Kinesin motor domain-containing protein

Overview
NameKinesin motor domain-containing protein
Smed IDSMED30023347
Length (bp)2534
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin motor domain-containing protein (SMED30023347) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin motor domain-containing protein (SMED30023347) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin motor domain-containing protein (SMED30023347) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin motor domain-containing protein (SMED30023347) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023347

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023347SMESG000069689.1 SmedASXL_017886SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30023347SMESG000069689.1 dd_Smed_v4_10482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023347SMESG000069689.1 dd_Smed_v4_10482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023347SMESG000069689.1 dd_Smed_v4_10482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30023347SMESG000069689.1 dd_Smed_v6_10482_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023347SMESG000069689.1 dd_Smed_v4_10482_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin motor domain-containing protein vs. Ensembl Zebrafish
Match: ccdc78 (coiled-coil domain containing 78 [Source:ZFIN;Acc:ZDB-GENE-060301-1])

HSP 1 Score: 58.9214 bits (141), Expect = 2.114e-8
Identity = 110/491 (22.40%), Postives = 219/491 (44.60%), Query Frame = 3
Query: 1119 NIRLRDKVEDLQSILLKKNMESNDLKSKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYK------DLETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKSLQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQ------LQEEL--------------------------QNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYAS--IKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDN--INLGPDHKEIIASHP-----TPTETVKLLK---------KYFNDQEFHKTDSSNLMELRQ--------QIKEFGNTTVTDLEIERAQLISRNVXXXXXXXXXXXYIDVYLKK 2399
            N +L  K++  Q+ L ++    +DL  K       ++ EE+KL+ SK ++D++I+  ++++Q E   F+L+N ++  E   TAS ++ E  ++  +       LE ++    D  E F+ +++ F +L       + Q+ EL+ E L L+       ++  +   +   ++  R L S    + +K      P +    K  LG+      L+EEL                          +N R+I   R  +LSQ S  LI+ +++ K+ +++++ L  +L +++++Y+ ++K Y     +      N +     K  + S+L    + Y ++E QL  ++     R   L +   + ++ Y + R+Q+  +    ++ GP   +   + P     T  E  +L +         K   +Q    ++SS   EL Q        QI+E  N+T    E ER QL++R    E++L   +EY+D +L +
Sbjct:   31 NKQLVSKLDSAQNKLGQQAASKSDLSVK------LVQCEEDKLKISKDLVDVQIEANKMREQYEAEIFELKNMVLCHEG--TASSLQAERDRLRQEVSAASTRLEISERNEHDLAEEFTVVKRNFLSLRDAYERERTQSEELSSELLALARTHDTLLQERERTHRHTLELERVRALLSRASQNRVK------PEEFEQSKSTLGENGVQNKLREELEKLRKSYEEQQRRLEDKVVAMGREQQENKRAIQNTRL-QLSQQSTTLILSQQQLKEAENEVSKLQNHLKELNREYRARLKHYIQDITECVSAAGNVDLGQKLKGFVESMLEEMKTSYRSREEQLTKAVRTYRKRIQGLSNAHQQLLIAYRMQREQILALPEHALDAGPPEAQFSPAGPELSGETEREIHRLREDKARLESQLKLAREQMAVLSESSQKTELTQEAWADVKRQIREITNSTQEAQERERIQLLTRATVAEEQLCELKEYVDNHLGR 506          
BLAST of Kinesin motor domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000002158.1 (coiled-coil domain containing 78 [Source:NCBI gene;Acc:100489806])

