BED-type domain-containing protein

Overview
NameBED-type domain-containing protein
Smed IDSMED30023332
Length (bp)3113
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BED-type domain-containing protein (SMED30023332) t-SNE clustered cells

Violin plots show distribution of expression levels for BED-type domain-containing protein (SMED30023332) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BED-type domain-containing protein (SMED30023332) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BED-type domain-containing protein (SMED30023332) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A4C1X7C4 (BED-type domain-containing protein OS=Eumeta variegata OX=151549 GN=EVAR_25855_1 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 2.458e-95
Identity = 146/401 (36.41%), Postives = 217/401 (54.11%), Query Frame = 3
Query:  684 VWNYFLVEKKGQVAKCKKFGKEIKCTEGSTSGLHTHLKTIHGL-NLKKKCE------------FTNYVESCVSKQPILLITNYFK-NNKNEQLSEVLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHSVG---GTMWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLYKLPTNLSE---DVDFVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYASITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCIQKAL 1826
            VW +FL  + G  AKCK+    IK T  ST GLH HLK  H + +L KK               +       S      IT++F   N    + E +A+MTA+DGL  ++F+ S D++E  KA+GF  +P+ + +IR MV+ Y   ++   V E+S+LK     FS+TFDEWTS  NRRY+NIN H+        W +GL R +GS+PA  C+  + KKL+ F +++ +DIV +TTDGAS+MVK G  + A  Q C AH + L I DVLYK   ++ +   D D ++    + +      N ++        +       +          D   +++K+R +V+ FK SP+KND  LQKY+K + G++  L  DCKTRW+S+  M++K   +K CI K L
Sbjct:  447 VWEHFLKSEDGLSAKCKRCKTVIKTTARSTKGLHVHLKAKHQIEDLNKKVPENAVSSSSVSTNLSMLSPELPSPSKRTKITHHFPIQNSENSMEERVARMTAKDGLPLSVFVTSEDLRELFKAKGFL-LPRSSTTIRMMVMNYGMTLRMKVVNELSQLKETGHRFSLTFDEWTSSSNRRYLNINAHTYANDRALFWNLGLTRIFGSMPATVCVETLRKKLKKFEIDLDEDIVAITTDGASVMVKTGSLVPAFQQLCYAHGLQLGILDVLYKKNESIRQELIDDDILDNSEAESNDNDGRPNISENSGFTVEVVSFATEGELIP--------DFKDIINKVRKIVRMFKCSPTKNDV-LQKYVKNEFGRKIELDGDCKTRWSSLAVMVEKFNKLKLCIAKTL 837          

HSP 2 Score: 77.0258 bits (188), Expect = 2.458e-95
Identity = 45/97 (46.39%), Postives = 59/97 (60.82%), Query Frame = 3
Query: 2271 TLKKQLQTAIEETLN---TSPALACKKFQSLEQKIEDEITFFEKTETKGIYLQNVYDFLMTIVPTSVESERAFSEAGYICTKIRSSLDDESIDCLFF 2552
            TL+++L+  I    N    SP+ A     SLE  I+ EIT +E   + G YL   Y+ L  I PTSVE+ERAFS AGYI +KIR SL D+++D L F
Sbjct:  999 TLQEELELTISSACNVICPSPSRA----NSLESIIKKEITLYESGGSMGKYLTFTYNSLKGIPPTSVEAERAFSAAGYIASKIRCSLADDTLDMLCF 1091          

