Potassium voltage-gated channel protein

Overview
NamePotassium voltage-gated channel protein
Smed IDSMED30023329
Length (bp)1715
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage-gated channel protein (SMED30023329) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage-gated channel protein (SMED30023329) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel protein (SMED30023329) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel protein (SMED30023329) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNB1 (potassium voltage-gated channel subfamily B member 1 [Source:HGNC Symbol;Acc:HGNC:6231])

HSP 1 Score: 370.933 bits (951), Expect = 6.298e-118
Identity = 195/435 (44.83%), Postives = 286/435 (65.75%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +R+NVGG    + W  + R   +RL +L    T + +L +CD+Y     E FFDRHP +F +I N  + GR +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE ++    + R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP    +++  QS    N  L +              +E +CIAWFT+EY+LR +S  +   F K  LN ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETL-REREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQS--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 449          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNB1 (potassium voltage-gated channel subfamily B member 1 [Source:HGNC Symbol;Acc:HGNC:6231])

HSP 1 Score: 370.933 bits (951), Expect = 6.298e-118
Identity = 195/435 (44.83%), Postives = 286/435 (65.75%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +R+NVGG    + W  + R   +RL +L    T + +L +CD+Y     E FFDRHP +F +I N  + GR +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE ++    + R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP    +++  QS    N  L +              +E +CIAWFT+EY+LR +S  +   F K  LN ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETL-REREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQS--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 449          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNB2 (potassium voltage-gated channel subfamily B member 2 [Source:HGNC Symbol;Acc:HGNC:6232])

HSP 1 Score: 369.007 bits (946), Expect = 8.930e-117
Identity = 195/435 (44.83%), Postives = 288/435 (66.21%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            ++INVGG    + W  + R   +RL +L    T E +L +CD+Y+    E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE  +    M   +  +  +     K R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP   + ++  Q  +  N+ L +              +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   37 VKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPDK-RKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQETDEFGQ--LNDNRQLAH--------------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 453          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNF1 (potassium voltage-gated channel modifier subfamily F member 1 [Source:HGNC Symbol;Acc:HGNC:6246])

HSP 1 Score: 278.87 bits (712), Expect = 1.088e-86
Identity = 151/424 (35.61%), Postives = 249/424 (58.73%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQL--CRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEM 1413
            I +NVGG   +L    + ++  +RL +L  C A   + I  LCD+YD    E +FDR P +F+ +  +   G  +     C      E+ +W + + +L  CC+ +   ++E ++E   +V+ I+  L +    ++ ++ +C+  +W  +E PE+S  +R++AV S   I++S++ + + T+P    ++ +                  + ++   E +E  CI WFTLEY+LRL S    LHF   F+NI+D +AI PF+++L +T +  R  + L ++ + VQ  RI+R+ R+ KLARHS GLQ+L Y L++S+KELGLL+ ++A+G+ +FS+L Y  E+    T F SIP +FWWAII+MTTVGYGDIYPKT +G+  A+I  + GV+ IALPI  I++NF  +Y  +  +E   K + E+
Sbjct:   25 IVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGV--DAAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQVLDAEGN----------------RVEHPTLENVETACIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMME-LTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLETAAKHELEL 429          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Match: KCNG4 (potassium voltage-gated channel modifier subfamily G member 4 [Source:HGNC Symbol;Acc:HGNC:19697])

HSP 1 Score: 272.707 bits (696), Expect = 5.784e-84
Identity = 158/445 (35.51%), Postives = 251/445 (56.40%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCC------------RYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDK------LESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHT-KFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAK 1425
            I INVGG+ +LL WS + RF  SRL +L    + EEI++LCD+YD  + E FFDR P +F  I + L  G+     E CA    EEL YWGI   +L  CC                  R++++ ++ E  R          +   +++G C ++L  ++E+P++ +  ++ A  SI F+  + + L VST+P      ++DQ E  +     +             I+E IC+AWF+LE+ LR +       F +  LNIID +AI+P++++L V++      ++      LE +  V++V R LR+L V++LARHS+GLQ+LG T+++  +E GLL+ F+A+ +TLFS L+Y AEK+     +F+SIP ++WWAIISMTTVGYGD+ P++  GQ  A    ++G+L++A P   I   FS  Y +       LK+++E  +A+
Sbjct:   61 ILINVGGRRYLLPWSTLDRFPLSRLSKLRLCRSYEEIVQLCDDYDEDSQEFFFDRSPSAFGVIVSFLAAGKLVLLQEMCALSFQEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRR---------PASHSSRWGLCMNRLREMVENPQSGLPGKVFACLSILFVATTAVSLCVSTMPDLRA--EEDQGECSRKCYYIF-------------IVETICVAWFSLEFCLRFVQAQDKCQFFQGPLNIIDILAISPYYVSLAVSEEPPEDGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGLTVRRCTREFGLLLLFLAVAITLFSPLVYVAEKESGRVLEFTSIPASYWWAIISMTTVGYGDMVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLE-------LKKEQEQLQAR 474          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: exp-2 (pep chromosome:WBcel235:V:6141569:6143548:1 gene:WBGene00001374.1 transcript:F12F3.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:exp-2)