HSP 1 Score: 63.5438 bits (153), Expect = 9.370e-10
Identity = 118/536 (22.01%), Postives = 238/536 (44.40%), Query Frame = 3
Query: 1077 KSSLVEDINSTKAENIRLRDKVEDLQSIL--LKKNMESNDLKSKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKD----LETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGN---------------------------FKRKSLQPVSNISTIQETRGLKS---PNPHH---ELKILSPISPSKDRNIKLRLGQLQEELQNS-RSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQ-------KQIKSYASIKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDN--INLGPDHKEIIASHP----TPTETVKLL----------------KKYFND-----QEFHKTDSSN---LMELRQQIKEFGNTTVTDLEIERAQLISRNVXXXXXXXXXXXYIDVY----------LKKKLSSRIPR 2423
            ++SL E I     EN++L+D+ E L + L  L+  M        DL + L +  EEEKL+ SK +++L+I+  ++++  E   F+L+N I+ LE +L + E++KE     ++     L+T +  R +  + +  L+  +  L  +     A+N EL++E LNL +  G                               ++++P   ++T  E + L+     N  H   E+  +  I  ++ + ++ R+  + +ELQ + R+I   + K   Q ++ L+  + + +++++Q ++L   L +++++Y+       + +  Y          +   +   K+ + S+L+   + + ++E QL  +      R   L    +  ++ Y + R+Q+    N   + GP       + P       + + LL                KK   D     Q      + N     E+R+Q++EF + T  +LE ER+QL+SR +  E+++   Q+Y+D +          L+K L S  PR
Sbjct:    8 ETSLKEQIRRLTNENVQLQDRNERLYAKLGELQDKMGKLAGSKTDLSSKLVLS-EEEKLKISKELIELQIETNKIREHYEAETFELKNTILTLENRLMSLELQKEKLAGEHEAVKERLQTVEVNRKELADEYIVLKSNYLALSKEHEKEVAKNDELSMELLNLVSQRGQDETYSQSRVLVNEATAELERVKAMVNRLTARNIKPEDVVATEYERQKLERNLLGNQDHIREEIDNIKKIHETQQQRLEERIVAMGKELQEAKRAIRNTQHKMAEQMAV-LLTSQSQLQEVEAQNSHLQLQLKELNEEYRSRLNRYIQDLAEYVDGAARAGGKSQADSSRIKAFVDSMLSDMKASHRSREEQLAGAARQYKKRMQNLIRKHESLLIAYRMQREQMMASGNQDTDPGPPEHHFSITDPELQSQAGQELNLLREDKARLETQVRDLKEKKRLGDTGTANQHVEHNGALNEESWAEIRKQLREFTHNTQEELEKERSQLLSRALVAEEQVAELQDYVDKHLARYKQEIMRLRKLLGSEGPR 541          
BLAST of Kinesin motor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q66KE8|CCD78_XENLA (Coiled-coil domain-containing protein 78 OS=Xenopus laevis OX=8355 GN=ccdc78 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.502e-8
Identity = 110/501 (21.96%), Postives = 224/501 (44.71%), Query Frame = 3
Query: 1119 NIRLRDKVEDLQSILLKKNMESNDLKSKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKE--QRLDA-----LERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGN---------------------------FKRKSLQPVSNISTIQETRGLKS---PNPHH---ELKILSPISPSKDRNIKLRLGQLQEELQNS-RSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYA---SIKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDN--INLGPDHKEIIASHPTPTETVKL--------------------LKKYFND--------QEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRNVXXXXXXXXXXXYIDVYLKK 2399
            N RL  K+ +LQ  + K      DL SK       +  EEEKL+ SK +++L+I+  ++++  E   F+L+N I+ LE +L + E++KE     +   E+ KE  Q +DA      + +  L+  +  L  +     A+N EL++E LNL++  G                               ++++P   ++T  E + L+     N  H   E++ +  I  ++ + ++ R+  + +ELQ + R+I   + K   QS++ L+  + + ++ ++Q ++L   L +++++Y+ ++  Y    +  ++    +       K  + ++L+   + + ++E QL  +      R   L       ++ Y + R+Q+    N  +  GP       + P     V L                     KK  +D        +   K    +  E+R+Q++EF + T  +LE ER+QL+SR +  E+++   Q+Y+D +L +
Sbjct:   29 NERLYAKLGELQDKMGKLAGSKTDLSSK------LVLSEEEKLKISKELIELQIETNKIREHYEAETFELKNTILTLENRLMSLELQKEKLAGEH---ESVKERLQAVDANRKELADEYIVLKSNYLALSKEHEKEVAKNDELSMELLNLASRRGQDETYSQSRALVNEATAELDRVKAMVNRLSARNIKPEDLVATEYERQKLERNLLGNQDHIREEIENMKKIHETQQQRLEERIIAMGKELQEAKRAIRNTQHKMAEQSAV-LLTSQSQLQETEAQNSHLQLQLKELNEEYRSRLNRYIQDLADYVDGTARSKGDGTRMKHFVDNMLSDIKASHRSREEQLAGAARQYKKRMQNLIKKHQSLLIAYRMQREQLLASGNQDVEPGPPEHHFTITDPELQSQVGLELNRLREDKARLETQIHDLKEKKRLSDAGTSNQHVEHGGKLQEESWAEIRKQLREFTHNTQEELERERSQLLSRALVAEEQVAELQDYVDKHLAR 519          
BLAST of Kinesin motor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZLK6|KI18B_CHICK (Kinesin-like protein KIF18B OS=Gallus gallus OX=9031 GN=KIF18B PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 9.617e-7
Identity = 40/172 (23.26%), Postives = 78/172 (45.35%), Query Frame = 3
Query:  156 KCFTEFDENQTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTGTIIIQIKCNVKIYGKEQNDIV 671
            + F E    + ++Q+    +++  + G N + F +G     K+  + G+  + GI Y+ +  L+ ++   R+ K S +V +S   V    I DL +P     I  D  K     G++++GLS     SAE  + + +N   ++   P        +     +IY K+Q+ +V
Sbjct:   75 RVFGEGATQEEVFQHTTREVLDGVLNGYNCSVFAYGATGAGKTYTMLGSEQSPGIMYLTMAELYRRIEARRDEK-SCEVLVSYQEVYNEQIHDLLEPKGPLAIREDPEK-----GVVVQGLSFHQPKSAEQLLEMLANGNKNRTQHPTDANATSSRSHAVFQIYVKQQDRVV 240          
BLAST of Kinesin motor domain-containing protein vs. UniProt/SwissProt
Match: sp|P53086|KIP3_YEAST (Kinesin-like protein KIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIP3 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 4.227e-6
Identity = 30/101 (29.70%), Postives = 52/101 (51.49%), Query Frame = 3
Query:  156 KCFTEFDENQTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSS 458
            K F E      +Y+     L+++ + G NS  F +G     K+  ++G  S  GI ++A+  LFNK+   ++ K  F++ LS + +    I DL KP++ S
Sbjct:  157 KLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELFNKITDLKDEK-DFEISLSYLEIYNERIRDLLKPETPS 256          
BLAST of Kinesin motor domain-containing protein vs. TrEMBL
Match: R7TPL0 (Kinesin motor domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226630 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.490e-34
Identity = 202/851 (23.74%), Postives = 371/851 (43.60%), Query Frame = 3
Query:  189 IYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDR---------NMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTG--TIIIQIKCNVKIYGKEQNDIV---SQFSIVYFP--------ENHL----------SVXXXXXXXXXXXXXXXXXXXXXXTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAI----KTNLGNDFTDRDKSRFLLGPKSSLVEDINSTKAENIRLRDKVEDLQSILLKKNMESNDLKSK--DLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQ-------RLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSN----------------------------LEGNFKRKSLQPVSNISTIQETR-----GLKSPNPHHELKILSPISPSKD--RNIKLRLGQLQEELQNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYAS-----IKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQV--KHMDNINLGPD---------------HKEI------IASHPTPTETVKL---LKKYFNDQEFHK---TDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRNVXXXXXXXXXXXYIDVYLKK 2399
            ++   +E LV+  + G N+   + GE    K+    G+ S  G+  M +  LF+K++KD          N KA   VQ+    +   ++ DL +    S  D+  V+ + T+G  +  L + ++  A    +     W  +  +P   G  +I   I C +++    +   +   S+ ++V  P         N++          S+ S SQ +  L         IN T+ RL Y         L D++GGNC T +L C   +  + +     +    L++++N+PI+N   A++LI + R R +    +  L    +D        G    + +++   + EN+ L+DK E L   L     +  +L S   DL   L +  EEEKL+ SK +++++I+N +LK++ E  ++DL N+I+ LE  L   E E E ++   +   +AKE+       R D  + + AL+  +  L         +N EL +E LNL N                            ++   KR S +P  +I    + R      L      H+  +    S   D  R +  ++  L++E + +R++ +ER K++S+ + ++I +R + + L++  N L   L  ++ +++ ++  Y       +             N K  + S++      +  +E QL ++  +   R +      +  ++ Y  +R QV  K  D ++LGPD                KEI      + +  +  E +K+   +  Y +D + HK   +D+ N+ +LR+Q+ EF + T  +LE ERA L+SRN  LEQE+   Q YID +L +
Sbjct:   42 VFSPSIEPLVDLFMAGFNTCLIITGETGAGKAHSFVGD-SQSGLMQMIIENLFSKMSKDERFMYDSRTDNHKA---VQIQACEIYNELVKDLLQVPGVSN-DYLDVEDTATKGPYVRNLLKKNVGHASEGTNFLRQAWERRTRTPTDFGPSSIHSSIICYLELSVMTKESSIPNKSRLTVVVTPGIEKLSEDSNNIRLREGPNLSKSLVSLSQLVTALANQPFPDRFINYTESRLTY--------LLRDELGGNCKTRVLFCLKQKPDSTSLAAGLRFCTQLAQVKNFPILNDPFAQQLITQWRARVLHFQNQIGLAAGLSD-------TGKVHDIQDELRRIQTENLGLKDKNERLHQKLEDLQGKFGNLASSKTDLSTQLLMT-EEEKLKVSKTLVEMQIENNKLKEEGEEAKYDLTNRILQLENALMEKEGELERFQ---RSEHSAKERLSELEKDRKDLADEYVALKSNYLALNKDHGIGVEKNQELCMELLNLVNAKAIILRRLERMNPNLDLEEDPDVEVARIKAVVKRLSSKPGEDIVGTDQDRETVHNDLFGDLGRHQRDMDKLRSQFDDDARTLDKQMKNLKKESREARNLGRERQKKISELNAQVITLRNDKQNLETVNNRLQHKLKDVNDEFRSRLVKYVEDIADYVDHGGHPDRKKDAANMKKYLDSMMQDLRKAHKVREEQLSSAAQNYKGRLDGALRKHEELLVAYRELRQQVEDKGFDELDLGPDEHHLNITDKDLTTAQQKEILRLKQELGNVTSELEALKIRGRMGDYKDDSKAHKSVSSDADNMKDLRRQLAEFTHNTQEELEQERAGLLSRNAVLEQEVTELQAYIDTHLAR 868          
BLAST of Kinesin motor domain-containing protein vs. TrEMBL
Match: A0A1I8JFZ2 (Kinesin motor domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 5.497e-32
Identity = 165/800 (20.62%), Postives = 346/800 (43.25%), Query Frame = 3
Query:  216 VNATIMGLNSAFFLFGEPEYDKSLIINGNNSNR-GIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTG------TIIIQIKCNVKIYGKEQN-DIVSQFSIVYFP--------ENHLSVXXXX--XXXXXXXXXXXXXXXXXXTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIKT--NLGNDFTDRDKSRFLLGPKSSLVEDINSTKAENIRLRDKVEDLQSILLKKNMESNDLK-SKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLE------------GNFKRKSLQPVSNISTIQ----------------------------ETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYA---SIKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQV-KHMDNINLGPD-------HKEIIASHPTPTETVKLLKKYFND--------------------QEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRN 2339
            V+  + G N  F  FGE    KS  + G++S + G+  + +++    L      + + KV L ++ +    + DL    ++S     +++++   G+ ++G     ++ A  A +LF   W  +       G       +++Q+  ++    KE      S+F++V  P          H+ ++                      +  +R+  +   +L   L++++GGNC T  L+C   Q  ++    T ++   L+ +  +PI+N   A+ L+ + R R +K   +LG+D     + R  +   S +  ++   + EN++LRDK E L   L +   +   L  SK   N   +  EEEKL+  K +++LEI+N +LK+++E  +F++ N+I+ LE +L  + +  E +  +   L   +++R    + F  +++         +++ A+N EL++E LNL N +               +     P + +  I+                            E R L++     EL+ L          ++ R+  L +ELQ++R +A+ R +E+S+    L+  R + +++Q Q N     L  + ++Y+ ++  Y    +   +     G    + +  ++S+L      + ++E QL  +  +   R  +     +R ++ +  +R +V +   +++ GP         +E+I+   T +E ++L ++                        Q     ++ +  +LR+QI++F N+   +LE ERA LI+RN
