMESG000053210.1 (SMESG000053210.1)

HSP 1 Score: 137.502 bits (345), Expect = 1.135e-34
Identity = 107/282 (37.94%), Postives = 158/282 (56.03%), Query Frame = 3
Query:  438 NDDFNNGEKIQVQILPQDENWGADTCTAVTSDTGGSAENIAALTGMGNHVSTKRPKFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFRRKQHSVTRVSXXXXXXXXXXXXXXXXYWLFYSVRIL----DKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYN-YDLVQC---LKRKCYKRYQARQNHGSNHNTPND 1259
            ND  N    +  Q L  D++     C++V                  N+ + K P FDC+  +   I I L ++S ASPI M++LPNIK+  W    C+  CE  L+ +  KL IL + +  LF RRK ++  RV +F+  ++ + F+I+F  WLFY +RIL    ++  KDF  +V FS S+ D L+F HYL+LV+LE+  ++  + IKV RSPDG SRFY++G +SIQ+AAI +LQ YVIDFP YN Y    C   + R       + +N    H++ N+
Sbjct:  132 NDRTNQSTHLFSQTLNTDKSSKVSNCSSV------------------NYENDKFP-FDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRVLVFKLVLIMLLFIIIFGLWLFYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISRDSNTDLCSSKNKKDTHDSLNE 394          
BLAST of Vang-1 vs. Planmine SMEST
Match: SMESG000046194.1 (SMESG000046194.1)

HSP 1 Score: 109.383 bits (272), Expect = 1.649e-24
Identity = 66/202 (32.67%), Postives = 112/202 (55.45%), Query Frame = 3
Query: 1407 RLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 2012
            R YEE E+EK+  KR++RL++A E+AF ++  Y+  +  R  +  + +G  EAA+ I   ++KPLQK LR +R+   +S   V+ H+  CL+Y L  +  ++ F     +    +L +    ++L     ++  SWIL  ++L+S+ + +   F L    C   D+ L CTV  +P F+L E++F E   +F    +SETSV
Sbjct:  467 RYYEEVEYEKRVAKRRVRLMLASEDAFRNLFRYD--ENCRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPF-----LSQGPVLEDPGYQQQLYID-DEVVTSWILYSDRLVSRNIGDGTVFHL----CQ-GDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 655          

