N-alpha-acetyltransferase

Overview
NameN-alpha-acetyltransferase
Smed IDSMED30023338
Length (bp)671
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N-alpha-acetyltransferase (SMED30023338) t-SNE clustered cells

Violin plots show distribution of expression levels for N-alpha-acetyltransferase (SMED30023338) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N-alpha-acetyltransferase (SMED30023338) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N-alpha-acetyltransferase (SMED30023338) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023338

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30023338h1SMcG0022602 dd_Smed_v4_2570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30023338h1SMcG0022602 dd_Smed_v4_2570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N-alpha-acetyltransferase vs. Ensembl Human
Match: NAA10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:HGNC Symbol;Acc:HGNC:18704])

HSP 1 Score: 265.774 bits (678), Expect = 8.185e-91
Identity = 122/154 (79.22%), Postives = 136/154 (88.31%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQM 154          
BLAST of N-alpha-acetyltransferase vs. Ensembl Human
Match: NAA10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:HGNC Symbol;Acc:HGNC:18704])

HSP 1 Score: 267.314 bits (682), Expect = 1.493e-90
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMAD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Human
Match: NAA10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:HGNC Symbol;Acc:HGNC:18704])

HSP 1 Score: 264.618 bits (675), Expect = 3.272e-90
Identity = 122/154 (79.22%), Postives = 136/154 (88.31%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQM 154          
BLAST of N-alpha-acetyltransferase vs. Ensembl Human
Match: NAA11 (N(alpha)-acetyltransferase 11, NatA catalytic subunit [Source:HGNC Symbol;Acc:HGNC:28125])

HSP 1 Score: 265.774 bits (678), Expect = 4.537e-90
Identity = 121/156 (77.56%), Postives = 135/156 (86.54%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN +P DL+NMQ CNL CLPENYQMKYY YHGLSWPQLSY+AE  DG+IVGYVL+KMEEE DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNR ALHLY  TL F ISEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEEPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLSQMAD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Human
Match: NAA10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:HGNC Symbol;Acc:HGNC:18704])

HSP 1 Score: 246.899 bits (629), Expect = 9.606e-84
Identity = 116/151 (76.82%), Postives = 128/151 (84.77%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSL 503
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVG      EE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVG------EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDL 145          
BLAST of N-alpha-acetyltransferase vs. Ensembl Celegans
Match: daf-31 (N-alpha-acetyltransferase daf-31 [Source:UniProtKB/Swiss-Prot;Acc:O61219])

HSP 1 Score: 226.483 bits (576), Expect = 1.392e-75
Identity = 105/151 (69.54%), Postives = 124/151 (82.12%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSL 503
            MNIR  R  DL++MQ+ NL CLPENYQMKYYFYH LSWPQLSY+AE   G +VGYVL+KMEE+  + PHGHITSLAVK+S+RRLGLA K+M+Q  RAMVET+ ++YVSLHVR SNRAAL+LY+ TL F I + E KYY DGEDAYAM+R L
Sbjct:    1 MNIRCARVDDLMSMQNANLMCLPENYQMKYYFYHALSWPQLSYIAEDHKGNVVGYVLAKMEEDPGEEPHGHITSLAVKRSYRRLGLANKMMDQTARAMVETYNAKYVSLHVRVSNRAALNLYKNTLKFEIVDTEPKYYADGEDAYAMRRDL 151          
BLAST of N-alpha-acetyltransferase vs. Ensembl Celegans
Match: natb-1 (N-terminal AceTyltransferase B (NatB) complex, catalytic subunit, homolog [Source:UniProtKB/TrEMBL;Acc:Q965S3])

HSP 1 Score: 95.1301 bits (235), Expect = 2.266e-24
Identity = 58/151 (38.41%), Postives = 92/151 (60.93%), Query Frame = 3
Query:   66 CRPGDLLNM---QDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTI-SEVEAKYYGD-GEDAYAMKRSL 503
             RP D+++M    + NL    E Y  ++Y ++ +++P+   VAE P+GEI+ YV+ K+E   D   HGH+T+L+V  + RRLGLA  +M    R   E  ++ +V L VR SN+ A+ LY+K LG+ +  ++   Y GD  EDA+ M++SL
Sbjct:    4 LRPFDVMDMFKFNNVNLDINTETYGFQFYLHYMMNYPEYYQVAEHPNGEIMAYVMGKIEGR-DTNWHGHVTALSVAPNFRRLGLAAYMMEFLERT-SEARRAYFVDLFVRVSNKIAIELYKK-LGYVVYRQIIGYYTGDRDEDAFDMRKSL 151          
BLAST of N-alpha-acetyltransferase vs. Ensembl Celegans
Match: natc-2 (N-alpha-AcetylTransferase C complex subunit [Source:UniProtKB/TrEMBL;Acc:O16486])

HSP 1 Score: 58.5362 bits (140), Expect = 3.740e-10
Identity = 42/128 (32.81%), Postives = 67/128 (52.34%), Query Frame = 3
Query:  114 LPENYQMKYYFYHGLSWPQLSYVA-EAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMK 494
            L E Y +  Y Y   +WP+  ++A +  +   +G VL K+E +      G++  LAV +S RRLG+  +L+ +A  AM ++     + L    SN+ A  LY   LGF   +   KYY +G DA+ +K
Sbjct:  117 LSEPYSIYTYRYFLHNWPEYCFLAYDQTNNTYIGAVLCKLELDMYGRCKGYLAMLAVDESCRRLGIGTRLVRRALDAM-QSKGCDEIVLETEVSNKNAQRLY-SNLGFIRQKRLLKYYLNGGDAFRLK 242          
BLAST of N-alpha-acetyltransferase vs. Ensembl Celegans
Match: natc-2 (N-alpha-AcetylTransferase C complex subunit [Source:UniProtKB/TrEMBL;Acc:O16486])

HSP 1 Score: 58.5362 bits (140), Expect = 3.740e-10
Identity = 42/128 (32.81%), Postives = 67/128 (52.34%), Query Frame = 3
Query:  114 LPENYQMKYYFYHGLSWPQLSYVA-EAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMK 494
            L E Y +  Y Y   +WP+  ++A +  +   +G VL K+E +      G++  LAV +S RRLG+  +L+ +A  AM ++     + L    SN+ A  LY   LGF   +   KYY +G DA+ +K
Sbjct:  117 LSEPYSIYTYRYFLHNWPEYCFLAYDQTNNTYIGAVLCKLELDMYGRCKGYLAMLAVDESCRRLGIGTRLVRRALDAM-QSKGCDEIVLETEVSNKNAQRLY-SNLGFIRQKRLLKYYLNGGDAFRLK 242          
BLAST of N-alpha-acetyltransferase vs. Ensembl Fly
Match: vnc (gene:FBgn0263251 transcript:FBtr0076349)