Sbjct:   62 VDIFLAGYNVCFMCFGESGSGKSFTLAGDSSMKNGLVPLPIFFPDAFLYSQDGARENSKVTLRMVEIYQEKVRDLMVIPTTSDGGL-QLRHTAEGGVEVDGAIVTQVNKASEATTLFREGWTRRNEEMTDQGLASNQSAVVLQL--DLTYVAKETGLPNRSRFTLVDLPGSEKLIFESTHIRMRDGPLLSRAIVAFAGVAKELSSKRNANRVINYNQSVLTRLLQEELGGNCRTRCLVCMKPQSDSDVLAGTLRVAEQLALVNTFPILNDLYAQFLLTQIRARLLKLELDLGSDVGG-GQGRPAM---SDVKTELQRVQTENLQLRDKSERLLYRLEQLQSKYGTLAHSKADLNSELLSTEEEKLKVGKALVELEIENNKLKEELEAQKFEMGNRILELENQLLEASMRAEQWHADAMKLRQTEDERKQLADEFVRIKEQLLTQTRDYDALVAKNEELSMELLNLVNTKNELLKQRDNMSLAGMRGAQHDPQAEMQRIKAMIAKTPAEMAAAAGGGRGSSRRQQLPAERRMLRTGELDRELEGLRGQYDKDQEKLRDRINFLLKELQDTRQLAKNRLREISEVKAALVTARSDAQQMQLQYNRCQHKLKDLQEEYKSRLGRYVQDIAEHEDSRGGGGGDGGSLRDYVTSMLADLRRAHKSREEQLAAAAQEFRGRMMDTAREHERLLVAHESLRQRVLESAPDVDPGPPIDQLRLTDEELISG--TQSELLRLTEELTRARKEAANLKLRLGARPDTGERQRLADGEAHDFQDLRRQIRDFNNSVQAELETERAGLIARN 852          
BLAST of Kinesin motor domain-containing protein vs. TrEMBL
Match: A0A267ED48 (Kinesin motor domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030815g1 PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 5.224e-31
Identity = 171/817 (20.93%), Postives = 351/817 (42.96%), Query Frame = 3
Query:  216 VNATIMGLNSAFFLFGEPEYDKSLIINGNNSNR-GIFYMAVYYLFNKLN--------------KDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTG------TIIIQIKCNVKIYGKEQN-DIVSQFSIVYFP--------ENHLSVXXXX--XXXXXXXXXXXXXXXXXXTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIKT--NLGNDFTDRDKSRFLLGPKSSLVEDINSTKAENIRLRDKVEDLQSILLKKNMESNDLK-SKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQRLDALERFSALQQAFDNLLIQA---NSMKAQNTELNIEYLNLSNLE------------GNFKRKSLQPVSNISTIQ----------------------------ETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYA---SIKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQV-KHMDNINLGPD-------HKEIIASHPTPTETVKLLKKYFND--------------------QEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRN 2339
            V+  + G N  F  FGE    KS  + G++S + G+  + +  LF KL+                   + + KV L ++ +    + DL    ++S     +++++   G+ ++G     ++ A  A +LF   W  +       G       +++Q+  ++    KE      S+F++V  P          H+ ++                      +  +R+  +   +L   L++++GGNC T  L+C   Q  ++    T ++   L+ +  +PI+N   A+ L+ + R R +K   +LG+D     + R  +   S +  ++   + EN++LRDK E L   L +   +   L  SK   N   +  EEEKL+  K +++LEI+N +LK+++E  +F++ N+I+ LE +L  + +  E +  +   L   +++R    + F  ++   + LL Q    +++ A+N EL++E LNL N +               +     P + +  I+                            E R L++     EL+ L          ++ R+  L +ELQ++R +A+ R +E+S+    L+  R + +++Q Q N     L  + ++Y+ ++  Y    +   +     G    + +  ++S+L      + ++E QL  +  +   R  +     +R ++ +  +R +V +   +++ GP         +E+I+   T +E ++L ++                        Q     ++ +  +LR+QI++F N+   +LE ERA LI+RN
Sbjct:   66 VDIFLAGYNVCFMCFGESGSGKSFTLAGDSSMKNGLVPLVLASLFAKLDPADILPGRSDKFLYSQDGARENSKVTLRMVEIYQEKVRDLMVIPTTSDGGL-QLRHTAEGGVEVDGAIVTQVNKASEATTLFREGWTRRNEEMTDQGLASNQSAVVLQL--DLTYVAKETGLPNRSRFTLVDLPGSEKLIFESTHIRMRDGPLLSRAIVAFAGVAKELSSKRNANRVINYNQSVLTRLLQEELGGNCRTRCLVCMKPQSDSDVLAGTLRVAEQLALVNTFPILNDLYAQFLLTQIRARLLKLELDLGSDVGG-GQGRPAM---SDVKTELQRVQTENLQLRDKSERLLYRLEQLQSKYGTLAHSKADLNSELLSTEEEKLKVGKALVELEIENNKLKEELEAQKFEMGNRILELENQLLEASMRAEQWHADAMKLRQTEDERKQLADEFVRIK---EQLLTQTRDYDALVAKNEELSMELLNLVNTKNELLKQRDNMSLAGMRGAQHDPQAEMQRIKAMIAKTPAEMAAAAGGGRGSSRRQQLPAERRMLRTGELDRELEGLRGQYDKDQEKLRDRINFLLKELQDTRQLAKNRLREISEVKAALVTARSDAQQMQLQYNRCQHKLKDLQEEYKSRLGRYVQDIAEHEDSRGGGGGDGGSLRDYVTSMLADLRRAHKSREEQLAAAAQEFRGRMMDTAREHERLLVAHESLRQRVLESAPDVDPGPPIDQLRLTDEELISG--TQSELLRLTEELTRARKEAANLKLRLGARPDTGERQRLADGEAHDFQDLRRQIRDFNNSVQAELETERAGLIARN 870          
BLAST of Kinesin motor domain-containing protein vs. TrEMBL
Match: A0A267DML3 (Kinesin motor domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030815g3 PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 5.827e-31
Identity = 172/817 (21.05%), Postives = 353/817 (43.21%), Query Frame = 3
Query:  216 VNATIMGLNSAFFLFGEPEYDKSLIINGNNSNR-GIFYMAVYYLFNKLN--------KDR------NMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTG------TIIIQIKCNVKIYGKEQN-DIVSQFSIVYFP--------ENHLSVXXXX--XXXXXXXXXXXXXXXXXXTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIKT--NLGNDFTDRDKSRFLLGPKSSLVEDINSTKAENIRLRDKVEDLQSILLKKNMESNDLK-SKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQRLDALERFSALQQAFDNLLIQA---NSMKAQNTELNIEYLNLSNLE------------GNFKRKSLQPVSNISTIQ----------------------------ETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYA---SIKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQV-KHMDNINLGPD-------HKEIIASHPTPTETVKLLKKYFND--------------------QEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRN 2339
            V+  + G N  F  FGE    KS  + G++S + G+  + +  LF KL+         D+        + + KV L ++ +    + DL    ++S     +++++   G+ ++G     ++ A  A +LF   W  +       G       +++Q+  ++    KE      S+F++V  P          H+ ++                      +  +R+  +   +L   L++++GGNC T  L+C   Q  ++    T ++   L+ +  +PI+N   A+ L+ + R R +K   +LG+D     + R  +   S +  ++   + EN++LRDK E L   L +   +   L  SK   N   +  EEEKL+  K +++LEI+N +LK+++E  +F++ N+I+ LE +L  + +  E +  +   L   +++R    + F  ++   + LL Q    +++ A+N EL++E LNL N +               +     P + +  I+                            E R L++     EL+ L          ++ R+  L +ELQ++R +A+ R +E+S+    L+  R + +++Q Q N     L  + ++Y+ ++  Y    +   +     G    + +  ++S+L      + ++E QL  +  +   R  +     +R ++ +  +R +V +   +++ GP         +E+I+   T +E ++L ++                        Q     ++ +  +LR+QI++F N+   +LE ERA LI+RN
Sbjct:   68 VDIFLAGYNVCFMCFGESGSGKSFTLAGDSSMKNGLVPLVLASLFAKLDPADILPGRSDKFLYSQDGARENSKVTLRMVEIYQEKVRDLMVIPTTSDGGL-QLRHTAEGGVEVDGAIVTQVNKASEATTLFREGWTRRNEEMTDQGLASNQSAVVLQL--DLTYVAKETGLPNRSRFTLVDLPGSEKLIFESTHIRMRDGPLLSRAIVAFAGVAKELSSKRNANRVINYNQSVLTRLLQEELGGNCRTRCLVCMKPQSDSDVLAGTLRVAEQLALVNTFPILNDLYAQFLLTQIRARLLKLELDLGSDVGG-GQGRPAM---SDVKTELQRVQTENLQLRDKSERLLYRLEQLQSKYGTLAHSKADLNSELLSTEEEKLKVGKALVELEIENNKLKEELEAQKFEMGNRILELENQLLEASMRAEQWHADAMKLRQTEDERKQLADEFVRIK---EQLLTQTRDYDALVAKNEELSMELLNLVNTKNELLKQRDNMSLAGMRGAQHDPQAEMQRIKAMIAKTPAEMAAAAGGGRGSSRRQQLPAERRMLRTGELDRELEGLRGQYDKDQEKLRDRINFLLKELQDTRQLAKNRLREISEVKAALVTARSDAQQMQLQYNRCQHKLKDLQEEYKSRLGRYVQDIAEHEDSRGGGGGDGGSLRDYVTSMLADLRRAHKSREEQLAAAAQEFRGRMMDTAREHERLLVAHESLRQRVLESAPDVDPGPPIDQLRLTDEELISG--TQSELLRLTEELTRARKEAANLKLRLGARPDTGERQRLADGEAHDFQDLRRQIRDFNNSVQAELETERAGLIARN 872          
BLAST of Kinesin motor domain-containing protein vs. TrEMBL
Match: A0A401NI19 (Kinesin motor domain-containing protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0003950 PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.439e-29
Identity = 188/854 (22.01%), Postives = 363/854 (42.51%), Query Frame = 3
Query:  234 GLNSAFFLFGEPEYDKSLIINGNNSNR-GIFYMAVYYLFNKLN-KDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFD-KVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKI-----ISPKST-GTIIIQIKCNVKIYGKEQNDIVSQFSIVYFP----------ENHLSVXXXXXXXXXXXXXXXXXXXXXXTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHR--AIKTNLGNDFTDRDKSRFLLGPKSSLVED-INSTKAENIRLRD-------KVEDLQSILLKKNMESNDLKSKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKE-C---YKINYKDLETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKSLQPVSNISTIQET-------RGLKSPNPHHELKILSPISPSKDRN------------------------------IKLRLGQLQEELQNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYA---------SIKLXXXXXXXXXXXX--YKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDNINLGPDHKEI---IASHPTPTETVKLLKKYFNDQ--------------------------EFHKTDSSN----LMELRQQIKEFGNTTVTDLEIERAQLISRNVXXXXXXXXXXXYIDVY----------LKKKLSSRIPR 2423
            G+N+   +FGE +  KS  + G  ++R  I  +A+ Y+F     ++    A + + +S+  +   V+ DL   DSS     + K+  +  +G  I+GL+ + + SA  A S F   W  +        P ++  T++ Q+   V+  G E +   S   I+  P           +H            +    +          R+  +    L    ++  GGNC T ++ C P +  T       +  + LS+++N+P++N      L+ + R R  A++     +   +       G K +L+ D I     EN++LRD       K+ DLQ  + +      DL SK       +  EEEKL+ SK ++DL+I+  ++++Q E   F+L++KI+ LE ++   E++K+ C   Y+     L   ++ R +  + +  L+  +  L  Q  +  A+N EL++E LNL+N + +  RK  +   + +   E        + L +     ++K      P  DR                               ++ R+ ++ +ELQ ++   +    +L++ ++ L+  + + K+++++ + L  +L +++++Y+ ++  Y          ++K    N+      +   K  + S+L    S Y ++E QL T+  +   R   +    +  ++ Y + R+Q+  +   +L P   EI   I      ++  + L +   D+                             +TD  +      ELR+Q++EF  TT  DLE ERAQLISR    E++L   QEY+D +          L+K + + IPR
Sbjct:   70 GMNACVVVFGETDSGKSYTLIGEKNDRLAIIPLAIDYIFGAPYLQNLQATAMWSLTISMYEIYAEVLKDLL--DSSGMDPANLKIACNAQDGTFIKGLNRVAVSSAADATSTFRQGWARRTGASTDFGPAASHATVVTQLDLLVQD-GNEMHPTKSSLQIIDLPGAEKLADDKNTSHFQESPLLNKSLHVFAQVVSDLAGTPYPDRVINYSESKLTQLTQEAFGGNCKTRVICCLPPKPETNRLAAVLRTCSTLSQVKNFPVLNDYFVESLVTQYRARILALQHQSFQEMGTKGD-----GEKVNLLRDQIRRLNNENVQLRDRNERLYTKLGDLQGKMGQMAGSKTDLSSK------LVFSEEEKLKISKDLIDLQIQTNKIREQYEAENFELKSKILFLENRIMELELQKDKCTHEYRTAKDCLRVVEKNRKELADEYIVLKTNYMTLSKQHENEVAKNDELSLELLNLANSKKSLTRKQDEYAKSRAIYDEATTELNRVKDLVARLSCQKMKPEEVFVPESDRGTFERNLLGNQDQIKEQIEVMKQNYEKQQNAMEERIVKMGKELQEAKRGIRNTQHKLAEQTVALLGSQSQLKEVETENSQLQLHLKELNEEYRMRLVRYIEDVTDYVDNTVKSGNDNTKPPAADHPYLKRFVDSMLKDIRSAYRSREEQLATAARNYKKRMQNVFKKHEHLLIAYRMQREQILSLGTKDLDPGPSEITFAITDSELLSKQSQELNRLREDKAHLEAKLQDLQEKVRLGRISAPVIFSSLPETDGKDANESWSELRRQLREFTFTTQEDLERERAQLISRVTVAEEQLAELQEYVDKHLGRYKQEITRLRKLVGTEIPR 909          
BLAST of Kinesin motor domain-containing protein vs. Ensembl Cavefish
Match: ccdc78 (coiled-coil domain containing 78 [Source:ZFIN;Acc:ZDB-GENE-060301-1])