HSP 1 Score: 236.498 bits (602), Expect = 3.178e-71
Identity = 148/417 (35.49%), Postives = 230/417 (55.16%), Query Frame = 1
Query:  130 NNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRL--CDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPG---SHKVNKQDQSEIIKNKNLTYSSHEE--KSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVT--KVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNF 1353
            N    F+++N+GG  F++   A+ R   +    L R V L    RL   D Y +     +F R P SFE ++     G  +  +E C +  L EL +W IS  ++  CC  +   +K   ++E EKV +  +         K   GK R ++W  +E P +S+ ++   ++S  F+ IS + L   T+P    +H +   +++ ++ N  +T     E  + ++  +   E ICIA+FT+EY LR  +  R L F  + LN++D +AI PF+L L++T   V +R    L     VV++ R+LRV+R++KL R S GLQ+ G TLQ+S K+L ++   +  GV  FS+++YF EKD   T F+SIP  +WW I++MTTVGYGD  P T +G+  AS   + GVLV+ALPI IIV NF
Sbjct:   32 NGSPQFLKLNIGGTSFMILIDAILRADTTTF--LSRFVQLTHTARLKVADAYISADDAYYFQRSPTSFEAVFQYYATGVVHRPSEICPASFLSELDFWRISHQHVGSCCA-DIIPQKREEEKEEEKVDDTTF--------DKLMCGKLRRRMWTFLERPGSSMQAKAFELSSTLFVAISVMGLSFGTIPDFQVTHLMPPHNETVVLPNGTVTVVQKVEQMRVEHPAFVFTERICIAFFTVEYCLRFFAAPRKLRFALKPLNLVDLLAIVPFYLELLLTLCGVDDRKLRDLRWAFLVVRILRVLRVIRIIKLGRFSSGLQTFGMTLQRSQKQLQMMTIVLLTGVVFFSTMIYFLEKDEEGTPFTSIPAAYWWCIVTMTTVGYGDAVPATTMGKIIASAAIMCGVLVLALPITIIVDNF 437          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: exp-2 (pep chromosome:WBcel235:V:6141471:6143548:1 gene:WBGene00001374.1 transcript:F12F3.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:exp-2)

HSP 1 Score: 236.498 bits (602), Expect = 5.062e-71
Identity = 148/417 (35.49%), Postives = 230/417 (55.16%), Query Frame = 1
Query:  130 NNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRL--CDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPG---SHKVNKQDQSEIIKNKNLTYSSHEE--KSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVT--KVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNF 1353
            N    F+++N+GG  F++   A+ R   +    L R V L    RL   D Y +     +F R P SFE ++     G  +  +E C +  L EL +W IS  ++  CC  +   +K   ++E EKV +  +         K   GK R ++W  +E P +S+ ++   ++S  F+ IS + L   T+P    +H +   +++ ++ N  +T     E  + ++  +   E ICIA+FT+EY LR  +  R L F  + LN++D +AI PF+L L++T   V +R    L     VV++ R+LRV+R++KL R S GLQ+ G TLQ+S K+L ++   +  GV  FS+++YF EKD   T F+SIP  +WW I++MTTVGYGD  P T +G+  AS   + GVLV+ALPI IIV NF
Sbjct:   53 NGSPQFLKLNIGGTSFMILIDAILRADTTTF--LSRFVQLTHTARLKVADAYISADDAYYFQRSPTSFEAVFQYYATGVVHRPSEICPASFLSELDFWRISHQHVGSCCA-DIIPQKREEEKEEEKVDDTTF--------DKLMCGKLRRRMWTFLERPGSSMQAKAFELSSTLFVAISVMGLSFGTIPDFQVTHLMPPHNETVVLPNGTVTVVQKVEQMRVEHPAFVFTERICIAFFTVEYCLRFFAAPRKLRFALKPLNLVDLLAIVPFYLELLLTLCGVDDRKLRDLRWAFLVVRILRVLRVIRIIKLGRFSSGLQTFGMTLQRSQKQLQMMTIVLLTGVVFFSTMIYFLEKDEEGTPFTSIPAAYWWCIVTMTTVGYGDAVPATTMGKIIASAAIMCGVLVLALPITIIVDNF 458          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: exp-2 (pep chromosome:WBcel235:V:6139836:6143548:1 gene:WBGene00001374.1 transcript:F12F3.1d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:exp-2)