HSP 1 Score: 226.098 bits (575), Expect = 3.890e-75
Identity = 111/156 (71.15%), Postives = 126/156 (80.77%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEE--SDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIR  +P DL+ MQ CNL CLPENYQMKYYFYHGL+WPQLSYVA    G IVGYVL+KMEE   +++  HGHITSLAVK+S+RRLGLAQKLMNQA +AMVE F ++YVSLHVR+SNRAAL+LY   L F I EVE KYY DGEDAYAM+R L E 
Sbjct:    1 MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKGAIVGYVLAKMEEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYYADGEDAYAMRRDLSEF 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Fly
Match: vnc (gene:FBgn0263251 transcript:FBtr0076348)

HSP 1 Score: 226.098 bits (575), Expect = 3.890e-75
Identity = 111/156 (71.15%), Postives = 126/156 (80.77%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEE--SDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIR  +P DL+ MQ CNL CLPENYQMKYYFYHGL+WPQLSYVA    G IVGYVL+KMEE   +++  HGHITSLAVK+S+RRLGLAQKLMNQA +AMVE F ++YVSLHVR+SNRAAL+LY   L F I EVE KYY DGEDAYAM+R L E 
Sbjct:    1 MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKGAIVGYVLAKMEEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYYADGEDAYAMRRDLSEF 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Fly
Match: vnc (gene:FBgn0263251 transcript:FBtr0076350)

HSP 1 Score: 226.098 bits (575), Expect = 3.890e-75
Identity = 111/156 (71.15%), Postives = 126/156 (80.77%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEE--SDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIR  +P DL+ MQ CNL CLPENYQMKYYFYHGL+WPQLSYVA    G IVGYVL+KMEE   +++  HGHITSLAVK+S+RRLGLAQKLMNQA +AMVE F ++YVSLHVR+SNRAAL+LY   L F I EVE KYY DGEDAYAM+R L E 
Sbjct:    1 MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKGAIVGYVLAKMEEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYYADGEDAYAMRRDLSEF 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Fly
Match: vnc (gene:FBgn0263251 transcript:FBtr0076352)

HSP 1 Score: 226.098 bits (575), Expect = 3.890e-75
Identity = 111/156 (71.15%), Postives = 126/156 (80.77%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEE--SDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIR  +P DL+ MQ CNL CLPENYQMKYYFYHGL+WPQLSYVA    G IVGYVL+KMEE   +++  HGHITSLAVK+S+RRLGLAQKLMNQA +AMVE F ++YVSLHVR+SNRAAL+LY   L F I EVE KYY DGEDAYAM+R L E 
Sbjct:    1 MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKGAIVGYVLAKMEEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYYADGEDAYAMRRDLSEF 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Fly
Match: vnc (gene:FBgn0263251 transcript:FBtr0076351)

HSP 1 Score: 226.098 bits (575), Expect = 3.890e-75
Identity = 111/156 (71.15%), Postives = 126/156 (80.77%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEE--SDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIR  +P DL+ MQ CNL CLPENYQMKYYFYHGL+WPQLSYVA    G IVGYVL+KMEE   +++  HGHITSLAVK+S+RRLGLAQKLMNQA +AMVE F ++YVSLHVR+SNRAAL+LY   L F I EVE KYY DGEDAYAM+R L E 
Sbjct:    1 MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKGAIVGYVLAKMEEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPKYYADGEDAYAMRRDLSEF 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Zebrafish
Match: naa10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-040426-2648])

HSP 1 Score: 268.085 bits (684), Expect = 4.151e-91
Identity = 122/154 (79.22%), Postives = 137/154 (88.96%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR+L +M
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLKFQISEVEPKYYADGEDAYAMKRNLTQM 154          
BLAST of N-alpha-acetyltransferase vs. Ensembl Zebrafish
Match: naa10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-040426-2648])

HSP 1 Score: 224.172 bits (570), Expect = 3.455e-74
Identity = 108/154 (70.13%), Postives = 120/154 (77.92%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL                  AVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR+L +M
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVL------------------AVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLKFQISEVEPKYYADGEDAYAMKRNLTQM 136          
BLAST of N-alpha-acetyltransferase vs. Ensembl Zebrafish
Match: naa10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-040426-2648])

HSP 1 Score: 224.172 bits (570), Expect = 3.455e-74
Identity = 108/154 (70.13%), Postives = 120/154 (77.92%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL                  AVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR+L +M
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVL------------------AVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLKFQISEVEPKYYADGEDAYAMKRNLTQM 136          
BLAST of N-alpha-acetyltransferase vs. Ensembl Zebrafish
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:541516])

HSP 1 Score: 95.5153 bits (236), Expect = 3.385e-24
Identity = 58/152 (38.16%), Postives = 85/152 (55.92%), Query Frame = 3
Query:   78 DLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEE-SDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSR----YVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYG-----DGEDAYAMKRSL 503
            DL    + NL  L E Y + +Y  +   WP+   VAEAP GE++GY++ K E   + +  HGH+T+L+V    RRLGLA KLM      M+E    R    +V L VR SN+ A+++Y K LG+++     +YY        EDAY M+++L
Sbjct:   11 DLFKFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLME-----MLEEISERKGGFFVDLFVRVSNQVAVNMY-KQLGYSVYRTVIEYYSASNGEPDEDAYDMRKAL 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Zebrafish
Match: naa30 (N(alpha)-acetyltransferase 30, NatC catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-081022-73])