HSP 3 Score: 75.0998 bits (183), Expect = 2.458e-95
Identity = 45/101 (44.55%), Postives = 58/101 (57.43%), Query Frame = 1
Query: 1876 LTPVKLTVDALCRKDANLLTADASLTFMLDTLSQQNSAIALELLEALKSRILLRRTELSQILQYLQNGVQ----DVGEVFKCISKFTIIKKIVSLTKHMKI 2166
            L PVKL V+ LCR+DA L+T +A+L FM+  L   NSA+A EL   L+ RIL RRT L+ +L YLQN       +  E F   SK  + K+I      MK 
Sbjct:  865 LKPVKLAVEVLCRQDATLITTEATLKFMIKKLEDNNSALASELALCLRRRILQRRTNLNALLMYLQNPCNYCASNDDETFCFPSKNVLRKQIQEFVMRMKF 965          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A226D4I7 (Putative AC transposase OS=Folsomia candida OX=158441 GN=Fcan01_25450 PE=4 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 4.492e-88
Identity = 160/396 (40.40%), Postives = 246/396 (62.12%), Query Frame = 3
Query:  648 FTEHRKGQDEASVWNYFLVE-KKGQVAKCKKFG--KEIKCTEGSTSGLHTHLKTIHGLNLKKKCEFTNYVESCVSKQPILLITNYFKNNKNEQLSEVLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHSVGGTMWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLYKLPTNLSEDVDFVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYASITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCIQKAL 1826
            F   ++G ++ S+WNYFL E   G+ AKC      K +K   GSTSGL+THL++IH ++L KK    N  E  V  + +  I+++F+  K + L E LA+MTA+DG+ F++F  S D++  LK+ GF ++PK A +I+ +V+ Y + IK +  + +  LK   + FS+TFDEW+SI+NRRY+N+ +H      W +GL+R +GS+PAEKCL +V  KLR  NL++  DIV + TDG+S+M K+G+      Q C AH I L + DVLYK   N + + D  E  N+D+     DD+  D D +++     E+   +      I H  +  ++ K+R +V+ F+ SP KN+  LQ YIK++ GKE +L LDCKTRWNS+++ML++   ++  I+KAL
Sbjct:   23 FQVPQQGLNKDSIWNYFLKEVADGKTAKCMDTSCQKVLKTAGGSTSGLNTHLRSIHHIDLLKKD--LNPSELGVKAKSVKPISDFFEK-KTKSLEETLARMTAKDGIPFSVFSTSTDLRRALKSDGFTDLPKSAHTIKKIVIGYSQKIKSTENEHVLDLKRIGRKFSVTFDEWSSIKNRRYMNVILHGKPQEFWNLGLIRIHGSLPAEKCLEMVANKLRLLNLSLENDIVCIITDGSSVMTKIGRLSPTYQQLCFAHGIQLGVLDVLYK-KINQTPEADESENENLDNLAPCEDDSCCDSDSDSEEIDEDEDEDLV------ISHT-LRPVIDKVRTIVRMFRRSPLKNEI-LQTYIKQEFGKELSLILDCKTRWNSLVAMLERFYTVQASIKKAL 406          

HSP 2 Score: 86.6557 bits (213), Expect = 4.492e-88
Identity = 41/74 (55.41%), Postives = 54/74 (72.97%), Query Frame = 1
Query: 1858 SSIIAALTPVKLTVDALCRKDANLLTADASLTFMLDTLSQQNSAIALELLEALKSRILLRRTELSQILQYLQNG 2079
            S I+ AL P++ T++ALCR+DANLLTAD +L FM+  L  Q S +ALEL  AL++RI  RRTELS + +YL  G
Sbjct:  424 SDIVDALKPIEATIEALCRRDANLLTADTALNFMIQKLDMQQSGLALELGVALRTRIEERRTELSGLFKYLHTG 497          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A0J7KNG8 (Dimer_Tnp_hAT domain-containing protein OS=Lasius niger OX=67767 GN=RF55_8155 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 8.309e-82
Identity = 125/303 (41.25%), Postives = 195/303 (64.36%), Query Frame = 3
Query:  927 VLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHSVGGTMWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLYK-LPTNLSEDVDFVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAS--ITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCIQKAL 1826
            ++++MTA+DG SFN F KS D++   +  G K +P  + +IR++V+++ + +K + + EI KL+ + + FS+TFDEWTS +NRRY+NIN+HS       +GL+R  GS  AE C++LVE+ L+ FN+NI  DIV +T DG ++M+K+G  +    Q+C AH I LAI D+LYK LP   ++D + + +    D+    + +D D D+   + I+    +S  I  N ++        L++K+R VVK F+ SP+KND  LQKYI+E+  K   L LDCKTRWNS+++ML++   ++ CI KAL
Sbjct:    4 MISRMTAKDGFSFNSFCKSSDLRYLFQKSGHK-LPSSSNTIRSIVIQFSESVKANMINEIQKLQMQNQKFSLTFDEWTSRKNRRYLNINLHS-DKQHRNLGLIRIQGSSSAEHCVNLVEEHLKIFNINIKDDIVAITADGPNVMIKVGNLMPCFQQRCFAHGIQLAIIDILYKDLPEEEAQDQEGLRRFQEIDNADQSELSDVDDDDNEGSFIVDCIPSSVKIASNYKD--------LITKVRKVVKIFRRSPTKNDLILQKYIQEEHDKRLELILDCKTRWNSLVNMLERFYIVRLCISKAL 296          

HSP 2 Score: 73.9442 bits (180), Expect = 8.309e-82
Identity = 45/118 (38.14%), Postives = 70/118 (59.32%), Query Frame = 3
Query: 2217 SCKVSSETALDYNMVSIKTLKKQLQTAIEETLNTSPALACKKF-QSLEQKIEDEITFFEKTETKGIYLQNVYDFLMTIVPTSVESERAFSEAGYICTKIRSSLDDESIDCL-FFESIF 2564
            SC  +S+   + +     +LK++L+  +++       +  K   ++LE  ++ E+  FE   TK  YL+  Y++L+TI PTSVE+ERAFS AGYI   +R+SL DESI+ L F  S F
Sbjct:  437 SCSNNSDEDQEQDESRTLSLKEELEMKLQKEYPEVKVIESKVLSKNLENVLKKEMIAFENDGTKDRYLRMAYEYLLTIPPTSVEAERAFSAAGYIRNNLRTSLGDESINSLCFLRSYF 554          