HSP 1 Score: 236.498 bits (602), Expect = 6.104e-71
Identity = 148/417 (35.49%), Postives = 230/417 (55.16%), Query Frame = 1
Query:  130 NNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRL--CDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPG---SHKVNKQDQSEIIKNKNLTYSSHEE--KSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVT--KVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNF 1353
            N    F+++N+GG  F++   A+ R   +    L R V L    RL   D Y +     +F R P SFE ++     G  +  +E C +  L EL +W IS  ++  CC  +   +K   ++E EKV +  +         K   GK R ++W  +E P +S+ ++   ++S  F+ IS + L   T+P    +H +   +++ ++ N  +T     E  + ++  +   E ICIA+FT+EY LR  +  R L F  + LN++D +AI PF+L L++T   V +R    L     VV++ R+LRV+R++KL R S GLQ+ G TLQ+S K+L ++   +  GV  FS+++YF EKD   T F+SIP  +WW I++MTTVGYGD  P T +G+  AS   + GVLV+ALPI IIV NF
Sbjct:   64 NGSPQFLKLNIGGTSFMILIDAILRADTTTF--LSRFVQLTHTARLKVADAYISADDAYYFQRSPTSFEAVFQYYATGVVHRPSEICPASFLSELDFWRISHQHVGSCC-ADIIPQKREEEKEEEKVDDTTF--------DKLMCGKLRRRMWTFLERPGSSMQAKAFELSSTLFVAISVMGLSFGTIPDFQVTHLMPPHNETVVLPNGTVTVVQKVEQMRVEHPAFVFTERICIAFFTVEYCLRFFAAPRKLRFALKPLNLVDLLAIVPFYLELLLTLCGVDDRKLRDLRWAFLVVRILRVLRVIRIIKLGRFSSGLQTFGMTLQRSQKQLQMMTIVLLTGVVFFSTMIYFLEKDEEGTPFTSIPAAYWWCIVTMTTVGYGDAVPATTMGKIIASAAIMCGVLVLALPITIIVDNF 469          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: exp-2 (pep chromosome:WBcel235:V:6140958:6143548:1 gene:WBGene00001374.1 transcript:F12F3.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:exp-2)

HSP 1 Score: 236.498 bits (602), Expect = 1.008e-70
Identity = 148/417 (35.49%), Postives = 230/417 (55.16%), Query Frame = 1
Query:  130 NNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRL--CDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPG---SHKVNKQDQSEIIKNKNLTYSSHEE--KSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVT--KVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNF 1353
            N    F+++N+GG  F++   A+ R   +    L R V L    RL   D Y +     +F R P SFE ++     G  +  +E C +  L EL +W IS  ++  CC  +   +K   ++E EKV +  +         K   GK R ++W  +E P +S+ ++   ++S  F+ IS + L   T+P    +H +   +++ ++ N  +T     E  + ++  +   E ICIA+FT+EY LR  +  R L F  + LN++D +AI PF+L L++T   V +R    L     VV++ R+LRV+R++KL R S GLQ+ G TLQ+S K+L ++   +  GV  FS+++YF EKD   T F+SIP  +WW I++MTTVGYGD  P T +G+  AS   + GVLV+ALPI IIV NF
Sbjct:   73 NGSPQFLKLNIGGTSFMILIDAILRADTTTF--LSRFVQLTHTARLKVADAYISADDAYYFQRSPTSFEAVFQYYATGVVHRPSEICPASFLSELDFWRISHQHVGSCCA-DIIPQKREEEKEEEKVDDTTF--------DKLMCGKLRRRMWTFLERPGSSMQAKAFELSSTLFVAISVMGLSFGTIPDFQVTHLMPPHNETVVLPNGTVTVVQKVEQMRVEHPAFVFTERICIAFFTVEYCLRFFAAPRKLRFALKPLNLVDLLAIVPFYLELLLTLCGVDDRKLRDLRWAFLVVRILRVLRVIRIIKLGRFSSGLQTFGMTLQRSQKQLQMMTIVLLTGVVFFSTMIYFLEKDEEGTPFTSIPAAYWWCIVTMTTVGYGDAVPATTMGKIIASAAIMCGVLVLALPITIIVDNF 478          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Match: kvs-4 (Probable voltage-gated potassium channel subunit kvs-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9XXD1])