HSP 1 Score: 61.2326 bits (147), Expect = 1.011e-10
Identity = 44/127 (34.65%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  114 LPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMK 494
            L E Y +  Y Y   +WPQL ++A   + + VG ++ K++        G+I  LAV    RR G+   L+ +A  AMVE      V L    +N++AL LYE  LGF   +   +YY +G DA  +K
Sbjct:  236 LSEPYSIYTYRYFIHNWPQLCFLAMV-EKDCVGAIVCKLDMHKKMFRRGYIAMLAVDSKFRRKGIGTNLVKKAIYAMVEG-DCDEVVLETEITNKSALKLYE-NLGFVRDKRLFRYYLNGVDALRLK 359          
BLAST of N-alpha-acetyltransferase vs. Ensembl Xenopus
Match: znf37a (zinc finger protein 37A [Source:Xenbase;Acc:XB-GENE-6465694])

HSP 1 Score: 267.314 bits (682), Expect = 1.615e-90
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMAD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Xenopus
Match: znf37a (zinc finger protein 37A [Source:Xenbase;Acc:XB-GENE-6465694])

HSP 1 Score: 266.159 bits (679), Expect = 2.209e-90
Identity = 122/154 (79.22%), Postives = 136/154 (88.31%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQM 154          
BLAST of N-alpha-acetyltransferase vs. Ensembl Xenopus
Match: znf37a (zinc finger protein 37A [Source:Xenbase;Acc:XB-GENE-6465694])

HSP 1 Score: 266.544 bits (680), Expect = 2.218e-90
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMAD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Xenopus
Match: znf37a (zinc finger protein 37A [Source:Xenbase;Acc:XB-GENE-6465694])

HSP 1 Score: 266.159 bits (679), Expect = 2.256e-90
Identity = 122/154 (79.22%), Postives = 136/154 (88.31%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQM 154          
BLAST of N-alpha-acetyltransferase vs. Ensembl Xenopus
Match: znf37a (zinc finger protein 37A [Source:Xenbase;Acc:XB-GENE-6465694])

HSP 1 Score: 254.603 bits (649), Expect = 1.180e-85
Identity = 116/149 (77.85%), Postives = 131/149 (87.92%), Query Frame = 3
Query:   72 PGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            P DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M +
Sbjct:    3 PEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMAD 151          
BLAST of N-alpha-acetyltransferase vs. Ensembl Mouse
Match: Naa11 (N(alpha)-acetyltransferase 11, NatA catalytic subunit [Source:MGI Symbol;Acc:MGI:2141314])

HSP 1 Score: 269.24 bits (687), Expect = 1.148e-91
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  DG+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F +SEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFGAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMTD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Mouse
Match: Naa10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:MGI Symbol;Acc:MGI:1915255])

HSP 1 Score: 268.47 bits (685), Expect = 4.093e-91
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMAD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Mouse
Match: Gm16286 (predicted gene 16286 [Source:MGI Symbol;Acc:MGI:3833940])

HSP 1 Score: 267.7 bits (683), Expect = 4.369e-91
Identity = 121/156 (77.56%), Postives = 136/156 (87.18%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIR  RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  DG+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F +SEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRRARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMAD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Mouse
Match: Gm16286 (predicted gene 16286 [Source:MGI Symbol;Acc:MGI:3833940])

HSP 1 Score: 267.7 bits (683), Expect = 4.369e-91
Identity = 121/156 (77.56%), Postives = 136/156 (87.18%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIR  RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  DG+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F +SEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRRARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMAD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Mouse
Match: Gm16286 (predicted gene 16286 [Source:MGI Symbol;Acc:MGI:3833940])