HSP 3 Score: 63.929 bits (154), Expect = 8.309e-82
Identity = 34/90 (37.78%), Postives = 56/90 (62.22%), Query Frame = 1
Query: 1873 ALTPVKLTVDALCRKDANLLTADASLTFMLDTLSQQNSAIALELLEALKSRILLRRTELSQILQYLQNGVQDVGEVFKCISKFTIIKKIV 2142
            +L PVKL V  LCR+DA L+TA+ ++ F+L+ L  Q++ ++ +L  AL+ RI  RR +L+  L YLQN ++   ++      F + KK +
Sbjct:  319 SLQPVKLGVKVLCRRDATLITAETTVRFILEKLDNQSTPLSTKLAAALRRRIKQRRIDLTGTLLYLQNPIKFENDLKNPDDTFLLPKKTI 408          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A4C1SVE1 (AC transposase OS=Eumeta variegata OX=151549 GN=EVAR_3373_1 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.915e-73
Identity = 151/406 (37.19%), Postives = 229/406 (56.40%), Query Frame = 3
Query:  648 FTEHRKGQDEASVWNYFLVEKKGQVAKCKKFGKEIKCTEGSTSGLHTHLKTIHGLNL-----KKKCEFTNYVESCVSKQPILLITNYFKNNK--NEQLSEVLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHSVGGTMWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLYK-------LPTNLS----------EDVDFVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYASITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKL 1793
            F +H+K  D  SVW+YFLV K G  AKCK+    +K   GST GLHTHL T H + +      +  E  N       ++    + +YF   K  ++ L +VLA+M A DG  F++FI S ++++ L A+ + ++PK AV+I+  V+ Y + IK+    E+  LKS  + FS++FDEWTS+ N+RY+ +NVHS     W +GLV  YG++ AE CL ++ ++L  F++++  DI  + TDG ++M+K+G+ + AE Q C+AH INLA+ DVLYK        PT+            ED+D  E   +      +                      +T+++      +I  L+ K+R VV  FK SP KN+  LQKY+K + GKE +L LDCKTRWNS+L+ML++ 
Sbjct:    5 FVKHKKDSDMMSVWSYFLVAKDGNSAKCKRCPSILKTLGGSTKGLHTHLSTKHNIKVISASTSQDTENLNTAPPPAKRK----LDDYFTKTKSDDDNLDDVLARMIALDGFPFSVFITSDNLRKLLLAK-YTDLPKSAVTIQKRVMNYSEKIKKQVTSELKHLKSAGERFSLSFDEWTSMSNKRYMALNVHSYK-KFWNLGLVPIYGNMTAENCLRILNERLSKFDISLETDIAAIVTDGPNVMIKVGRLVCAEQQLCLAHGINLAVCDVLYKKHNYLQDSPTSDDMDDNNDDDHLEDLDCSESGLILMSQNDLAREHI---------------PELTQDE------NIKELIEKVRKVVIYFKRSPLKNETVLQKYVKIEHGKELSLLLDCKTRWNSLLTMLERF 383          
BLAST of BED-type domain-containing protein vs. TrEMBL
Match: A0A2A4J3N7 (BED-type domain-containing protein OS=Heliothis virescens OX=7102 GN=B5V51_8277 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.919e-72
Identity = 158/418 (37.80%), Postives = 239/418 (57.18%), Query Frame = 3
Query:  663 KGQDEASVWNYFLVEKKGQVAKCKKFGKEIKCTEGSTSGLHTHLKTIHGLNLKKKC-------EFTNYVESCVSKQPI----LLITNYFKNNKNEQLSEVLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHS---VGGTMWK-IGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLYKLPTNLSEDVD---------------FVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYASITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCIQKAL 1826
            +  D+ SVW+YFL  +    AKCKK  K +KC  GSTSGL  HLK +H +  +K+        E +N V    S + I      +T+Y++++ N  +  ++A+MT+ +G SF  FI+  D++      G K +P  A +IRN+V++    IK+    EI  L  E   FSI+FDEWTSIRNRRY+++N+HS    GG  +K +GL+R YGS+PA+KC+  +++KL +F +++ KDIV  TTDG S+M K GK + + HQKC+AH + LAIADV YK    L  +                  V Q +  +   S  DND+D DE+           +   +++   + D+ + V K+   VK F+ SP+KND  LQKY+ ++ G+E +L  D  TRW+S+ + L++   +K CI KAL
Sbjct:  739 RASDKTSVWHYFLRARDKVSAKCKKCQKILKCVGGSTSGLQKHLKNVHQITGEKQVSITESHGEVSNMVIPSTSSEDIPKKKTKVTDYYESDTNPSMQLMIARMTSMNGYSFRTFIECEDLRTLFLKSGHK-LPLCADTIRNIVVKEADKIKRLLKAEIQNLLKEHHKFSISFDEWTSIRNRRYLSLNLHSHNFSGGNKFKNLGLIRIYGSLPAKKCVEEIKRKLDEFGVSLEKDIVAETTDGCSMMTKFGKFLSSYHQKCIAHALQLAIADVFYKKSEALIANAAEELEEDDDDDLPLSVLVRQAHQSNTHNSASDNDSDDDEDGAEFSSNAVTTTSEVSEQQFVYHDLIAKVKKV---VKIFRKSPTKNDNILQKYVVDEFGREYSLTCDAITRWSSLANTLERFLKLKNCIVKAL 1152          