HSP 1 Score: 229.95 bits (585), Expect = 1.885e-68
Identity = 153/437 (35.01%), Postives = 229/437 (52.40%), Query Frame = 1
Query:  145 FIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGI-SINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFF--LTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVL 1446
            F+++NVGG+ F+L+   ++R    RL  L      +      D + + T E +F+R P  F  ++    NG  +  +  C   ++EEL+YW I    YL+ CC        +   EE +K  N+   L+         FG+ R  +WNI+E P +S  ++  AV S+ F++IS   LV+ +LP      KQ         NLT     E     I   IEY+CI WFT+EY L+++  A      ++ LNIID +AI PF   + L++  +       L+    V+++ R+LRV+RVLKL R+S GLQ  G TL+ S+++LG++   +  GV  FS+L+YF EKD   +KF SIP   WW I++MTTVGYGD+ P T  G+  A+     GVLV+ALPI IIV NF +  + +        R  +  KA      +L
Sbjct:   84 FVKLNVGGQRFMLRKDTIRRRGVGRLLDLINKPVADSN---ADAFFSSTSEFYFERPPSLFHIVYQFYLNGVIHQPSNLCPVDIIEELEYWRIIPDQYLASCCCAQQIDDDDEEVEEQDK-PNLFKTLR---------FGEIRRCVWNIIEEPASSGKAQAFAVCSVVFVLISISGLVLGSLPELQVATKQ-------RNNLTGEEFTEMEPMPILGYIEYVCIVWFTMEYGLKMLVSAERSKTFRQLLNIIDLLAILPFIIEMLLLIFGISTEQLRDLKGAFLVIRILRVLRVIRVLKLGRYSSGLQMFGKTLKASFRQLGMMAMVVMTGVIFFSTLVYFLEKDEPASKFHSIPAACWWCIVTMTTVGYGDLTPVTVPGKLVATGAIACGVLVLALPITIIVDNFMKVAETERPAGGNRYRTSQYPKATKSEQMIL 500          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shab (gene:FBgn0262593 transcript:FBtr0305207)

HSP 1 Score: 379.793 bits (974), Expect = 2.522e-122
Identity = 200/432 (46.30%), Postives = 279/432 (64.58%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV 1443
            + INVGG    + W  ++R  ++RL +L    T E I+ LCD+Y     E FFDRHPKSF +I N  + G+ +   E C     ++L+YWG+   YL  CC++ + +RKE + EE  K    + R +  +   + K  + +  LW ++E P TS  +R++AV SI FI++ST+ L ++TLP                  L +  +     N    ++E +CI WFTLEY+LR  +      F K  LNIID +AI P+F++L + +  +   D+ + + RVVQVFRI+R+LR+LKLARHS GLQSLG+TL+ SYKELGLL+ F+A+GV +FSSL YFAEKD   TKF SIP TFWWA I+MTTVGYGDIYP TA+G+   ++CC+ GVLVIALPIPIIV+NF+EFYK+++R EK LKR+E +++AK  GS V
Sbjct:  309 VSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESL-RQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLP-----------------QLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV 722          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shab (gene:FBgn0262593 transcript:FBtr0305208)

HSP 1 Score: 379.407 bits (973), Expect = 1.850e-120
Identity = 200/432 (46.30%), Postives = 279/432 (64.58%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV 1443
            + INVGG    + W  ++R  ++RL +L    T E I+ LCD+Y     E FFDRHPKSF +I N  + G+ +   E C     ++L+YWG+   YL  CC++ + +RKE + EE  K    + R +  +   + K  + +  LW ++E P TS  +R++AV SI FI++ST+ L ++TLP                  L +  +     N    ++E +CI WFTLEY+LR  +      F K  LNIID +AI P+F++L + +  +   D+ + + RVVQVFRI+R+LR+LKLARHS GLQSLG+TL+ SYKELGLL+ F+A+GV +FSSL YFAEKD   TKF SIP TFWWA I+MTTVGYGDIYP TA+G+   ++CC+ GVLVIALPIPIIV+NF+EFYK+++R EK LKR+E +++AK  GS V
Sbjct:  309 VSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESL-RQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLP-----------------QLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV 722          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shab (gene:FBgn0262593 transcript:FBtr0305201)

HSP 1 Score: 379.407 bits (973), Expect = 2.162e-120
Identity = 200/432 (46.30%), Postives = 279/432 (64.58%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV 1443
            + INVGG    + W  ++R  ++RL +L    T E I+ LCD+Y     E FFDRHPKSF +I N  + G+ +   E C     ++L+YWG+   YL  CC++ + +RKE + EE  K    + R +  +   + K  + +  LW ++E P TS  +R++AV SI FI++ST+ L ++TLP                  L +  +     N    ++E +CI WFTLEY+LR  +      F K  LNIID +AI P+F++L + +  +   D+ + + RVVQVFRI+R+LR+LKLARHS GLQSLG+TL+ SYKELGLL+ F+A+GV +FSSL YFAEKD   TKF SIP TFWWA I+MTTVGYGDIYP TA+G+   ++CC+ GVLVIALPIPIIV+NF+EFYK+++R EK LKR+E +++AK  GS V
Sbjct:  309 VSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESL-RQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLP-----------------QLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV 722          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shab (gene:FBgn0262593 transcript:FBtr0305203)