HSP 2 Score: 79.337 bits (194), Expect = 5.009e-15
Identity = 77/234 (32.91%), Postives = 117/234 (50.00%), Query Frame = 3
Query:  603 KFDCIRXXXXXXXXXXXXXXXXXXXAMLVLPNIKLMEWEITNCNPACEGQXXXXXXXXXXXXXGTWALFFR-------RKQHS------------------------------------VTRVSXXXXXXXXXXXXXXXXYWLFYSVRILDKKF-KDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQ-MFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYN 1169
            +FDC    G  I I L +I+  SP AM+ LP  +L+EW    CN  CE QLISL  KLI++    +  F R       RK+ S                                    + R++  R+F+LF+ F+I   +WLFY +R+L+    + +   V+ +  + D LL VHYL LV++ + +M      +KV R PDG ++ Y+  + S+Q AAI +L+NY++DF  YN
Sbjct:  100 RFDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHTTLPRLTFLRSFLLFLIFIITIVFWLFYGIRMLENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYN 333          
The following BLAST results are available for this feature:
BLAST of Vang-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VANGL11.320e-6633.21VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL11.320e-6633.21VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL11.320e-6633.21VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL14.028e-6634.44VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL22.308e-3648.37VANGL planar cell polarity protein 2 [Source:HGNC ... [more]
back to top
BLAST of Vang-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vang-13.304e-4028.38Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
vang-13.251e-3929.13Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
back to top
BLAST of Vang-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vang1.509e-6932.52gene:FBgn0015838 transcript:FBtr0330624[more]
Vang1.884e-6932.63gene:FBgn0015838 transcript:FBtr0088566[more]
back to top
BLAST of Vang-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vangl19.262e-6131.70VANGL planar cell polarity protein 1 [Source:ZFIN;... [more]
vangl24.106e-5231.25VANGL planar cell polarity protein 2 [Source:NCBI ... [more]
back to top
BLAST of Vang-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
krt12.21.115e-5633.47keratin 12, gene 2 [Source:Xenbase;Acc:XB-GENE-649... [more]
back to top
BLAST of Vang-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vangl16.510e-6635.02VANGL planar cell polarity 1 [Source:MGI Symbol;Ac... [more]
Vangl11.848e-4146.31VANGL planar cell polarity 1 [Source:MGI Symbol;Ac... [more]
Vangl11.309e-4046.31VANGL planar cell polarity 1 [Source:MGI Symbol;Ac... [more]
Vangl21.789e-3648.37VANGL planar cell polarity 2 [Source:MGI Symbol;Ac... [more]
Vangl21.789e-3648.37VANGL planar cell polarity 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Vang-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TAA9|VANG1_HUMAN6.341e-6633.21Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VAN... [more]
sp|Q80Z96|VANG1_MOUSE4.553e-6535.02Vang-like protein 1 OS=Mus musculus OX=10090 GN=Va... [more]
sp|Q90X64|VNG2A_XENLA3.548e-5633.69Vang-like protein 2-A OS=Xenopus laevis OX=8355 GN... [more]
sp|Q4VBG5|VANG2_XENTR5.905e-5633.47Vang-like protein 2 OS=Xenopus tropicalis OX=8364 ... [more]
sp|Q8UVJ6|VANG2_DANRE3.099e-5131.25Vang-like protein 2 OS=Danio rerio OX=7955 GN=vang... [more]
back to top
BLAST of Vang-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F2WMR60.000e+099.84Vang-1 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
I0AYW20.000e+099.84Vang-1 OS=Schmidtea mediterranea OX=79327 GN=vang-... [more]
A0A0L8FGX62.361e-8137.50Vang-like protein OS=Octopus bimaculoides OX=37653... [more]
A0A0F6N0Q32.690e-7936.67Vang-like protein OS=Terebratalia transversa OX=34... [more]
R7U2Q53.042e-7935.82Vang-like protein OS=Capitella teleta OX=283909 GN... [more]
back to top
BLAST of Vang-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
VANGL13.588e-6132.45VANGL planar cell polarity protein 1 [Source:NCBI ... [more]
vangl21.816e-5231.71VANGL planar cell polarity protein 2 [Source:NCBI ... [more]
vangl13.247e-4630.49vang-like protein 1 [Source:NCBI gene;Acc:10303657... [more]
vangl13.474e-4631.13vang-like protein 1 [Source:NCBI gene;Acc:10303657... [more]
back to top
BLAST of Vang-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010728.12.631e-2131.18pep scaffold:Pmarinus_7.0:GL486594:2920:5521:1 gen... [more]
back to top
BLAST of Vang-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vang-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO383578.751e-6331.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270766.089e-1930.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vang-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VANGL11.074e-6131.70VANGL planar cell polarity protein 1 [Source:NCBI ... [more]
VANGL19.210e-6131.70VANGL planar cell polarity protein 1 [Source:NCBI ... [more]
vangl11.700e-5232.08vang-like protein 1 [Source:NCBI gene;Acc:10117063... [more]
vangl11.700e-5232.08vang-like protein 1 [Source:NCBI gene;Acc:10117063... [more]
VANGL25.045e-5031.10VANGL planar cell polarity protein 2 [Source:NCBI ... [more]
back to top
BLAST of Vang-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000029281.10.000e+0100.00SMESG000029281.1[more]
SMESG000053210.11.135e-3437.94SMESG000053210.1[more]
SMESG000046194.11.649e-2432.67SMESG000046194.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30023352
GenBankADZ58513.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023352 ID=SMED30023352|Name=Vang-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2299bp
TATTTTAAGTTTAACCTTAGTTAATAGTTAGCTGCTGAGTTACTTTATTT
AATTTATTTGTTAAAATAATTATTTAATACCTAATGGACGTGGAAAGCAT
CCATAGTGCTAATTCACACAGGTCTCATAACAAGAATATTCATTTAAAAA
ATGGTGCAGATTTTTCCATGCAACCTTATCAAACCTATGATTCTCAATTA
TATGGATGCTCGAACAATAACAATTATCCAAATAATGCAATGCCAGTTTA
TAATCCTAGTTTTTATCCTCAAAATTTTCAAATACAACCAAATGCTTTTA
ATTCACCCCCAATAACAACCAATTTTTGCTTCACTGGCAACAACAATCAA
GCACCGACTAGTGGTGGCTATATTCCCGTGTCTGTCTTACAGAACAATGG
CTATGGAGATTACCCTAACATTGTCAGTAAACCCATTAACGATGATTTTA
ACAACGGAGAGAAAATCCAAGTACAAATATTACCCCAAGACGAGAATTGG
GGTGCCGACACCTGCACTGCCGTTACAAGCGATACAGGGGGCAGCGCAGA
AAACATTGCCGCACTAACCGGAATGGGTAATCATGTTTCAACGAAACGTC
CGAAATTTGACTGCATCCGAATAATCGGAAATTCAATTTTCATCATTCTC
TGCATCATTTCAATCGCTTCTCCGATTGCAATGCTCGTCTTACCAAACAT
CAAACTGATGGAATGGGAAATCACCAATTGCAATCCGGCATGTGAAGGCC
AGTTGATTAGTTTGGTGTCGAAATTGATTATATTGATTGTCGGCACTTGG
GCACTTTTCTTCCGACGCAAGCAACACAGCGTCACTAGAGTCAGCTTGTT
TAGGGCATTTATTTTGTTTATTGCATTTGTTATTGTGTTTGCTTATTGGT
TGTTTTATTCGGTGAGAATTCTCGATAAGAAATTTAAAGACTTTTACGGG
ATTGTGTTGTTTTCTGTGAGTTTGGTCGATACCCTACTGTTTGTCCATTA
CTTGGCACTTGTCATGTTAGAGGTTTATCAAATGCAAATGTTTTACTATA
TAAAAGTCACTCGATCTCCCGACGGAATCAGCCGTTTTTATCGAGTTGGG
CGTCTGTCAATACAATCGGCTGCTATTCACGTTTTACAGAATTACGTAAT
AGATTTCCCGGAATACAATTATGACTTGGTGCAATGTTTAAAACGAAAAT
GCTACAAACGATATCAAGCCCGGCAAAATCACGGTAGTAATCACAACACT
CCGAATGACACACCGGATAAGAAAACAAAATATAAGGTATACAACATTGA
CAATGAAGGTAACCCGGGAGAAAACAACGATAATAACAATAATAATAATT
CTGGAAATCTTATTTCTAACCAAAACACAATCAAAGGCGGAACAGGAACA
TCTGCGAGACTCTATGAGGAATCGGAATGGGAGAAGAAATTTCGTAAACG
TCAAATGAGATTATTGGTAGCAGTAGAAGAAGCATTCAGTCATGTCCATG
TTTATGAAGGAAGCGATGAAGTTAGGGTGGGAAATCAAATGAGAAATATG
GGAGTACTCGAGGCGGCCGAAACGATTTTGCCAGCGATTATGAAACCTCT
GCAAAAATTACTCCGGGTTTCCCGGAGACATTTGAGTTATTCAAGTGGAA
TCGTTGTCACGCATATAGCTCAGTGTCTGTCTTATCGTTTGTCTCCAAAA
TATCTCGTCCAACAATTTTCCCCCTCGGTTACTGTTATGGATTCGCTGAT
TTTGTCCAATGCAAAACCGAACGAAAAACTCAACAACCAACCGAAAGATC
TTCATCTTTCTTGGATTCTCATTTGCAATAAATTGTTGTCGAAAGCTCTT
GATAATGACATAACTTTTCAATTGAAACCCCGTGATTGTCATGTAGAGGA
TTTGTGTCTTATGTGTACTGTACACAAGGTGCCTTTCTTTAGTTTAGAAG
AGAAGATGTTTAACGAATCGAATTGTCGGTTTACATTGCACACGAATTCA
GAAACGTCCGTGTAAAATTTTAGAAATTTATGTAAAAAAAATTGTTTTTG
TTCTTCATTTGGAACTTGAATTATTTGCATTTATCACACCAAATATGTCG
TTATCATGACAATGAATTCTTGTCTACTGTGATGGAGAGATTTGATTGGA
TGAGAGTTCTATTATCAATCGATCAAATGTGTAATTGGAATAATCATCAA
AAATTTTTTGGAAATTATCGTTAATTATATCTCGCAGAATGTATTAAATT
TTGTTTTTTTTTTGAATTATTGAAATTTTTCTTTGATTAAAAATATGTT
back to top