HSP 2 Score: 57.7658 bits (138), Expect = 1.919e-72
Identity = 29/64 (45.31%), Postives = 44/64 (68.75%), Query Frame = 1
Query: 1885 VKLTVDALCRKDANLLTADASLTFMLDTLSQQNSAIALELLEALKSRILLRRTELSQILQYLQN 2076
            VK  ++ALCR+DA LLTAD ++ F L+ LS  ++ ++ +++ ALK+R   RR   + IL YLQN
Sbjct: 1179 VKTVLEALCRRDATLLTADVAIKFALNKLSNIDTHLSRKMISALKTRYTQRRLIEASILNYLQN 1242          

HSP 3 Score: 68.9366 bits (167), Expect = 7.999e-8
Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 3
Query: 2352 LEQKIEDEITFFEKTETKGIYLQNVYDFLMTIVPTSVESERAFSEAGYICTKIRSSLDDESIDCLFF 2552
            +E  +  E+  FE    +G +L   +D L+TI PTSVE ER FS AG IC KIRS L D ++D L F
Sbjct: 1331 IETNVRIEMALFENGGDRGRHLSKAFDHLLTIPPTSVEPERIFSSAGLICNKIRSRLGDVTLDALIF 1397          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000036917.1 (SMESG000036917.1)

HSP 1 Score: 181.03 bits (458), Expect = 1.008e-56
Identity = 113/320 (35.31%), Postives = 176/320 (55.00%), Query Frame = 3
Query:  918 LSEVLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHSV------GGTMWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLY--------KLPTNLSED---VDFVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYASITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCIQKAL 1826
            L  VLA++T  DGL F IF  S+D++E L+ARGF+NIP+L  +I ++V+ Y + IK + + E+  ++      SITF++WTS RNRRYININ+H              +G+VR +GS+ +EKC  +V+ KL+DFN+N+ K+IV +T DGAS+++K+G  +      C AH I L + D+LY        ++P N   D    D  +      +       ++  + + D  I       I    + I        V+KIR +VK F+ SP+ ND            ++  L LD KTRWNS+++M+++   +K  IQK+L
Sbjct:  160 LPAVLARLTLVDGLLFRIFCSSYDLRESLRARGFENIPRLPHTIHSIVVGYYEKIKYNLITELKSVQQ--VGVSITFNDWTSKRNRRYININIHYAVEHKITEAKFCSLGMVRIHGSMHSEKCKLIVKTKLQDFNINLEKNIVCMTADGASVILKVGSLVSNYQLLCFAHGIQLVVIDILYTKDKYSNQRVPKNTQNDEIQADTSDSDKHGSEDELELKLNDTGESDVDERIFTGLNLEICNAAKPI--------VTKIREIVKIFRNSPTTNDGQ---------QEDKVLILDTKTRWNSLVNMIKRFDQLKSYIQKSL 460          

HSP 2 Score: 60.4622 bits (145), Expect = 1.008e-56
Identity = 37/86 (43.02%), Postives = 50/86 (58.14%), Query Frame = 1
Query: 1858 SSIIAALTPVKLTVDALCRKDANLLTADASLTFMLDTLSQQNSAIALELLEALKSRILLRRTELSQILQYLQNG----VQDVGEVF 2103
            S++++ L P+K+TV+ALCR+DA LLT+                    ELL+AL +RI  RRTE+S ILQYL  G    + D  EVF
Sbjct:  478 STLLSTLHPIKITVEALCRRDAKLLTSK-------------------ELLKALNTRISQRRTEISGILQYLHRGKDAFIHD-SEVF 543          

HSP 3 Score: 51.2174 bits (121), Expect = 4.410e-6
Identity = 29/58 (50.00%), Postives = 37/58 (63.79%), Query Frame = 3
Query: 2373 EITFFEKTETKGIYLQNVYDFLMTIVPTSVESERAFSEA--GYICTKIRSSLDDESID 2540
            E+  FE++  +G +LQ VY+ L+TI PTSVESERAFS A  G   T I S L   + D
Sbjct:  642 EMKIFEESSHRGPHLQRVYNDLLTIPPTSVESERAFSAAENGNAGTGIPSHLSKTACD 699          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000036917.1 (SMESG000036917.1)