HSP 1 Score: 75.8702 bits (185), Expect = 6.967e-14
Identity = 100/458 (21.83%), Postives = 208/458 (45.41%), Query Frame = 3
Query: 1137 KVEDLQSILLKKNMESNDLKSKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLET----AKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKSLQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYASIKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQV----KHMDNINLGPDHKEIIASHPT-PTETVKLLKKYFNDQE----------------FHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRNVXXXXXXXXXXXYIDVYLKKKLSSRIPRNKNL 2435
            K+   QS + ++   S DL SK       ++ EE+KL+ SK +++ +I+  +L++Q E   F L+NK++  +E +++ E E E  K+  + L+      + Q  +  E + +L+ +F ++          + +L+ E L L++      R+  +   +   ++  R L S   H  +++ + +S  KD+             +N R+I   + +EL+Q S  LI  + + K+++++ + L  +L  ++Q+Y+ ++  Y        +   +     K  + S+L      Y ++E QL +S+ +  +R N+L +     ++ Y + R+Q+         +  GP              ET + L++   D++                F+        ++R Q+++  NT     E ER QL+SR V  EQ++   QEY+D +L  +    + R + +
Sbjct:    1 KLGSFQSKVAQQASSSRDLSSK------LVQSEEDKLKISKDLVEAQIETNKLREQYEEEIFQLKNKVLTQDEAISSVEAESERLKLEAESLKAELGVTRGQSQELEEEYGSLKSSFLSVSEALEQEITHSDQLSEELLTLAHTHDTLLRERQRSHKHTLEVERVRALLSRVSHSRVRVRTYVSMGKDQQ------------ENKRAIRSTQ-QELAQQSAALITSQFQLKEVEAENSKLQNHLKDLNQEYRARLTHY------IHDITADVGGRLKEFVDSMLREVRGSYRSREEQLTSSVRNYRSRLNKLNNTHQLLLIAYRMQREQILARAAGDGGLEAGPPEATFSPGESEIRGETERELQRLREDKQSLEKQLTAAQQQVCAHFYLLSEEAWTDIRSQLRDMANTEAQ--ERERLQLVSRAVLAEQQVCELQEYVDNHLGSRYKLEVTRLRRM 431          
BLAST of Kinesin motor domain-containing protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 54.299 bits (129), Expect = 6.087e-8
Identity = 30/101 (29.70%), Postives = 52/101 (51.49%), Query Frame = 3
Query:  156 KCFTEFDENQTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSS 458
            K F E      +Y+     L+++ + G NS  F +G     K+  ++G  S  GI ++A+  LFNK+   ++ K  F++ LS + +    I DL KP++ S
Sbjct:  157 KLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELFNKITDLKDEK-DFEISLSYLEIYNERIRDLLKPETPS 256          
BLAST of Kinesin motor domain-containing protein vs. Ensembl Nematostella
Match: EDO42532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S146])