protein sequence of SMED30023352-orf-1

>SMED30023352-orf-1 ID=SMED30023352-orf-1|Name=SMED30023352-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=644bp
MDVESIHSANSHRSHNKNIHLKNGADFSMQPYQTYDSQLYGCSNNNNYPN
NAMPVYNPSFYPQNFQIQPNAFNSPPITTNFCFTGNNNQAPTSGGYIPVS
VLQNNGYGDYPNIVSKPINDDFNNGEKIQVQILPQDENWGADTCTAVTSD
TGGSAENIAALTGMGNHVSTKRPKFDCIRIIGNSIFIILCIISIASPIAM
LVLPNIKLMEWEITNCNPACEGQLISLVSKLIILIVGTWALFFRRKQHSV
TRVSLFRAFILFIAFVIVFAYWLFYSVRILDKKFKDFYGIVLFSVSLVDT
LLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHV
LQNYVIDFPEYNYDLVQCLKRKCYKRYQARQNHGSNHNTPNDTPDKKTKY
KVYNIDNEGNPGENNDNNNNNNSGNLISNQNTIKGGTGTSARLYEESEWE
KKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQMRNMGVLEAAETILP
AIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVT
VMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPR
DCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV*
back to top
Aliases
The feature 'Vang-1' has the following synonyms
Synonym
Vang-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR009539VANGL
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009539Vang-like proteinPFAMPF06638Strabismuscoord: 114..643
e-value: 9.9E-127
score: 423.6
IPR009539Vang-like proteinPANTHERPTHR20886FAMILY NOT NAMEDcoord: 1..643
NoneNo IPR availablePANTHERPTHR20886:SF11VANG-LIKE PROTEIN-RELATEDcoord: 1..643
NoneNo IPR availableTMHMMTMhelixcoord: 287..309
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
NoneNo IPR availableTMHMMTMhelixcoord: 224..243
NoneNo IPR availableTMHMMTMhelixcoord: 181..203