HSP 1 Score: 180.644 bits (457), Expect = 1.133e-56
Identity = 113/320 (35.31%), Postives = 176/320 (55.00%), Query Frame = 3
Query:  918 LSEVLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHSV------GGTMWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLY--------KLPTNLSED---VDFVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYASITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCIQKAL 1826
            L  VLA++T  DGL F IF  S+D++E L+ARGF+NIP+L  +I ++V+ Y + IK + + E+  ++      SITF++WTS RNRRYININ+H              +G+VR +GS+ +EKC  +V+ KL+DFN+N+ K+IV +T DGAS+++K+G  +      C AH I L + D+LY        ++P N   D    D  +      +       ++  + + D  I       I    + I        V+KIR +VK F+ SP+ ND            ++  L LD KTRWNS+++M+++   +K  IQK+L
Sbjct:  160 LPAVLARLTLVDGLLFRIFCSSYDLRESLRARGFENIPRLPHTIHSIVVGYYEKIKYNLITELKSVQQ--VGVSITFNDWTSKRNRRYININIHYAVEHKITEAKFCSLGMVRIHGSMHSEKCKLIVKTKLQDFNINLEKNIVCMTADGASVILKVGSLVSNYQLLCFAHGIQLVVIDILYTKDKYSNQRVPKNTQNDEIQADTSDSDKHGSEDELELKLNDTGESDVDERIFTGLNLEICNAAKPI--------VTKIREIVKIFRNSPTTNDGQ---------QEDKVLILDTKTRWNSLVNMIKRFDQLKSYIQKSL 460          

HSP 2 Score: 60.4622 bits (145), Expect = 1.133e-56
Identity = 37/91 (40.66%), Postives = 52/91 (57.14%), Query Frame = 1
Query: 1858 SSIIAALTPVKLTVDALCRKDANLLTADASLTFMLDTLSQQNSAIALELLEALKSRILLRRTELSQILQYLQNG----VQDVGEVFKCISK 2118
            S++++ L P+K+TV+ALCR+DA LLT+                    ELL+AL +RI  RRTE+S ILQYL  G    + D  EVF   ++
Sbjct:  478 STLLSTLHPIKITVEALCRRDAKLLTSK-------------------ELLKALNTRISQRRTEISGILQYLHRGKDAFIHD-SEVFSVPTR 548          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000036917.1 (SMESG000036917.1)

HSP 1 Score: 180.644 bits (457), Expect = 9.463e-52
Identity = 113/320 (35.31%), Postives = 176/320 (55.00%), Query Frame = 3
Query:  918 LSEVLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHSV------GGTMWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLY--------KLPTNLSED---VDFVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYASITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCIQKAL 1826
            L  VLA++T  DGL F IF  S+D++E L+ARGF+NIP+L  +I ++V+ Y + IK + + E+  ++      SITF++WTS RNRRYININ+H              +G+VR +GS+ +EKC  +V+ KL+DFN+N+ K+IV +T DGAS+++K+G  +      C AH I L + D+LY        ++P N   D    D  +      +       ++  + + D  I       I    + I        V+KIR +VK F+ SP+ ND            ++  L LD KTRWNS+++M+++   +K  IQK+L
Sbjct:  160 LPAVLARLTLVDGLLFRIFCSSYDLRESLRARGFENIPRLPHTIHSIVVGYYEKIKYNLITELKSVQQ--VGVSITFNDWTSKRNRRYININIHYAVEHKITEAKFCSLGMVRIHGSMHSEKCKLIVKTKLQDFNINLEKNIVCMTADGASVILKVGSLVSNYQLLCFAHGIQLVVIDILYTKDKYSNQRVPKNTQNDEIQADTSDSDKHGSEDELELKLNDTGESDVDERIFTGLNLEICNAAKPI--------VTKIREIVKIFRNSPTTNDGQ---------QEDKVLILDTKTRWNSLVNMIKRFDQLKSYIQKSL 460          

HSP 2 Score: 44.2838 bits (103), Expect = 9.463e-52
Identity = 18/31 (58.06%), Postives = 27/31 (87.10%), Query Frame = 1
Query: 1858 SSIIAALTPVKLTVDALCRKDANLLTADASL 1950
            S++++ L P+K+TV+ALCR+DA LLT DA+L
Sbjct:  478 STLLSTLHPIKITVEALCRRDAKLLTCDAAL 508          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000077975.1 (SMESG000077975.1)