HSP 1 Score: 267.7 bits (683), Expect = 4.369e-91
Identity = 121/156 (77.56%), Postives = 136/156 (87.18%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIR  RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  DG+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F +SEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRRARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMAD 156          
BLAST of N-alpha-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q3UX61|NAA11_MOUSE (N-alpha-acetyltransferase 11 OS=Mus musculus OX=10090 GN=Naa11 PE=1 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 8.033e-91
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  DG+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F +SEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFGAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMTD 156          
BLAST of N-alpha-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q9QY36|NAA10_MOUSE (N-alpha-acetyltransferase 10 OS=Mus musculus OX=10090 GN=Naa10 PE=1 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 2.863e-90
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMAD 156          
BLAST of N-alpha-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q4V8K3|NAA11_RAT (N-alpha-acetyltransferase 11 OS=Rattus norvegicus OX=10116 GN=Naa11 PE=2 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 4.270e-90
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  DG+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F +SEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLAQMAD 156          
BLAST of N-alpha-acetyltransferase vs. UniProt/SwissProt
Match: sp|P41227|NAA10_HUMAN (N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10 PE=1 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 7.172e-90
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMAD 156          
BLAST of N-alpha-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q2KI14|NAA10_BOVIN (N-alpha-acetyltransferase 10 OS=Bos taurus OX=9913 GN=NAA10 PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 8.450e-90
Identity = 122/156 (78.21%), Postives = 137/156 (87.82%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMAD 156          
BLAST of N-alpha-acetyltransferase vs. TrEMBL
Match: A0A430Q2R7 (N-alpha-acetyltransferase 10/11 OS=Schistosoma bovis OX=6184 GN=DC041_0011321 PE=4 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.240e-95
Identity = 129/174 (74.14%), Postives = 151/174 (86.78%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQ 572
            MN+RN RP DLLNM+DCNL CLPENYQMKYYFYHGLSWPQLSYVAE  +GEIVGYVL+KMEE+ +D+P+GHITSLAVK+ +RRLG+AQ LMN A RAMVE F +RYVSLHVR+SNRAAL LY+KTL F +S++E KYY DGEDAYAMKR L+ +W+ YGP+DVPFKE KS  +Q
Sbjct:    1 MNVRNARPTDLLNMRDCNLDCLPENYQMKYYFYHGLSWPQLSYVAETDNGEIVGYVLAKMEEDPEDVPYGHITSLAVKRPYRRLGIAQTLMNLASRAMVENFHARYVSLHVRKSNRAALTLYKKTLHFVVSDIEPKYYADGEDAYAMKRDLKTLWDKYGPSDVPFKESKSKNTQ 174          
BLAST of N-alpha-acetyltransferase vs. TrEMBL
Match: A0A183QGJ0 (N-acetyltransferase domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.900e-95
Identity = 129/174 (74.14%), Postives = 150/174 (86.21%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQ 572
            MN+RN RP DLLNM+DCNL CLPENYQMKYYFYHGLSWPQLSYVAE  +GEIVGYVL+KMEE+ +D+P+GHITSLAVK+ +RRLG+AQ LMN A RAMVE F +RYVSLHVR+SNRAAL LY+KTL F +S++E KYY DGEDAYAMKR L+ +W+ YGP DVPFKE KS  +Q
Sbjct:    1 MNVRNARPTDLLNMRDCNLDCLPENYQMKYYFYHGLSWPQLSYVAETDNGEIVGYVLAKMEEDPEDVPYGHITSLAVKRPYRRLGIAQTLMNLASRAMVENFHARYVSLHVRKSNRAALTLYKKTLHFVVSDIEPKYYADGEDAYAMKRDLKTLWDKYGPADVPFKESKSKNTQ 174          
BLAST of N-alpha-acetyltransferase vs. TrEMBL
Match: G4VHI6 (Putative n-terminal acetyltransferase complex ard1 subunit OS=Schistosoma mansoni OX=6183 GN=Smp_050590 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.900e-95
Identity = 129/174 (74.14%), Postives = 150/174 (86.21%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQ 572
            MN+RN RP DLLNM+DCNL CLPENYQMKYYFYHGLSWPQLSYVAE  +GEIVGYVL+KMEE+ +D+P+GHITSLAVK+ +RRLG+AQ LMN A RAMVE F +RYVSLHVR+SNRAAL LY+KTL F +S++E KYY DGEDAYAMKR L+ +W+ YGP DVPFKE KS  +Q
Sbjct:    1 MNVRNARPTDLLNMRDCNLDCLPENYQMKYYFYHGLSWPQLSYVAETDNGEIVGYVLAKMEEDPEDVPYGHITSLAVKRPYRRLGIAQTLMNLASRAMVENFHARYVSLHVRKSNRAALTLYKKTLHFVVSDIEPKYYADGEDAYAMKRDLKTLWDKYGPADVPFKESKSKNTQ 174          
BLAST of N-alpha-acetyltransferase vs. TrEMBL
Match: A0A183K783 (N-acetyltransferase domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10860 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 2.215e-95
Identity = 129/174 (74.14%), Postives = 150/174 (86.21%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQ 572
            MN+RN RP DLLNM+DCNL CLPENYQMKYYFYHGLSWPQLSYVAE   GEIVGYVL+KMEE+ +D+P+GHITSLAVK+ +RRLG+AQ LMN A RAMVE F +RYVSLHVR+SNRAAL LY+KTL F +S++E KYY DGEDAYAMKR L+ +W+ YGP+DVPFKE KS  +Q
Sbjct:    1 MNVRNARPTDLLNMRDCNLDCLPENYQMKYYFYHGLSWPQLSYVAETDSGEIVGYVLAKMEEDPEDVPYGHITSLAVKRPYRRLGIAQTLMNLASRAMVENFHARYVSLHVRKSNRAALTLYKKTLHFVVSDIEPKYYADGEDAYAMKRDLKTLWDKYGPSDVPFKESKSKNTQ 174          
BLAST of N-alpha-acetyltransferase vs. TrEMBL
Match: A0A183P8Y3 (N-acetyltransferase domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10819 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 2.215e-95
Identity = 129/174 (74.14%), Postives = 150/174 (86.21%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQ 572
            MN+RN RP DLLNM+DCNL CLPENYQMKYYFYHGLSWPQLSYVAE   GEIVGYVL+KMEE+ +D+P+GHITSLAVK+ +RRLG+AQ LMN A RAMVE F +RYVSLHVR+SNRAAL LY+KTL F +S++E KYY DGEDAYAMKR L+ +W+ YGP+DVPFKE KS  +Q
Sbjct:    1 MNVRNARPTDLLNMRDCNLDCLPENYQMKYYFYHGLSWPQLSYVAETDSGEIVGYVLAKMEEDPEDVPYGHITSLAVKRPYRRLGIAQTLMNLASRAMVENFHARYVSLHVRKSNRAALTLYKKTLHFVVSDIEPKYYADGEDAYAMKRDLKTLWDKYGPSDVPFKESKSKNTQ 174          
BLAST of N-alpha-acetyltransferase vs. Ensembl Cavefish
Match: naa10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:NCBI gene;Acc:103038013])

HSP 1 Score: 268.085 bits (684), Expect = 3.188e-91
Identity = 122/154 (79.22%), Postives = 137/154 (88.96%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEM 512
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR+L +M
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLKFQISEVEPKYYADGEDAYAMKRNLTQM 154          
BLAST of N-alpha-acetyltransferase vs. Ensembl Cavefish
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:103034291])

HSP 1 Score: 96.6709 bits (239), Expect = 1.103e-24
Identity = 60/157 (38.22%), Postives = 87/157 (55.41%), Query Frame = 3
Query:   63 NCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEE-SDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSR----YVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDG-----EDAYAMKRSL 503
            NC   DL    + NL  L E Y + +Y  +   WP+   VAEAP GE++GY++ K E   + +  HGH+T+L+V    RRLGLA KLM      M+E    R    +V L VR SN+ A+++Y K LG+++     +YY        EDAY M+++L
Sbjct:    8 NC--DDLFKFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLME-----MLEEISERKGGFFVDLFVRVSNQVAVNMY-KQLGYSVYRTVIEYYSASNGEPDEDAYDMRKAL 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Cavefish
Match: NAA30 (N(alpha)-acetyltransferase 30, NatC catalytic subunit [Source:NCBI gene;Acc:103045260])

HSP 1 Score: 65.855 bits (159), Expect = 2.099e-12
Identity = 45/127 (35.43%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  114 LPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMK 494
            L E Y +  Y Y   +WPQL ++A   D E VG ++ K++        G+I  LAV   HRR  +   L+ +A  AMV+      V L    +N++AL LYE  LGF   +   +YY +G DA  +K
Sbjct:  210 LSEPYSIYTYRYFIHNWPQLCFLAVV-DKECVGAIVCKLDMHKKMFRRGYIAMLAVDSKHRRKSIGTNLVKKAIYAMVDG-DCDEVVLETEITNKSALKLYE-NLGFVRDKRLFRYYLNGVDALRLK 333          
BLAST of N-alpha-acetyltransferase vs. Ensembl Cavefish
Match: naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:NCBI gene;Acc:103040640])