HSP 1 Score: 92.0485 bits (227), Expect = 4.321e-19
Identity = 179/839 (21.33%), Postives = 346/839 (41.24%), Query Frame = 3
Query:  216 VNATIMGLNSAFFLFGEPEYDKSLIINGNNSNR-GIFYMAVYYLFNKLN---KDRN-----MKASFKVQLSVINVAGNVILDLS-KPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTG------TIIIQIKCNVKIYGKEQNDIVSQFSIVYFP------ENHLSVXXXXXXXXXXXXXXXXXXXXXXTDHR-----LDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIKTNLGNDFTDRDKSRFLLGPK-SSLVEDINSTKAENIRLRDKVEDLQSILL---KKNMESNDLKSKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQR-----LDALERFSALQQAF--DNLLIQANSMK---------AQNTELNIEYLNLSNLEGNFKR-----------------KSLQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYA---SIKLXXXXXXXXXXXXYKSEISSLLNRYDSV-------YAAKENQLKTSINDL------------TTRFNELKSWSDRAIL-------EYILIRDQVKHMDNINLGPDHKEIIASHPTPTE----------TVKLLKKYF-NDQEFHKTDSSNLM-------ELRQQIKEFGNTTVTDLEIERAQLISRNVXXXXXXXXXXXYIDVYLKK 2399
            V     G N++  LFGE    KS  + G+ + + G+  + +  +F K+    +++N       +S +V +         + DL   P  +  ++   +  S T G+ ++  ++  +  A    ++F   W ++  S    G      T +  +  ++ +         S+ S++  P      E+   ++           L         T  R     ++Y+   IL + L D +GGNC T +L+   +   +        I   L+++ NYPIIN   A  LI  + +R I   L  +                 L + +     EN+ L++  E L   +L    K  E+ +   K L + L I  +EEKL+  K ++DL+++N ++ ++ E+ +++L N+I+ LE             +++  D E  KE+R       ALE F    Q    + + ++ N +K          +N EL +E ++LSN++   +R                 + L    +  +IQE   + S +    L +L      +   +  R+ +L+ +LQ S+S  +E  ++++  + E+I  + E K+LQ + N L + L +IS +Y  +++ Y    S+     +       +  + I +++ +              +  +LK SI DL              RF  L+S  DRA L        ++   ++++      +G   +++     T TE          ++KL ++   + QE+H      +         LR+Q++EF   T  DLE ERA L++R    E+E+   ++YI   LK+
Sbjct:   59 VELLCAGYNTSLLLFGETGSGKSFSLAGDKTAKAGLIPLLINGVFMKVRDQAREQNRTHLTATSSSQVVVQCCEFYNEQVTDLLLSPTEAQRVE---IAESATSGVYLKNATKRRVADAAECTAVFREAWAARAHSYTDYGQSDSRTTFLFTLDLSMSLRDNSA-PFTSRLSVIELPGAEKLAEDPTQLRMREGVSLNKSVLAFGQLVATLTSTRDAARNINYNE-SILTSLLHDTLGGNCKTKVLVTLKS-MDSSVLNTVLMIAGQLAQVVNYPIINDSLAMGLI--TYYRRIIHQLKEELKSGGFKSGGSSSNFQELKDQLARLANENVELQEGREQLHRRVLDLEAKYTEATN-SWKQLSSKLEIS-DEEKLQVYKNLVDLQLENNRIIEEAESDKYELTNRILSLEN------------QVHELDAELGKERRSGGQAAQALELFQQDHQDLREEYMTLKTNHIKVSNDYQREVTRNEELAVELVSLSNIKDRLQRDREDVEFEKMQEYYSQLRKLASKFSRGSIQEKLMMSSKDKEGRLNLLRNEHQQELDRLDGRISKLKVDLQESKSAHRETQQKVAAQAAEVITAKAEQKRLQEENNRLDQQLKEISAEYSNRLQQYVHDISVYCGQSSGQQFSLESLNAYIDAMVRKIRDAQEQRVVQLEGRVRELKGSITDLLNKHQQVLSAYSVLRFTALESEQDRARLLSSDEYDAFLPSGEELQTAQAREIGILTRKLHEYENTITELRRKPVKDENSLKLAQELTQHKQEYHHDKGLTIASVEMGWGSLRKQLREFTLNTQQDLETERAALLTRCTMAEEEVCYLKDYITTQLKR 875          
BLAST of Kinesin motor domain-containing protein vs. Ensembl Nematostella
Match: EDO45950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH2])