HSP 1 Score: 379.793 bits (974), Expect = 3.177e-120
Identity = 200/432 (46.30%), Postives = 279/432 (64.58%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV 1443
            + INVGG    + W  ++R  ++RL +L    T E I+ LCD+Y     E FFDRHPKSF +I N  + G+ +   E C     ++L+YWG+   YL  CC++ + +RKE + EE  K    + R +  +   + K  + +  LW ++E P TS  +R++AV SI FI++ST+ L ++TLP                  L +  +     N    ++E +CI WFTLEY+LR  +      F K  LNIID +AI P+F++L + +  +   D+ + + RVVQVFRI+R+LR+LKLARHS GLQSLG+TL+ SYKELGLL+ F+A+GV +FSSL YFAEKD   TKF SIP TFWWA I+MTTVGYGDIYP TA+G+   ++CC+ GVLVIALPIPIIV+NF+EFYK+++R EK LKR+E +++AK  GS V
Sbjct:  309 VSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESL-RQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLP-----------------QLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV 722          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Match: Shab (gene:FBgn0262593 transcript:FBtr0305202)

HSP 1 Score: 379.793 bits (974), Expect = 3.668e-120
Identity = 200/432 (46.30%), Postives = 279/432 (64.58%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV 1443
            + INVGG    + W  ++R  ++RL +L    T E I+ LCD+Y     E FFDRHPKSF +I N  + G+ +   E C     ++L+YWG+   YL  CC++ + +RKE + EE  K    + R +  +   + K  + +  LW ++E P TS  +R++AV SI FI++ST+ L ++TLP                  L +  +     N    ++E +CI WFTLEY+LR  +      F K  LNIID +AI P+F++L + +  +   D+ + + RVVQVFRI+R+LR+LKLARHS GLQSLG+TL+ SYKELGLL+ F+A+GV +FSSL YFAEKD   TKF SIP TFWWA I+MTTVGYGDIYP TA+G+   ++CC+ GVLVIALPIPIIV+NF+EFYK+++R EK LKR+E +++AK  GS V
Sbjct:  309 VSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESL-RQRDEEEFGEGKCAEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLP-----------------QLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGITMTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV 722          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnb1 (potassium voltage-gated channel, Shab-related subfamily, member 1 [Source:ZFIN;Acc:ZDB-GENE-090831-3])

HSP 1 Score: 367.466 bits (942), Expect = 2.190e-118
Identity = 193/440 (43.86%), Postives = 289/440 (65.68%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC-----RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +++NVGG    + W  + R   +RL +L    T E ++ +CD+Y+ +  E FFDRHP +F +I N  + G+ +   E CA    +EL YWG+   YL  CC+  + ++KE ++EE ++  + +      K +   +F        R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP       Q+  E  +  + T  +H           +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   36 VKLNVGGLPHEVLWRTLDRLPRTRLGKLRDCKTHESLMEVCDDYNLEDNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDYWGVDEIYLESCCQARYHQKKEQMNEELKREADTL------KDREGEEFDNTCCSEKRKKLWDLLEKPGSSVAAKILAIISILFIVLSTIALSLNTLP-----ELQETDEFGQTTDNTQLAH-----------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 452          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnb1 (potassium voltage-gated channel, Shab-related subfamily, member 1 [Source:ZFIN;Acc:ZDB-GENE-090831-3])

HSP 1 Score: 366.696 bits (940), Expect = 3.200e-118
Identity = 193/440 (43.86%), Postives = 289/440 (65.68%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC-----RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +++NVGG    + W  + R   +RL +L    T E ++ +CD+Y+ +  E FFDRHP +F +I N  + G+ +   E CA    +EL YWG+   YL  CC+  + ++KE ++EE ++  + +      K +   +F        R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP       Q+  E  +  + T  +H           +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   37 VKLNVGGLPHEVLWRTLDRLPRTRLGKLRDCKTHESLMEVCDDYNLEDNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDYWGVDEIYLESCCQARYHQKKEQMNEELKREADTL------KDREGEEFDNTCCSEKRKKLWDLLEKPGSSVAAKILAIISILFIVLSTIALSLNTLP-----ELQETDEFGQTTDNTQLAH-----------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTES-NKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 453          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnb1 (potassium voltage-gated channel, Shab-related subfamily, member 1 [Source:ZFIN;Acc:ZDB-GENE-090831-3])