HSP 1 Score: 47.3654 bits (111), Expect = 1.732e-6
Identity = 41/146 (28.08%), Postives = 71/146 (48.63%), Query Frame = 3
Query:   72 PGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGE--DAYAMKRSL 503
            P ++  ++  N    P +Y  K+Y    L   +L+ +A   D   VG V  +++  S +    +I +L     +RRLG+  K++N       +      + LHV+ SN +A+  Y+K  GF I E +  YY   E  DA+ +++SL
Sbjct:   13 PHNIKQLKRLNQVIFPVSYNDKFY-KDVLEVGELAKLAYFNDIA-VGAVCCRVDH-SQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYQK-FGFEIIETKKNYYKRIEPADAHVLQKSL 154          
BLAST of N-alpha-acetyltransferase vs. Ensembl Sea Lamprey
Match: naa10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-040426-2648])

HSP 1 Score: 265.003 bits (676), Expect = 1.387e-90
Identity = 122/156 (78.21%), Postives = 136/156 (87.18%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSYVAE  +G+IVGYVL+KMEE+ DD PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F +SEVE KYY DGEDAYAMKR L +M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYVAEDENGKIVGYVLAKMEEDPDDAPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLKFQVSEVEPKYYADGEDAYAMKRDLAQMGD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Sea Lamprey
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:541516])

HSP 1 Score: 83.9593 bits (206), Expect = 1.669e-20
Identity = 54/155 (34.84%), Postives = 83/155 (53.55%), Query Frame = 3
Query:   57 IRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEE-SDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDG-----EDAYAMKRSL 503
             RNC    +      NL  L E Y + +Y  +   WP+   +AE+  G+I+GY++ K E   S +  HGH+T+L+V    RRLGLA KLM +    + E     +V L VR SN+ A+ +Y + LG+++     +YY        EDAY M+++L
Sbjct:   13 FRNCMSNII------NLDPLTETYGIPFYLQYLAHWPEYFLLAESASGDIMGYIMGKAEGSVSREEWHGHVTALSVAPDFRRLGLAAKLM-ELLEEISEKKGCFFVDLFVRVSNQVAVSMYRR-LGYSVYRTVLEYYSASNGEADEDAYDMRKAL 159          
BLAST of N-alpha-acetyltransferase vs. Ensembl Yeast
Match: ARD1 (Subunit of protein N-terminal acetyltransferase NatA; NatA comprises Nat1p, Ard1p, Nat5p; acetylates many proteins to influence telomeric silencing, cell cycle, heat-shock resistance, mating, sporulation, early stages of mitophagy; protein abundance increases under DNA replication stress; mutations in human homolog X-linked NAA10 lead to Ogden syndrome (S37P) and intellectual disability (R116W); expression of human NAA10 and NAA15 can complement ard1 nat1 double mutant [Source:SGD;Acc:S000001055])

HSP 1 Score: 163.31 bits (412), Expect = 8.440e-51
Identity = 87/193 (45.08%), Postives = 113/193 (58.55%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAE--------------------------------------APDGEIVGYVLSKMEEESD---DIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLE 506
            +NIR     D++ MQ+ NL  LPENY MKYY YH LSWP+ S+VA                                       AP  ++VGYVL KM ++ D   + P+GHITSL+V +++RR+G+A+ LM QA  A+ E  Q+ YVSLHVR+SNRAALHLY  TL F +  +E  YY DGEDAYAMK+ L+
Sbjct:    3 INIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQDENDKLELTLDGTNDGRTIKLDPTYLAPGEKLVGYVLVKMNDDPDQQNEPPNGHITSLSVMRTYRRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSYYQDGEDAYAMKKVLK 195          
BLAST of N-alpha-acetyltransferase vs. Ensembl Yeast
Match: NAT3 (Catalytic subunit of the NatB N-terminal acetyltransferase; NatB catalyzes acetylation of the amino-terminal methionine residues of all proteins beginning with Met-Asp or Met-Glu and of some proteins beginning with Met-Asn or Met-Met [Source:SGD;Acc:S000006335])

HSP 1 Score: 78.5666 bits (192), Expect = 1.270e-18
Identity = 48/151 (31.79%), Postives = 77/151 (50.99%), Query Frame = 3
Query:   57 IRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSY------VAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETF--QSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAY 485
            I+   P DL    + NL  L EN+ +++YF + + WP L +      V       I GY+++K E ++ +  H HIT++ V    RR+ LA KL N     M +    +  ++ L V+ +N+ A+ LYEK LG+++      YY   ED Y
Sbjct:    4 IQPFEPVDLFKTNNVNLDILTENFPLEFYFEYMIIWPDLFFKSSEMTVDPTFKHNISGYMMAKTEGKTTEW-HTHITAVTVAPRFRRISLASKLCN-TLETMTDVMPHEVNFIDLFVKCNNQLAIKLYEK-LGYSVYRRVVGYYNSAEDGY 151          
BLAST of N-alpha-acetyltransferase vs. Ensembl Yeast
Match: MAK3 (Catalytic subunit of the NatC type N-terminal acetyltransferase (NAT); involved in subcellular targeting of select N-terminally acetylated substrates to the Golgi apparatus (Arl3p and Grh1p) and the inner nuclear membrane (Trm1p); required for replication of dsRNA virus; human NatC ortholog, Naa60, functionally complements the null, requiring either auxiliary subunit Mak10p or co-expression of human ortholog, Naa35; Naa60, the human NatF gene, also complements the null allele [Source:SGD;Acc:S000006255])

HSP 1 Score: 52.373 bits (124), Expect = 3.880e-9
Identity = 43/137 (31.39%), Postives = 68/137 (49.64%), Query Frame = 3
Query:  114 LPENYQMKYYFYHGLSWPQLSYVA-----EAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEE 509
            L E Y +  Y Y    WP+L+Y+A       P+  I G ++ KM+   +    G+I  LAV+ ++R  G+A+KL+  A   M +      + L     N AAL+LYE  +GF   +   +YY +  DA+ +   L E
Sbjct:   27 LSEPYSIYVYRYFLNQWPELTYIAVDNKSGTPNIPI-GCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLVEIAIDKM-QREHCDEIMLETEVENSAALNLYE-GMGFIRMKRMFRYYLNEGDAFKLILPLTE 160          
BLAST of N-alpha-acetyltransferase vs. Ensembl Nematostella
Match: EDO36254 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ87])