HSP 1 Score: 53.9138 bits (128), Expect = 1.670e-7
Identity = 34/110 (30.91%), Postives = 59/110 (53.64%), Query Frame = 3
Query:  204 VENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDL 533
            V+ LV + + G N   F +G+    K+  + G  SN GI   A+ +LF +   DR +   ++V +SV+ +   ++ DL   D S+ +D  + K    EGL + GLSE+++
Sbjct:  153 VKPLVISCVDGYNVCIFAYGQTGSGKTFTMEGPVSNPGINQRALQHLFTE-TADRGVDWDYQVTVSVMEIYNEMLRDLLSSDPSAKLDIKQGK----EGLYVPGLSEVEV 257          
BLAST of Kinesin motor domain-containing protein vs. Ensembl Nematostella
Match: EDO49131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY3])

HSP 1 Score: 48.521 bits (114), Expect = 7.753e-6
Identity = 32/147 (21.77%), Postives = 71/147 (48.30%), Query Frame = 3
Query:  156 KCFTEFDENQTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISP 596
            + F E   N  +++N  +++++  + G N   F +G     K+  + G+N+N G+ ++ +  L+ ++++ ++ K +  V +S + V    I DL  P  +  +  D  +     G+ + GL+     SAE  +S+     N++   P
Sbjct:   71 RVFNEEANNTDVFENTTKDIIDGVLDGFNCTVFAYGATGAGKTHTMLGSNNNPGVMFLTMMDLYRRIHEMKDEK-TCDVAVSYLEVYNETIRDLLLPGPALAVREDPQR-----GVCVSGLTLHKPHSAEELLSMLEFGNNNRTQHP 211          
BLAST of Kinesin motor domain-containing protein vs. Ensembl Medaka
Match: kif13a (kinesin family member 13A [Source:NCBI gene;Acc:101161083])

HSP 1 Score: 51.9878 bits (123), Expect = 3.182e-6
Identity = 37/153 (24.18%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  159 CFTEFDEN--------QTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIIS 593
            CF   DE+        + +Y+   E ++     G N+  F +G+    KS  + GN  + G+       LF +++K+ N   +FKV++S + +    + DL  P  S      KV+  +  G  ++GLS++ + + E    L S    S+ ++
Sbjct:   61 CFWSMDESNIPKYAGQEVVYKCLGEGILENAFQGYNACIFAYGQTGSGKSFSMMGNGEHPGLIPRLCCCLFERVHKEANESHTFKVEVSYMEIYNEKVRDLLDPKGSR--QSLKVREHKVLGPYVDGLSQLAVTNFEDIEVLMSEGNKSRTVA 211          
BLAST of Kinesin motor domain-containing protein vs. Ensembl Medaka
Match: kif13a (kinesin family member 13A [Source:NCBI gene;Acc:101161083])

HSP 1 Score: 51.9878 bits (123), Expect = 3.267e-6
Identity = 37/153 (24.18%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  159 CFTEFDEN--------QTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIIS 593
            CF   DE+        + +Y+   E ++     G N+  F +G+    KS  + GN  + G+       LF +++K+ N   +FKV++S + +    + DL  P  S      KV+  +  G  ++GLS++ + + E    L S    S+ ++
Sbjct:   61 CFWSMDESNIPKYAGQEVVYKCLGEGILENAFQGYNACIFAYGQTGSGKSFSMMGNGEHPGLIPRLCCCLFERVHKEANESHTFKVEVSYMEIYNEKVRDLLDPKGSR--QSLKVREHKVLGPYVDGLSQLAVTNFEDIEVLMSEGNKSRTVA 211          
BLAST of Kinesin motor domain-containing protein vs. Ensembl Medaka
Match: kif13a (kinesin family member 13A [Source:NCBI gene;Acc:101161083])

HSP 1 Score: 51.9878 bits (123), Expect = 3.515e-6
Identity = 37/153 (24.18%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  159 CFTEFDEN--------QTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIIS 593
            CF   DE+        + +Y+   E ++     G N+  F +G+    KS  + GN  + G+       LF +++K+ N   +FKV++S + +    + DL  P  S      KV+  +  G  ++GLS++ + + E    L S    S+ ++
Sbjct:   61 CFWSMDESNIPKYAGQEVVYKCLGEGILENAFQGYNACIFAYGQTGSGKSFSMMGNGEHPGLIPRLCCCLFERVHKEANESHTFKVEVSYMEIYNEKVRDLLDPKGSR--QSLKVREHKVLGPYVDGLSQLAVTNFEDIEVLMSEGNKSRTVA 211          
BLAST of Kinesin motor domain-containing protein vs. Planmine SMEST
Match: SMESG000069689.1 (SMESG000069689.1)

HSP 1 Score: 1414.44 bits (3660), Expect = 0.000e+0
Identity = 748/761 (98.29%), Postives = 757/761 (99.47%), Query Frame = 3
Query:  153 IKCFTEFDENQTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTGTIIIQIKCNVKIYGKEQNDIVSQFSIVYFPENHLSVXXXXXXXXXXXXXXXXXXXXXXTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIKTNLGNDFTDRDKSRFLLGPKSSLVEDINSTKAENIRLRDKVEDLQSILLKKNMESNDLKSKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKSLQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYASIKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDNINLGPDHKEIIASHPTPTETVKLLKKYFNDQEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRNVXXXXXXXXXXXYIDVYLKKKLSSRIPRNKNL 2435
            +KCFTEFD+NQTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTGTIIIQIKCNVKIYGKEQNDI SQFSIVYFPENHLSVKSSSQ+LNGLLQLQILLEKINKTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIK+NLGNDF DRDKSRFLLGPKSSLVEDIN TKAENIRLRDKVEDLQSILLKKNM+S+DLKS+DLENHLFIKREEEKLRSSKLIMDLEIKNRQLK+QMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKSLQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSI+LIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYASIKLNFMNSNGNGNINYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDNINLGPD KEIIASHPTPTETVKLLKKYFNDQEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRNVELEQELLAAQEYIDVYLKKKLSSRIPRNKNL
Sbjct:   41 VKCFTEFDDNQTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTGTIIIQIKCNVKIYGKEQNDIASQFSIVYFPENHLSVKSSSQDLNGLLQLQILLEKINKTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIKSNLGNDFIDRDKSRFLLGPKSSLVEDINFTKAENIRLRDKVEDLQSILLKKNMDSSDLKSRDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKEQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKSLQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSIQLIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYASIKLNFMNSNGNGNINYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDNINLGPDLKEIIASHPTPTETVKLLKKYFNDQEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRNVELEQELLAAQEYIDVYLKKKLSSRIPRNKNL 801          