HSP 1 Score: 367.851 bits (943), Expect = 5.162e-118
Identity = 193/440 (43.86%), Postives = 289/440 (65.68%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC-----RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +++NVGG    + W  + R   +RL +L    T E ++ +CD+Y+ +  E FFDRHP +F +I N  + G+ +   E CA    +EL YWG+   YL  CC+  + ++KE ++EE ++  + +      K +   +F        R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP       Q+  E  +  + T  +H           +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   36 VKLNVGGLPHEVLWRTLDRLPRTRLGKLRDCKTHESLMEVCDDYNLEDNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDYWGVDEIYLESCCQARYHQKKEQMNEELKREADTL------KDREGEEFDNTCCSEKRKKLWDLLEKPGSSVAAKILAIISILFIVLSTIALSLNTLP-----ELQETDEFGQTTDNTQLAH-----------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 452          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnb1 (potassium voltage-gated channel, Shab-related subfamily, member 1 [Source:ZFIN;Acc:ZDB-GENE-090831-3])

HSP 1 Score: 367.851 bits (943), Expect = 1.897e-117
Identity = 193/440 (43.86%), Postives = 289/440 (65.68%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC-----RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +++NVGG    + W  + R   +RL +L    T E ++ +CD+Y+ +  E FFDRHP +F +I N  + G+ +   E CA    +EL YWG+   YL  CC+  + ++KE ++EE ++  + +      K +   +F        R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP       Q+  E  +  + T  +H           +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   38 VKLNVGGLPHEVLWRTLDRLPRTRLGKLRDCKTHESLMEVCDDYNLEDNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDYWGVDEIYLESCCQARYHQKKEQMNEELKREADTL------KDREGEEFDNTCCSEKRKKLWDLLEKPGSSVAAKILAIISILFIVLSTIALSLNTLP-----ELQETDEFGQTTDNTQLAH-----------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTES-NKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 454          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Match: kcnb1 (potassium voltage-gated channel, Shab-related subfamily, member 1 [Source:ZFIN;Acc:ZDB-GENE-090831-3])

HSP 1 Score: 367.851 bits (943), Expect = 3.047e-117
Identity = 193/440 (43.86%), Postives = 289/440 (65.68%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC-----RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +++NVGG    + W  + R   +RL +L    T E ++ +CD+Y+ +  E FFDRHP +F +I N  + G+ +   E CA    +EL YWG+   YL  CC+  + ++KE ++EE ++  + +      K +   +F        R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP       Q+  E  +  + T  +H           +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   32 VKLNVGGLPHEVLWRTLDRLPRTRLGKLRDCKTHESLMEVCDDYNLEDNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDYWGVDEIYLESCCQARYHQKKEQMNEELKREADTL------KDREGEEFDNTCCSEKRKKLWDLLEKPGSSVAAKILAIISILFIVLSTIALSLNTLP-----ELQETDEFGQTTDNTQLAH-----------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTES-NKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 448          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: KCNB2 (potassium channel, voltage gated Shab related subfamily B, member 2 [Source:NCBI gene;Acc:100489419])

HSP 1 Score: 367.851 bits (943), Expect = 1.792e-116
Identity = 195/440 (44.32%), Postives = 286/440 (65.00%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC-----RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            ++INVGG    + W  + R   +RL +L    T E +L +CD+Y+    E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE      +    +  + +   +F        R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP   + ++  Q     N  L +              +E +CIAWFT+EY+LR +S      F K  LNIID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   37 VKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEE------LRREAETLREREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAKILAIISILFIVLSTIALSLNTLPDLQETDEFGQPN--DNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNIIDLLAILPYYVTIFLTES-NKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 453          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: meltf (melanotransferrin [Source:Xenbase;Acc:XB-GENE-968181])

HSP 1 Score: 285.804 bits (730), Expect = 1.494e-89
Identity = 165/438 (37.67%), Postives = 257/438 (58.68%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQL--CRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAK-FGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            I +NVGG   +L    + R+  +RL +L  C A   + I  LCD+YD    E +FDR P +F+ I  +   G  +     C      E+ +W + ++ L  CC+ + + +   ++E  ++V+ I+  L    S+SK K F KC   LW  ME PE+S  +RI A+ S  FI+IS+  + + T+P       + Q E ++  ++ + + +          IE +CI WFTLEY+LRLIS    LHF   F+NIID +AI PF++++I+T +       L ++ + +Q  RI+R+ R+ KLARHS GLQ+L Y L+ S+KELGLL+ ++A+G+ +FS+L Y  E+    T F SIP +FWWAII+MTTVGYGDIYPKT +G+  A+   + GV+ IALPI  I++NF ++Y  +  +E   K + E+ +  + G ++  N
Sbjct:   23 ITVNVGGIRQVLYGDVLNRYPETRLAELVNCMAGGYDAIFSLCDDYDPGKKEFYFDRDPDAFKCIIEVYLYGEVHMKKGICPICFKNEMDFWRVDLDLLDDCCKSHLNEKNLELEEIAKRVQTILDDLGGDTSESKWKRFQKC---LWKFMEKPESSFPARITAILSFLFILISSTVMCIGTIP-------EMQVEDLQGNHVEHPTLDS---------IETVCIGWFTLEYLLRLISSPNRLHFALSFMNIIDVLAILPFYVSIILTNLGATIMG-LTNVQQAIQALRIMRIARIFKLARHSSGLQTLTYALKSSFKELGLLLMYLAVGIFVFSALGYTMEQSHPDTLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAATSFLCGVIAIALPIHPIINNFVKYYNKQRVLETATKHELELMELHSNGGYLGAN 440          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: sv2b (synaptic vesicle glycoprotein 2B [Source:Xenbase;Acc:XB-GENE-6041859])