HSP 1 Score: 161.384 bits (407), Expect = 2.667e-47
Identity = 118/383 (30.81%), Postives = 201/383 (52.48%), Query Frame = 3
Query:  678 ASVWNYFLVEKKGQVAKCKKFGKEIKCTEGSTSGLHTHLKTIHGLNLKKKCEFTNYVESCVSKQPILLITNYFKNNKNEQLSEVLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHSVGGTMWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLYKLPTNLSEDVDFVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYASITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCIQKAL 1826
            + VW  F  E     AKC      +KC  G+TS L  HL+  H +++KK  E         S      + N+ K    E + E+LAK  A DG S +    S  I+E +  R +  +P+   +I+ +++++    K     + +K+      FSIT DEWTS   +RY+N+ +HS   + +K+GL+    S  A +  SLVE+KL D+ + + ++I+  T DGAS+M K  +  + E+Q C+ H I+LA+ +  Y    N+ +++   E  + D+D    +      +   DN I   EY        ++   +I+ ++   R  V+ F+ SP +ND  LQ+Y++++ GK+  L LDC+TRWNS++ M+++L  ++ CI+ AL
Sbjct:    6 SEVWKIFQKETDN-TAKCTMCNSILKCASGNTSNLANHLRAKHDIDVKKNEEPPEKRAKATSS-----MLNFIKR---ESVEELLAKCAAYDGFSIDAMTHSSAIREFITTRSYV-MPRSESTIKKLIVDFANEKKLQFKDKFTKMAKSGMCFSITTDEWTSCSGKRYLNVTLHSQEDS-YKLGLIAIECSCDAYQIHSLVEQKLMDYGIKL-RNILTSTQDGASVMKKYAQLNKIENQFCINHAIHLAVVETFYN-KNNVIDEISDSENADGDEDENQFNSFAGYHNLNIDNDIDNTEYT------YSLDDANINEILQNFRKTVRFFRKSPVRNDI-LQRYVEDKEGKKLKLILDCRTRWNSIIPMMERLVLLQVCIKHAL 368          

HSP 2 Score: 48.521 bits (114), Expect = 2.667e-47
Identity = 27/76 (35.53%), Postives = 44/76 (57.89%), Query Frame = 1
Query: 1858 SSIIAALTPVKLTVDALCRKDANLLTADASLTFMLDTLSQQNSAIALELLEALKSRILLRRT-ELSQILQYLQNGV 2082
            +++I  L P +L V  L +  + LLTA+  LTF+   + Q N+A+  +   +LK RI  RR  EL  + ++LQ+G 
Sbjct:  386 ANLIEILKPTELAVKELSKHTSTLLTAEGVLTFLFTQMKQNNTALGKKFYNSLKIRISERRNKELITLYKFLQSGT 461          
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Match: SMESG000026901.1 (SMESG000026901.1)

HSP 1 Score: 155.221 bits (391), Expect = 8.877e-45
Identity = 117/383 (30.55%), Postives = 200/383 (52.22%), Query Frame = 3
Query:  678 ASVWNYFLVEKKGQVAKCKKFGKEIKCTEGSTSGLHTHLKTIHGLNLKKKCEFTNYVESCVSKQPILLITNYFKNNKNEQLSEVLAKMTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQSTVQEISKLKSE*KHFSITFDEWTSIRNRRYININVHSVGGTMWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVKLGKTIEAEHQKCMAHWINLAIADVLYKLPTNLSEDVDFVEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYASITKNQRNIRHVDISSLVSKIRNVVKTFKYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCIQKAL 1826
            + VW  F  E     AKC      +KC  G+TS L  HL+  H +++KK  E         S      + N+ K    E + E+LAK  A DG S +    S  I+E +  R +  +P+   +I+ +++++    K     + +K+       SIT DEWTS   +RY+N+ +HS   + +K+GL+   GS  A +  SLVE+KL D+ + + ++I+  T DGAS+M K  +  + E+Q C+ H I+LA+ +  +    N+ +++   E  + D+D    +    D +   DN I   EY        ++    I+ ++   R  V+ F+ SP +ND  LQ+Y++++ GK+  L LD +TRWNS++ M+++L  ++ CI+ AL
Sbjct:    6 SEVWKIFQKETDN-TAKCTMCNSVLKCAGGNTSNLANHLRAKHDIDVKKNEEPPEKRAKATSN-----MLNFIKR---ESVGELLAKCAAYDGFSIHAMTHSSAIREFITTRSYV-MPRSESTIKKLIVDFANEKKIQFKDKFTKMAESGICLSITTDEWTSCSGKRYLNVTLHSQEDS-YKLGLIAIEGSCDAYQIHSLVEQKLMDYGIKL-RNILASTQDGASVMKKYAQLNKIENQFCINHAIHLAVVETFHN-KNNVIDEISDSENADGDEDENQFNSFAGDHNLNIDNDIDNTEYT------YSLDDAKINEILQNFRKTVRFFRKSPVRNDI-LQRYVEDKEGKKLKLILDSRTRWNSLIPMMERLVLLQVCIKHAL 368          