HSP 1 Score: 246.899 bits (629), Expect = 2.682e-84
Identity = 117/151 (77.48%), Postives = 129/151 (85.43%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSL 503
            MNIR   P DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSYVAE   G+IVGYVL+KMEEE D+  HGHITSLAV++SHRRLGLAQKLM QA RAMVE F ++YVSLHVR+SNRAALHLY  TL F+ISE+E KYY DGEDAYAM+R L
Sbjct:    1 MNIRCATPQDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYVAEDEKGKIVGYVLAKMEEEPDEAVHGHITSLAVRRSHRRLGLAQKLMEQASRAMVECFNAQYVSLHVRKSNRAALHLYTITLKFSISEIEPKYYADGEDAYAMRRDL 151          
BLAST of N-alpha-acetyltransferase vs. Ensembl Nematostella
Match: EDO49530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGI6])

HSP 1 Score: 103.605 bits (257), Expect = 7.808e-28
Identity = 60/153 (39.22%), Postives = 91/153 (59.48%), Query Frame = 3
Query:   54 NIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKME-EESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYY-GD-GEDAYAMKRSL 503
             IR  +  DLLN  + NL  L E Y + +Y  +   WP+   V E+P G+I+GY++ K E  E+ +  HGH+T+++V    RRLGLA KLM+ +   + E  +  +V L VR SN+ A+ +Y K LG+ +     +YY GD  EDAY M+++L
Sbjct:    3 TIRPFKCEDLLNFNNVNLDPLTETYGLSFYLQYLARWPEYFQVLESPTGQIMGYIMGKAEGSEAQEQWHGHVTAVSVAPEFRRLGLAAKLMS-SLENISEIKEGFFVDLFVRVSNKVAVAMY-KQLGYVVYRTVLEYYSGDPDEDAYDMRKAL 153          
BLAST of N-alpha-acetyltransferase vs. Ensembl Nematostella
Match: EDO48600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ09])

HSP 1 Score: 68.9366 bits (167), Expect = 5.076e-15
Identity = 45/127 (35.43%), Postives = 67/127 (52.76%), Query Frame = 3
Query:  114 LPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMK 494
            L E Y +  Y Y   +WP L ++A   D + VG ++ K++     +  G+I  LAV+K  RR  +   L+ +A RAM+E      V L    +N+AAL LYE  LGF   +   +YY +G DA  +K
Sbjct:   12 LSEPYSIYTYRYFIHNWPNLCFLAMYKD-QCVGAIVCKLDVHKSMVHRGYIAMLAVEKDFRRHKIGTALVKKAIRAMIED-NCDEVVLETEITNKAALRLYE-NLGFVRDKRLFRYYLNGVDALRLK 135          
BLAST of N-alpha-acetyltransferase vs. Ensembl Nematostella
Match: EDO31938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI3])

HSP 1 Score: 49.6766 bits (117), Expect = 9.852e-8
Identity = 37/133 (27.82%), Postives = 69/133 (51.88%), Query Frame = 3
Query:  114 LPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYG--DGEDAYAMKRSLE 506
             P +Y  K+Y    L   +L+ +A   D  +VG V  ++++ ++D    +I +L     +RRLG+   ++    +   +      + LHV+ SN+ A+  Y+K  GF I E + +YY   D  DAY ++++L+
Sbjct:   31 FPVSYNDKFY-KDVLEVGELAKLAFYND-IVVGGVCCRVDQ-TEDARRLYIMTLGCLAPYRRLGIGTIMLEHVLKVCEKDGNIDNIYLHVQISNQGAIDFYQK-FGFEIIETKKQYYKRIDPADAYVLQKTLK 159          
BLAST of N-alpha-acetyltransferase vs. Ensembl Medaka
Match: naa10 (N(alpha)-acetyltransferase 10, NatA catalytic subunit [Source:NCBI gene;Acc:101165304])

HSP 1 Score: 266.929 bits (681), Expect = 5.354e-91
Identity = 122/156 (78.21%), Postives = 136/156 (87.18%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWN 518
            MNIRN RP DL+NMQ CNL CLPENYQMKYYFYHGLSWPQLSY+AE  +G+IVGYVL+KMEE+ DD+PHGHITSLAVK+SHRRLGLAQKLM+QA RAM+E F ++YVSLHVR+SNRAALHLY  TL F ISEVE KYY DGEDAYAMKR L  M +
Sbjct:    1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLKFQISEVEPKYYADGEDAYAMKRDLAHMAD 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Medaka
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:101164367])

HSP 1 Score: 94.7449 bits (234), Expect = 5.684e-24
Identity = 57/152 (37.50%), Postives = 85/152 (55.92%), Query Frame = 3
Query:   78 DLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEE-SDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSR----YVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYG-----DGEDAYAMKRSL 503
            DL    + NL  L E Y + +Y  +   WP+   VAEAP GE++GY++ K E   + +  HGH+T+L+V    RRLGLA KLM      M+E    R    +V L VR SN+ A+++Y + LG+++     +YY        EDAY M+++L
Sbjct:   11 DLFKFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLME-----MLEEISERKGGFFVDLFVRVSNQVAVNMYRR-LGYSVYRTVIEYYSASNGEPDEDAYDMRKAL 156          
BLAST of N-alpha-acetyltransferase vs. Ensembl Medaka
Match: naa30 (N(alpha)-acetyltransferase 30, NatC catalytic subunit [Source:NCBI gene;Acc:101167506])

HSP 1 Score: 62.3882 bits (150), Expect = 4.127e-11
Identity = 45/127 (35.43%), Postives = 65/127 (51.18%), Query Frame = 3
Query:  114 LPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMK 494
            L E Y +  Y Y   +WPQL ++A   + E VG ++ K++        G+I  LAV   HRR  +   L+ +A  AMVE      V L    +N++AL LYE  LGF   +   +YY +G DA  +K
Sbjct:  221 LSEPYSIYTYRYFIHNWPQLCFLAMV-EQECVGAIVCKLDMHKKMFRRGYIAMLAVDSKHRRKSIGTNLVKKAIYAMVEG-DCDEVVLETEITNKSALKLYE-NLGFVRDKRLFRYYLNGVDALRLK 344          
BLAST of N-alpha-acetyltransferase vs. Ensembl Medaka
Match: naa50 (N(alpha)-acetyltransferase 50, NatE catalytic subunit [Source:NCBI gene;Acc:101162486])