HSP 1 Score: 284.263 bits (726), Expect = 8.018e-89
Identity = 157/457 (34.35%), Postives = 268/457 (58.64%), Query Frame = 1
Query:  133 NKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEEN-EKVRNIMYRLKITKSKSKA-----------KFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRME-KTLKRKEEMEKAKNIGSFVLLNTFAQ 1464
            N+   +++NVGG    +    + RF ++RL +L    + E IL LCD+Y+    E +FDR+P  F  I N    G+ +   E C     +E++YWGI+  ++  CC   +  +KE+I E++ ++  +I+     +  +S             KFG  R K+W  +E+P  S+ +++ A+ S+S ++ S + + + ++P   K++  D+                + ++ +  ++E +CI WFT E V+RLI       F K  +NIIDF++I PF+ TL+V  V +  N+ +E++ +VVQ+ R++R+ R+LKLARHSVGL+SLG TL+ SY E+GLL+ F+A+G+++FS L+Y+ EKD   +   SIP  +WWA ISMTTVGYGD +P T  G+   ++C + G+LV+ALPI II + FS++Y+ +  ++       E+ +K  ++  F + + +A+
Sbjct:   12 NEEELVKLNVGGFKQSVDQKTLLRFPHTRLGKLLNCRSEEAILELCDDYNVADKEYYFDRNPSLFRYILNFYYTGKLHVMEELCVFSFSQEIEYWGINELFIDSCCSNKYQEKKEIIAEKDWDQKSDIISLGSSSSDQSSVFERELEMFDTLKFGDIRRKIWIRLENPAYSLSAKLFAIASLSVVLTSIVAMCIHSMPEFKKLDANDR----------------ELEDPVLAVVEIVCIIWFTSELVIRLIVAPSQKKFWKNPMNIIDFVSIIPFYATLVV-DVNDEENEGIENMGKVVQILRLMRIFRILKLARHSVGLRSLGATLKHSYHEVGLLLLFLAVGISIFSVLVYYVEKDEDQSGLHSIPMCWWWATISMTTVGYGDTHPVTLFGKLVGTVCIICGILVVALPITIIFNKFSKYYQKQKAIDVDGCNDDEQKDKFNDLPYFNIRDIYAR 451          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: KCNS2 (potassium voltage-gated channel, modifier subfamily S, member 2 [Source:NCBI gene;Acc:101732753])

HSP 1 Score: 278.1 bits (710), Expect = 1.050e-86
Identity = 170/465 (36.56%), Postives = 267/465 (57.42%), Query Frame = 1
Query:  112 ITMPIVNNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKS--------KSKAKF-----GKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLH-FLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLNTFAQ 1464
            + +P    +   I INVGG    L++  + RF  +RL +L    + E IL LCD+YD    E +FDR+P+ F  + +    G+ +   E C     +E++YWGI+  ++  CC Y++  RK  ++ E ++      R   T S           AKF     G  R +LW  +++P  SILSRI ++ SI  ++ S + + +++LP    VN     E                ++  +EI+E+  IAWFTLE V+R  SV+  L  F K  LNIIDFI+IAPF++TLIV  V E  +  L ++ RV QV R++R+ R+LKLARHS GL+SLG TL+ SY+E+GLL+ ++++G+++FS + Y  EK+  +   ++IP  +WWA +SMTTVGYGD+ P T  G+  AS C + G+LV+ LPI +I + FS FY+ + ++E  ++  +  +  K++ S  L + +A 
Sbjct:    7 MGLPDTGFEDTEISINVGGYKKRLRYDTLLRFPETRLCKLLACRSKESILELCDDYDDTKNEFYFDRNPELFPYVLHFYNTGKLHVMGELCVFSFCQEIEYWGINEFFIDSCCSYSYHGRK--VEPEQDQWEENSERESTTSSFDEILAFYHDAAKFDRQPLGNIRRRLWLALDNPGYSILSRIFSILSILVVLGSIVTMCLNSLPEFQVVNANGSVE----------------EDPRFEIVEHFGIAWFTLELVVRF-SVSPDLSLFFKHPLNIIDFISIAPFYITLIVNLVVE-SSPTLVNLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYREVGLLLLYLSVGISIFSVVAYTIEKE-ENDGLATIPACWWWATVSMTTVGYGDVVPGTIAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQKQLENAMRSCDFGDGVKDVPSVNLRDYYAH 450          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Match: KCNV2 (potassium channel, voltage gated modifier subfamily V, member 2 [Source:NCBI gene;Acc:100498412])