HSP 2 Score: 46.595 bits (109), Expect = 8.877e-45
Identity = 27/76 (35.53%), Postives = 43/76 (56.58%), Query Frame = 1
Query: 1858 SSIIAALTPVKLTVDALCRKDANLLTADASLTFMLDTLSQQNSAIALELLEALKSRILLRRT-ELSQILQYLQNGV 2082
            +++I  L P +L V  L +  + LLTA+  LTF+   + Q N+A+      +LK RI  RR  EL  + ++LQ+G 
Sbjct:  386 ANLIEILKPTELAVKELSKHTSTLLTAEGVLTFLFTQMKQNNTALGKIFYNSLKIRISERRNKELITLYKFLQSGT 461          
The following BLAST results are available for this feature:
BLAST of BED-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4C1X7C42.458e-9536.41BED-type domain-containing protein OS=Eumeta varie... [more]
A0A226D4I74.492e-8840.40Putative AC transposase OS=Folsomia candida OX=158... [more]
A0A0J7KNG88.309e-8241.25Dimer_Tnp_hAT domain-containing protein OS=Lasius ... [more]
A0A4C1SVE11.915e-7337.19AC transposase OS=Eumeta variegata OX=151549 GN=EV... [more]
A0A2A4J3N71.919e-7237.80BED-type domain-containing protein OS=Heliothis vi... [more]
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BED-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036917.11.008e-5635.31SMESG000036917.1[more]
SMESG000036917.11.133e-5635.31SMESG000036917.1[more]
SMESG000036917.19.463e-5235.31SMESG000036917.1[more]
SMESG000077975.12.667e-4730.81SMESG000077975.1[more]
SMESG000026901.18.877e-4530.55SMESG000026901.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023332 ID=SMED30023332|Name=BED-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3113bp
ATGGACCAAAATATTTATTCATATGGCTTCCAATACCGGGATCCCGGGAT
CTCGAATACCGGAATCCCAGACAATTTTCTCACCGGGATTGAAAACTGGT
ATCAGCGTAGAAATACCGGTATTTCGGTATTATAACAGTTGATAAAATGG
GTATTCATGCGCTTTATTTTATATTGGAAAATAATCACAAAAATTTACAA
TAAAATTTTCTTGGAAGAAAACAAAAAATTTTGTCGGATTAAAATCTACA
TCGGGTACATTTATTACACAAACTGAGCCGATTATGTCAACATGGTGTAA
TAGCGCTGCTGGGCATATTAAGCTGATTTTTATGGTTTATCTTTATGTCC
GGGAAGAGTCCTGTTTAGACAAATAAATGATATGTTAAAATAAGAAAATA
TAAAATAGTCGGATTAAGATCCTATAAATTTACAAATTAGCTTTAATATT
TGCAATGAAGGTTGTATTTTATATTTTCTCCTTTTTTTCTAATAATTAAA
AATAACATAACGTATTTAAATACTGATAAATCTATATTTATTATTCGATA
AGTTACTATATATTTACATTATGTATTTTGGATTGTAATATTTTAAATAT
TAATATTGATAAAAATAAATTGTTATCACCCTTAAAAAATGAATACATTT
ACTGAGCATCGAAAGGGACAGGACGAAGCTTCGGTTTGGAATTATTTTTT
AGTTGAAAAAAAAGGACAGGTTGCTAAATGTAAAAAGTTCGGAAAAGAAA
TAAAGTGCACAGAAGGATCCACAAGTGGCCTTCATACTCACTTAAAAACA
ATACATGGACTAAATCTTAAAAAGAAATGTGAATTTACTAATTATGTAGA
ATCATGTGTTTCTAAACAGCCCATATTGTTGATAACAAACTATTTTAAGA
ATAATAAAAACGAACAACTTTCTGAAGTGCTGGCCAAAATGACGGCTCGA
GATGGTTTGTCTTTTAATATTTTTATAAAGTCGCATGACATAAAAGAAGG
TTTAAAGGCAAGAGGATTTAAAAATATACCGAAATTAGCAGTCAGTATTA
GAAATATGGTACTTGAATATATTAAAATTATTAAACAGTCTACAGTGCAA
GAAATTTCTAAATTAAAATCCGAATAGAAACATTTCAGTATCACATTTGA
CGAATGGACGTCTATTCGTAATCGGCGCTATATAAATATCAATGTACATT
CTGTTGGAGGAACGATGTGGAAAATCGGATTAGTGCGCGCTTATGGATCC
GTTCCAGCCGAAAAATGTTTATCCCTCGTAGAAAAAAAATTAAGGGATTT
TAATTTAAATATATCTAAAGATATAGTTGGAGTAACTACTGATGGTGCAT
CAATTATGGTAAAACTAGGAAAAACTATTGAGGCTGAGCATCAAAAATGT
ATGGCTCATTGGATAAATTTAGCGATTGCTGATGTTTTGTATAAGTTACC
CACGAACTTGAGTGAGGATGTTGATTTTGTGGAGCAAATTAATGTTGATG
ATGATATTATTAGCGTTGATGACAATGACAACGATATCGACGAAGAAAAT
GATAATGGAATCATTATAGAGGAATATGCTAGTATTACTAAAAATCAACG
TAATATTAGACATGTTGACATATCATCTCTAGTCTCAAAAATTCGGAATG
TCGTAAAAACATTCAAATATTCACCTTCTAAAAACGATAAACATTTACAA
AAGTATATAAAAGAACAACTAGGCAAAGAATCTGCTCTAAAATTAGATTG
TAAAACAAGATGGAACAGCATGTTATCTATGTTACAAAAATTGAAAGATA
TTAAATTTTGTATTCAAAAAGCTCTTATTGACATTAGTTCTGATATTTAA
TTTATTGTCTTCAATTATTGCGGCTCTTACTCCCGTAAAATTAACAGTAG
ACGCACTATGCCGGAAAGATGCAAATCTTTTGACGGCTGACGCTTCTTTA
ACATTTATGCTAGACACTCTTTCGCAGCAAAATTCTGCAATTGCATTAGA
ATTATTAGAAGCATTGAAATCTCGAATTTTACTACGACGAACGGAGTTAT
CACAAATACTTCAGTATCTGCAAAATGGAGTACAAGACGTAGGAGAAGTA
TTTAAATGCATATCTAAATTTACAATCATAAAAAAAATTGTGAGCTTAAC
AAAACACATGAAAATCCTGAAGATACAGAAGATATGGAAGTTGTGCAAGA
AACATCCCTTCCAATTTCTTGTAAAGTAAGTAGTGAAACGGCATTAGATT
ATAATATGGTAAGCATAAAAACTTTGAAAAAACAACTACAGACAGCAATA
GAAGAAACATTAAATACTTCGCCTGCGCTTGCTTGTAAAAAATTTCAGAG
TTTAGAGCAAAAAATTGAAGATGAAATTACATTTTTTGAAAAGACGGAAA
CCAAAGGAATATATTTACAAAATGTGTATGATTTTTTAATGACAATAGTG
CCGACTAGTGTAGAATCAGAAAGAGCATTTTCAGAGGCTGGTTATATTTG
CACGAAAATTCGATCCTCGCTTGATGATGAATCTATTGATTGTTTGTTTT
TTGAGAGCATATTTTAATAAAAAAAATGCAAGTTATCAATAAAATATTTC
ATAACTGCTTTCAATTAATGTTTTTTTTTGCTTCTTTTATTAAATAATGC
CTTGCGGGCCCATTACATGCTTATTTAACATAGATTTAATATATAATTAA
TAAACTTTCTTCGTCTTTTGTACCCGTTTATTCCTACCATCTATGTAAAA
AAATAAAGAATATATACTCATTTTAGAATAATATTTATTAGATTTCATGA
ATATTTGTTAATAAGTCGTTATAATGTCTGATTTAAACAGTAATATGACT
TCAAATTTTTCATTTATAATACCGGTTTTAATACCGGTATCCCGATATTA
CAAAATTTCTAATATCGAATATCGGTATTCAGAATTTACTCCGGTATTGT
AAGCCATAGTCATGTACATTTGAATGACTGACTGCCCGTCATTTCCGCTC
TTAAGTTCTTGATCACAATTGACTTAGCGAATTAATTGATATTAGTACAC
TCAATTTTGTGATGCAGGATGGAAATAAATGCAAAATAGTTTTGTTCAAA
ATTTAAAAATATT
back to top