HSP 1 Score: 47.3654 bits (111), Expect = 1.624e-6
Identity = 44/148 (29.73%), Postives = 74/148 (50.00%), Query Frame = 3
Query:   72 PGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVE--TFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGE--DAYAMKRSL 503
            P ++  ++  N    P +Y  K+Y    L   +L+ +A   D   VG V  +++  S +    +I +L     +RRLG+  K++N       +  TF + Y  LHV+ SN +A+  Y+K  GF I E +  YY   E  DA+ +++SL
Sbjct:   13 PHNIKQLKRLNQVIFPVSYNDKFY-KDVLEVGELAKLAYFNDIA-VGAVCCRVDH-SQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIY--LHVQISNESAIDFYQK-FGFEIIETKKNYYKRIEPADAHVLQKSL 154          
BLAST of N-alpha-acetyltransferase vs. Planmine SMEST
Match: SMESG000016226.1 (SMESG000016226.1)

HSP 1 Score: 373.244 bits (957), Expect = 1.199e-133
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 3
Query:   51 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQNN 578
            MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQNN
Sbjct:    1 MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQNN 176          
BLAST of N-alpha-acetyltransferase vs. Planmine SMEST
Match: SMESG000016226.1 (SMESG000016226.1)

HSP 1 Score: 345.51 bits (885), Expect = 5.750e-123
Identity = 163/163 (100.00%), Postives = 163/163 (100.00%), Query Frame = 3
Query:   90 MQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQNN 578
            MQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQNN
Sbjct:    1 MQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRSLEEMWNLYGPTDVPFKEVKSGKSQNN 163          
BLAST of N-alpha-acetyltransferase vs. Planmine SMEST
Match: SMESG000026353.1 (SMESG000026353.1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.073e-18
Identity = 56/170 (32.94%), Postives = 86/170 (50.59%), Query Frame = 3
Query:   54 NIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYY-GD--GEDAYAMKRSLEEMWNLYGPTDVPFKEV 554
            ++R  +  DL    + NL  L E + + +Y  + + WP+    AE   G + GY++ K E   D   H H+T+L+V    RR+GLA  LM++     ++     +V L VR SN  A+ +Y   LG+T+     KYY GD   EDA+ M+++L        P DV  K V
Sbjct:    3 SVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGH-DLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKK-DCYFVDLFVRVSNAVAIKMY-NCLGYTVYRRVLKYYSGDEEDEDAFDMRKAL--------PRDVDKKSV 161          
BLAST of N-alpha-acetyltransferase vs. Planmine SMEST
Match: SMESG000063933.1 (SMESG000063933.1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.344e-14
Identity = 47/140 (33.57%), Postives = 73/140 (52.14%), Query Frame = 3
Query:   78 DLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGEIVGYVLSKMEE-ESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMK 494
            DL  + D   + L E Y +  Y Y   +WP++  +A   +G+ VG ++ K E   S D   G+I  LAV+K +RR  +  +L+      M+    S  V L    +N++AL LYEK LGF   +   +YY +G DA+ +K
Sbjct:  125 DLQPVIDLITKDLSEPYSIYTYRYFIYNWPKMCIMAFTTEGKCVGAIVGKTESHSSTDRVRGYIAMLAVQKEYRRRFIGSRLVELVIDTMINDGCSEVV-LETEITNKSALSLYEK-LGFIRDKRLFRYYLNGVDAFRLK 262          
BLAST of N-alpha-acetyltransferase vs. Planmine SMEST
Match: SMESG000065122.1 (SMESG000065122.1)