HSP 2 Score: 80.1073 bits (196), Expect = 3.757e-15
Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 2
Query:   38 MNINIYSRIIENDKTDSCIKLFTQSNQTVISCSDGSQL 151
            MNINIYSRIIENDKTDSCIKLFTQSNQTVISCSDGSQL
Sbjct:    1 MNINIYSRIIENDKTDSCIKLFTQSNQTVISCSDGSQL 38          
BLAST of Kinesin motor domain-containing protein vs. Planmine SMEST
Match: SMESG000069689.1 (SMESG000069689.1)

HSP 1 Score: 1326.23 bits (3431), Expect = 0.000e+0
Identity = 714/761 (93.82%), Postives = 723/761 (95.01%), Query Frame = 3
Query:  153 IKCFTEFDENQTIYQNCVENLVNATIMGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTGTIIIQIKCNVKIYGKEQNDIVSQFSIVYFPENHLSVXXXXXXXXXXXXXXXXXXXXXXTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIKTNLGNDFTDRDKSRFLLGPKSSLVEDINSTKAENIRLRDKVEDLQSILLKKNMESNDLKSKDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKSLQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYASIKLXXXXXXXXXXXXYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDNINLGPDHKEIIASHPTPTETVKLLKKYFNDQEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRNVXXXXXXXXXXXYIDVYLKKKLSSRIPRNKNL 2435
            +KCFTEFD+NQTIYQNCVENLVNATIMGLNSAFFLF                                  DRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTGTIIIQIKCNVKIYGKEQNDI SQFSIVYFPENHLSVKSSSQ+LNGLLQLQILLEKINKTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIK+NLGNDF DRDKSRFLLGPKSSLVEDIN TKAENIRLRDKVEDLQSILLKKNM+S+DLKS+DLENHLFIKREEEKLRSSKLIMDLEIKNRQLK+QMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKSLQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSI+LIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYASIKLNFMNSNGNGNINYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDNINLGPD KEIIASHPTPTETVKLLKKYFNDQEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRNVELEQELLAAQEYIDVYLKKKLSSRIPRNKNL
Sbjct:   41 VKCFTEFDDNQTIYQNCVENLVNATIMGLNSAFFLF----------------------------------DRNMKASFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEIDLDSAETAVSLFSNIWNSKIISPKSTGTIIIQIKCNVKIYGKEQNDIASQFSIVYFPENHLSVKSSSQDLNGLLQLQILLEKINKTDHRLDYHGLFILDTFLEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENARRLINKSRHRAIKSNLGNDFIDRDKSRFLLGPKSSLVEDINFTKAENIRLRDKVEDLQSILLKKNMDSSDLKSRDLENHLFIKREEEKLRSSKLIMDLEIKNRQLKEQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQRLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKSLQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEELQNSRSIAQERFKELSQSSIQLIVVREENKKLQSQINYLTRYLNQISQDYQKQIKSYASIKLNFMNSNGNGNINYKSEISSLLNRYDSVYAAKENQLKTSINDLTTRFNELKSWSDRAILEYILIRDQVKHMDNINLGPDLKEIIASHPTPTETVKLLKKYFNDQEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLISRNVELEQELLAAQEYIDVYLKKKLSSRIPRNKNL 767          