protein sequence of SMED30023332-orf-1

>SMED30023332-orf-1 ID=SMED30023332-orf-1|Name=SMED30023332-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=163bp
MNTFTEHRKGQDEASVWNYFLVEKKGQVAKCKKFGKEIKCTEGSTSGLHT
HLKTIHGLNLKKKCEFTNYVESCVSKQPILLITNYFKNNKNEQLSEVLAK
MTARDGLSFNIFIKSHDIKEGLKARGFKNIPKLAVSIRNMVLEYIKIIKQ
STVQEISKLKSE*
back to top

protein sequence of SMED30023332-orf-2

>SMED30023332-orf-2 ID=SMED30023332-orf-2|Name=SMED30023332-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=128bp
MEVVQETSLPISCKVSSETALDYNMVSIKTLKKQLQTAIEETLNTSPALA
CKKFQSLEQKIEDEITFFEKTETKGIYLQNVYDFLMTIVPTSVESERAFS
EAGYICTKIRSSLDDESIDCLFFESIF*
back to top

protein sequence of SMED30023332-orf-3

>SMED30023332-orf-3 ID=SMED30023332-orf-3|Name=SMED30023332-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=212bp
MWKIGLVRAYGSVPAEKCLSLVEKKLRDFNLNISKDIVGVTTDGASIMVK
LGKTIEAEHQKCMAHWINLAIADVLYKLPTNLSEDVDFVEQINVDDDIIS
VDDNDNDIDEENDNGIIIEEYASITKNQRNIRHVDISSLVSKIRNVVKTF
KYSPSKNDKHLQKYIKEQLGKESALKLDCKTRWNSMLSMLQKLKDIKFCI
QKALIDISSDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR007021DUF659
IPR012337RNaseH-like_sf
IPR003656Znf_BED
IPR008906HATC_C_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0046983protein dimerization activity