HSP 1 Score: 46.9802 bits (110), Expect = 3.710e-6
Identity = 38/161 (23.60%), Postives = 77/161 (47.83%), Query Frame = 3
Query:   60 RNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDGE-IVGYVLSKMEEESDDIPHG---------------HITSLAVKKSHRRLGLAQKLMNQACRAMVETFQSRYVS---LHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAY 485
            R+ +  D+ ++++   +C P  Y  ++Y    L+     +   A D E +VG +++K++ ++   P                 +I +L +  S+R+ G+A +L+ +   + V +  SR +    LHV  +N  A++ YEK  GFT +++   YY   E  +
Sbjct:    6 RSIKQSDIDDIKNLCEECFPVRYPERWY--KSLTSSSKYFTLAALDSEKLVGLIVAKIKNQNQCNPEDINILNQGFFHENKLVYILTLGITNSYRKQGIASELLTRLL-SFVNSKLSRSIKAVYLHVLTTNSNAIYFYEKR-GFTYAQMLPDYYSIDEKLF 162          
The following BLAST results are available for this feature:
BLAST of N-alpha-acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAA108.185e-9179.22N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
NAA101.493e-9078.21N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
NAA103.272e-9079.22N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
NAA114.537e-9077.56N(alpha)-acetyltransferase 11, NatA catalytic subu... [more]
NAA109.606e-8476.82N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
daf-311.392e-7569.54N-alpha-acetyltransferase daf-31 [Source:UniProtK... [more]
natb-12.266e-2438.41N-terminal AceTyltransferase B (NatB) complex, cat... [more]
natc-23.740e-1032.81N-alpha-AcetylTransferase C complex subunit [Sour... [more]
natc-23.740e-1032.81N-alpha-AcetylTransferase C complex subunit [Sour... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vnc3.890e-7571.15gene:FBgn0263251 transcript:FBtr0076349[more]
vnc3.890e-7571.15gene:FBgn0263251 transcript:FBtr0076348[more]
vnc3.890e-7571.15gene:FBgn0263251 transcript:FBtr0076350[more]
vnc3.890e-7571.15gene:FBgn0263251 transcript:FBtr0076352[more]
vnc3.890e-7571.15gene:FBgn0263251 transcript:FBtr0076351[more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naa104.151e-9179.22N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
naa103.455e-7470.13N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
naa103.455e-7470.13N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
naa203.385e-2438.16N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
naa301.011e-1034.65N(alpha)-acetyltransferase 30, NatC catalytic subu... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf37a1.615e-9078.21zinc finger protein 37A [Source:Xenbase;Acc:XB-GEN... [more]
znf37a2.209e-9079.22zinc finger protein 37A [Source:Xenbase;Acc:XB-GEN... [more]
znf37a2.218e-9078.21zinc finger protein 37A [Source:Xenbase;Acc:XB-GEN... [more]
znf37a2.256e-9079.22zinc finger protein 37A [Source:Xenbase;Acc:XB-GEN... [more]
znf37a1.180e-8577.85zinc finger protein 37A [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Naa111.148e-9178.21N(alpha)-acetyltransferase 11, NatA catalytic subu... [more]
Naa104.093e-9178.21N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
Gm162864.369e-9177.56predicted gene 16286 [Source:MGI Symbol;Acc:MGI:38... [more]
Gm162864.369e-9177.56predicted gene 16286 [Source:MGI Symbol;Acc:MGI:38... [more]
Gm162864.369e-9177.56predicted gene 16286 [Source:MGI Symbol;Acc:MGI:38... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UX61|NAA11_MOUSE8.033e-9178.21N-alpha-acetyltransferase 11 OS=Mus musculus OX=10... [more]
sp|Q9QY36|NAA10_MOUSE2.863e-9078.21N-alpha-acetyltransferase 10 OS=Mus musculus OX=10... [more]
sp|Q4V8K3|NAA11_RAT4.270e-9078.21N-alpha-acetyltransferase 11 OS=Rattus norvegicus ... [more]
sp|P41227|NAA10_HUMAN7.172e-9078.21N-alpha-acetyltransferase 10 OS=Homo sapiens OX=96... [more]
sp|Q2KI14|NAA10_BOVIN8.450e-9078.21N-alpha-acetyltransferase 10 OS=Bos taurus OX=9913... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430Q2R71.240e-9574.14N-alpha-acetyltransferase 10/11 OS=Schistosoma bov... [more]
A0A183QGJ01.900e-9574.14N-acetyltransferase domain-containing protein OS=S... [more]
G4VHI61.900e-9574.14Putative n-terminal acetyltransferase complex ard1... [more]
A0A183K7832.215e-9574.14N-acetyltransferase domain-containing protein OS=S... [more]
A0A183P8Y32.215e-9574.14N-acetyltransferase domain-containing protein OS=S... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
naa103.188e-9179.22N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
naa201.103e-2438.22N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
NAA302.099e-1235.43N(alpha)-acetyltransferase 30, NatC catalytic subu... [more]
naa501.732e-628.08N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
naa101.387e-9078.21N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
naa201.669e-2034.84N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ARD18.440e-5145.08Subunit of protein N-terminal acetyltransferase Na... [more]
NAT31.270e-1831.79Catalytic subunit of the NatB N-terminal acetyltra... [more]
MAK33.880e-931.39Catalytic subunit of the NatC type N-terminal acet... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO362542.682e-8477.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495307.808e-2839.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486005.076e-1535.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319389.852e-827.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
naa105.354e-9178.21N(alpha)-acetyltransferase 10, NatA catalytic subu... [more]
naa205.684e-2437.50N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
naa304.127e-1135.43N(alpha)-acetyltransferase 30, NatC catalytic subu... [more]
naa501.624e-629.73N(alpha)-acetyltransferase 50, NatE catalytic subu... [more]
back to top
BLAST of N-alpha-acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016226.11.199e-133100.00SMESG000016226.1[more]
SMESG000016226.15.750e-123100.00SMESG000016226.1[more]
SMESG000026353.11.073e-1832.94SMESG000026353.1[more]
SMESG000063933.18.344e-1433.57SMESG000063933.1[more]
SMESG000065122.13.710e-623.60SMESG000065122.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023338 ID=SMED30023338|Name=N-alpha-acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=671bp
GAAAAATAATTGAAACTTGTTTAAATTTACCAATATTTTAATCGCGTGAG
ATGAATATTAGAAATTGCAGACCAGGTGATTTATTAAATATGCAAGATTG
CAATTTGCAATGCTTACCAGAAAATTATCAAATGAAATATTATTTTTATC
ATGGTCTTTCCTGGCCTCAATTGTCTTATGTTGCTGAAGCTCCAGATGGT
GAAATTGTTGGCTATGTTTTATCAAAAATGGAAGAAGAATCAGACGATAT
ACCTCATGGTCATATTACATCCTTGGCTGTAAAGAAATCCCATCGTCGTT
TGGGATTAGCACAGAAGTTAATGAATCAAGCTTGTCGTGCGATGGTGGAA
ACTTTTCAATCGAGATATGTTTCTCTTCATGTCAGAAGAAGCAATCGAGC
CGCTTTGCATTTGTACGAAAAAACACTCGGATTTACTATTAGTGAAGTTG
AAGCAAAGTATTACGGTGACGGAGAAGATGCTTATGCTATGAAACGAAGT
CTTGAAGAAATGTGGAATTTATATGGTCCCACCGATGTTCCGTTCAAAGA
AGTTAAGTCAGGAAAATCCCAAAATAATTAACTTGAAAAATAAATGATTT
GTTTGCTATTTTATTTAATTGATTATTTTTGAATTTCTTGTTTTATAAAT
TTATTTAGTTTATTAAAAAAA
back to top

protein sequence of SMED30023338-orf-1

>SMED30023338-orf-1 ID=SMED30023338-orf-1|Name=SMED30023338-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MNIRNCRPGDLLNMQDCNLQCLPENYQMKYYFYHGLSWPQLSYVAEAPDG
EIVGYVLSKMEEESDDIPHGHITSLAVKKSHRRLGLAQKLMNQACRAMVE
TFQSRYVSLHVRRSNRAALHLYEKTLGFTISEVEAKYYGDGEDAYAMKRS
LEEMWNLYGPTDVPFKEVKSGKSQNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR000182GNAT_dom
IPR016181Acyl_CoA_acyltransferase
Vocabulary: molecular function
TermDefinition
GO:0008080N-acetyltransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 1..158
e-value: 1.9E-57
score: 196.3
NoneNo IPR availablePANTHERPTHR23091N-TERMINAL ACETYLTRANSFERASEcoord: 1..157
NoneNo IPR availablePANTHERPTHR23091:SF282N-ALPHA-ACETYLTRANSFERASE 11coord: 1..157
NoneNo IPR availableCDDcd04301NAT_SFcoord: 42..110
e-value: 3.10734E-10
score: 51.5077
IPR000182GNAT domainPFAMPF00583Acetyltransf_1coord: 41..128
e-value: 1.5E-16
score: 60.7
IPR000182GNAT domainPROSITEPS51186GNATcoord: 1..152
score: 24.614
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 1..152