HSP 2 Score: 80.4925 bits (197), Expect = 3.487e-15
Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 2
Query:   38 MNINIYSRIIENDKTDSCIKLFTQSNQTVISCSDGSQL 151
            MNINIYSRIIENDKTDSCIKLFTQSNQTVISCSDGSQL
Sbjct:    1 MNINIYSRIIENDKTDSCIKLFTQSNQTVISCSDGSQL 38          
The following BLAST results are available for this feature:
BLAST of Kinesin motor domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc782.114e-822.40coiled-coil domain containing 78 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000002158.19.370e-1022.01coiled-coil domain containing 78 [Source:NCBI gene... [more]
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinesin motor domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q66KE8|CCD78_XENLA1.502e-821.96Coiled-coil domain-containing protein 78 OS=Xenopu... [more]
sp|Q5ZLK6|KI18B_CHICK9.617e-723.26Kinesin-like protein KIF18B OS=Gallus gallus OX=90... [more]
sp|P53086|KIP3_YEAST4.227e-629.70Kinesin-like protein KIP3 OS=Saccharomyces cerevis... [more]
back to top
BLAST of Kinesin motor domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TPL01.490e-3423.74Kinesin motor domain-containing protein OS=Capitel... [more]
A0A1I8JFZ25.497e-3220.63Kinesin motor domain-containing protein OS=Macrost... [more]
A0A267ED485.224e-3120.93Kinesin motor domain-containing protein (Fragment)... [more]
A0A267DML35.827e-3121.05Kinesin motor domain-containing protein (Fragment)... [more]
A0A401NI193.439e-2922.01Kinesin motor domain-containing protein OS=Scylior... [more]
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc786.967e-1421.83coiled-coil domain containing 78 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
KIP36.087e-829.70Kinesin-related antiparallel sliding motor protein... [more]
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO425324.321e-1921.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459501.670e-730.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491317.753e-621.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin motor domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kif13a3.182e-624.18kinesin family member 13A [Source:NCBI gene;Acc:10... [more]
kif13a3.267e-624.18kinesin family member 13A [Source:NCBI gene;Acc:10... [more]
kif13a3.515e-624.18kinesin family member 13A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Kinesin motor domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000069689.13.757e-1598.29SMESG000069689.1[more]
SMESG000069689.13.487e-1593.82SMESG000069689.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023347 ID=SMED30023347|Name=Kinesin motor domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2534bp
ATTTAATATCATAGTTATAAAAGCAGCGATTTTAAACATGAATATAAATA
TATACAGTCGAATTATAGAAAATGATAAAACAGATTCTTGTATTAAACTG
TTTACTCAATCGAACCAAACTGTAATAAGTTGTTCCGATGGTTCTCAGTT
GAATAAAATGTTTCACTGAATTCGATGAAAATCAAACAATTTACCAGAAC
TGTGTAGAGAATCTTGTAAATGCTACAATAATGGGACTCAATTCGGCGTT
CTTTCTATTTGGTGAGCCGGAATACGATAAGTCATTAATTATAAACGGGA
ATAATTCCAATAGAGGAATATTCTACATGGCTGTTTATTACTTATTTAAT
AAATTAAATAAAGACAGAAACATGAAGGCATCATTCAAAGTGCAACTCTC
TGTTATAAATGTTGCAGGAAATGTTATACTTGATTTGTCAAAGCCAGATA
GTTCTTCAACAATTGATTTTGATAAAGTAAAATATTCAGAAACCGAAGGA
CTTATAATTGAGGGATTATCTGAAATTGATCTCGATTCAGCAGAAACTGC
CGTTTCTCTTTTTAGCAATATTTGGAATTCTAAGATTATATCTCCCAAAT
CAACCGGAACAATAATTATACAAATTAAATGCAATGTTAAGATTTATGGA
AAAGAGCAAAATGATATTGTAAGCCAATTTTCAATTGTATATTTTCCTGA
AAACCACCTTTCTGTGAAGTCTTCATCTCAAAATCTAAACGGATTATTAC
AGTTACAAATTCTGCTAGAAAAAATAAATAAAACGGATCATCGCCTAGAT
TACCATGGTTTATTTATTCTGGATACGTTTCTGGAGGATAAAATCGGGGG
AAACTGCGTGACGAATATCCTACTTTGCGCACCAGCCCAATGGCCAACTG
AAACCTTTGGTCCAACGTTTAAAATATTGAATGCATTATCCGAAATACAA
AATTACCCAATTATAAATACAGAGAACGCCAGGCGGCTAATAAATAAATC
CCGTCATCGTGCAATCAAGACCAATCTTGGAAACGATTTCACAGACAGGG
ATAAATCGCGTTTTTTGCTTGGTCCTAAATCCTCTCTTGTCGAAGATATA
AATTCCACAAAAGCGGAAAATATTAGACTTCGAGACAAAGTTGAGGATTT
ACAATCTATTCTTTTAAAAAAAAATATGGAATCCAACGATTTGAAAAGTA
AAGATTTAGAAAATCACTTGTTTATTAAGAGAGAAGAAGAAAAGTTGAGG
TCGTCAAAATTAATAATGGATTTGGAAATAAAAAATCGTCAACTCAAAGA
TCAAATGGAAACTATCCGATTTGATTTACGAAATAAAATTATGCATTTAG
AAGAAAAGCTCACTGCCAGTGAAGTGGAAAAAGAATGTTATAAAATAAAT
TATAAAGACCTTGAAACCGCAAAGGAACAAAGATTAGATGCTCTGGAAAG
ATTTTCAGCTTTACAACAAGCATTTGATAATCTGCTGATTCAAGCCAACT
CAATGAAAGCTCAAAATACAGAACTGAACATAGAATATCTTAACTTGTCG
AATTTGGAGGGAAATTTTAAACGAAAATCACTTCAACCCGTTTCAAATAT
TTCAACAATACAAGAAACTCGAGGTCTGAAAAGTCCAAACCCGCATCACG
AATTGAAAATTTTGTCCCCAATCAGCCCATCTAAAGATAGAAATATAAAA
TTGAGATTAGGTCAATTGCAGGAAGAATTACAAAATTCTCGTTCAATTGC
CCAAGAAAGATTCAAGGAATTATCACAATCATCAATAGAACTGATTGTCG
TGAGAGAGGAAAACAAAAAATTGCAGTCTCAGATAAATTATTTGACGAGA
TACCTAAATCAAATTTCACAAGACTATCAGAAACAGATAAAAAGTTATGC
CTCTATAAAACTTAATTTCATGAACTCTAATGGAAATGGAAATATAAATT
ATAAATCCGAAATATCCTCATTACTTAATCGGTATGATTCGGTTTACGCG
GCCAAAGAGAACCAACTGAAAACCTCTATAAATGATCTTACAACTAGATT
TAACGAGTTGAAATCATGGAGTGATAGAGCTATTCTCGAGTACATACTAA
TCAGAGATCAAGTGAAACACATGGACAACATAAATCTCGGACCCGACCAT
AAAGAGATAATAGCAAGTCACCCTACACCGACTGAAACAGTGAAATTATT
AAAGAAATATTTCAATGACCAAGAATTTCATAAAACAGATTCTTCGAACC
TTATGGAGTTGAGGCAGCAGATTAAAGAGTTTGGAAACACAACGGTTACG
GACTTGGAAATTGAAAGAGCTCAACTGATCTCGCGGAACGTGGAATTGGA
ACAAGAATTATTGGCAGCACAAGAATACATTGATGTTTATCTTAAAAAAA
AGCTCTCTTCGAGAATTCCGAGAAATAAGAATCTCTGAAGAATTCATTGG
TCAATATTGTTGTTAAAAATGAATTTTTATTATAAACACATTTTGTTTAT
CTTGATTTCATATTTTCCAAAATTTTAGCCTTTC
back to top

protein sequence of SMED30023347-orf-1

>SMED30023347-orf-1 ID=SMED30023347-orf-1|Name=SMED30023347-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=736bp
MGLNSAFFLFGEPEYDKSLIINGNNSNRGIFYMAVYYLFNKLNKDRNMKA
SFKVQLSVINVAGNVILDLSKPDSSSTIDFDKVKYSETEGLIIEGLSEID
LDSAETAVSLFSNIWNSKIISPKSTGTIIIQIKCNVKIYGKEQNDIVSQF
SIVYFPENHLSVKSSSQNLNGLLQLQILLEKINKTDHRLDYHGLFILDTF
LEDKIGGNCVTNILLCAPAQWPTETFGPTFKILNALSEIQNYPIINTENA
RRLINKSRHRAIKTNLGNDFTDRDKSRFLLGPKSSLVEDINSTKAENIRL
RDKVEDLQSILLKKNMESNDLKSKDLENHLFIKREEEKLRSSKLIMDLEI
KNRQLKDQMETIRFDLRNKIMHLEEKLTASEVEKECYKINYKDLETAKEQ
RLDALERFSALQQAFDNLLIQANSMKAQNTELNIEYLNLSNLEGNFKRKS
LQPVSNISTIQETRGLKSPNPHHELKILSPISPSKDRNIKLRLGQLQEEL
QNSRSIAQERFKELSQSSIELIVVREENKKLQSQINYLTRYLNQISQDYQ
KQIKSYASIKLNFMNSNGNGNINYKSEISSLLNRYDSVYAAKENQLKTSI
NDLTTRFNELKSWSDRAILEYILIRDQVKHMDNINLGPDHKEIIASHPTP
TETVKLLKKYFNDQEFHKTDSSNLMELRQQIKEFGNTTVTDLEIERAQLI
SRNVELEQELLAAQEYIDVYLKKKLSSRIPRNKNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR039873CCDC78
IPR001752Kinesin_motor_dom
IPR029329DUF4472
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0001172transcription, RNA-templated
GO:0006259DNA metabolic process
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
GO:0000166nucleotide binding
GO:0003774motor activity
GO:0003968RNA-directed 5'-3' RNA polymerase activity
GO:0009035Type I site-specific deoxyribonuclease activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 345..376
NoneNo IPR availableCOILSCoilCoilcoord: 689..709
NoneNo IPR availableCOILSCoilCoilcoord: 394..414
NoneNo IPR availableCOILSCoilCoilcoord: 497..517
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 1..128
e-value: 9.9E-12
score: 46.5
IPR029329Domain of unknown function DUF4472PFAMPF14739DUF4472coord: 335..435
e-value: 5.8E-9
score: 36.6
IPR039873Coiled-coil domain-containing protein 78PANTHERPTHR22106FAMILY NOT NAMEDcoord: 2..722
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..256