HSP 1 Score: 276.944 bits (707), Expect = 3.830e-85
Identity = 150/441 (34.01%), Postives = 252/441 (57.14%), Query Frame = 1
Query:  136 KRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEE---NEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYER--------HNDKLESITRV------VQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKE 1407
            +R  + INVGG  + + +     +  SR+ +L      +  L LCD+Y  K    FFDR P  F +I+N  + G  +   E C    LEE+ YWG+ + +   CCR +F+ R++ ++E+     ++R  M   +  +      +G  R ++WN+ME P +S+ ++ +AV S  F++IS + + ++T+            E ++ KN    +    S     E +E +CI +FTLEY+LRL+S     HF +  LN +D IAI P +L +++    +         H  ++E++ RV      +++ R++R+ R+LKLARHS GL++ G+TL++ Y+++G L  FIA+GV  FS+++Y  E DVS T F+SIPH +WWA +S++TVGYGD+YP+T +G+ FA +C   G+++  +PI I+ + FS++Y      E T  RK+
Sbjct:  106 RRKSLHINVGGTSYRISYGVAASYPKSRIGRLATYTDRQRKLDLCDDYSPKEDVYFFDRDPAIFHHIYNFYRTGVLWVRDELCPRSFLEEINYWGVRVKHTPRCCRISFEERQDDLNEQLKVQRELRAEMETEENEELFRGMLYGHLRRRIWNMMEKPFSSVTAKAIAVASSFFVLISVVAMTLNTV------------EDMQYKN----AAGLPSGKPYLEHVETLCITFFTLEYLLRLMSTPDLQHFGRSVLNAVDLIAILPLYLQMLLESFADEDRSGKGSSHEHEIEAVGRVGKLGQVLRIMRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLFLFIAMGVFSFSAMVYSVEHDVSGTNFTSIPHAWWWAAVSISTVGYGDVYPETHLGRLFAFLCIAFGIILNGMPISILYNKFSDYYSKLKSYEYTTIRKK 530          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnb1 (potassium voltage gated channel, Shab-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96666])

HSP 1 Score: 372.859 bits (956), Expect = 7.268e-119
Identity = 203/477 (42.56%), Postives = 308/477 (64.57%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN---TFAQNTIGVIQPFIKGNEFGLSRTNVEPLVTWNTNDWKF 1569
            +R+NVGG    + W  + R   +RL +L    T + +L++CD+Y  +  E FFDRHP +F +I N  + GR +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE ++    + R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP    +++  QS    N  L +              +E +CIAWFT+EY+LR +S  +   F K  LN ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N    FA+ +I ++   ++ N  G+++ +       + N WK+
Sbjct:   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETL-REREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQS--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFAR-SIEMMDIVVEKNGEGVAKKDKVQDNHLSPNKWKW 490          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnb1 (potassium voltage gated channel, Shab-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96666])

HSP 1 Score: 372.859 bits (956), Expect = 7.268e-119
Identity = 203/477 (42.56%), Postives = 308/477 (64.57%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN---TFAQNTIGVIQPFIKGNEFGLSRTNVEPLVTWNTNDWKF 1569
            +R+NVGG    + W  + R   +RL +L    T + +L++CD+Y  +  E FFDRHP +F +I N  + GR +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE ++    + R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP    +++  QS    N  L +              +E +CIAWFT+EY+LR +S  +   F K  LN ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N    FA+ +I ++   ++ N  G+++ +       + N WK+
Sbjct:   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETL-REREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQS--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFAR-SIEMMDIVVEKNGEGVAKKDKVQDNHLSPNKWKW 490          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnb2 (potassium voltage gated channel, Shab-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:99632])

HSP 1 Score: 368.237 bits (944), Expect = 1.227e-116
Identity = 196/435 (45.06%), Postives = 286/435 (65.75%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            ++INVGG    + W  + R   +RL +L    T E +L +CD+Y+    E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE  +    M R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP           E+ +N         + S N     +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   37 VKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETM-REREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLP-----------ELQENDEFG-----QPSDNRKLAHVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 453          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnb2 (potassium voltage gated channel, Shab-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:99632])

HSP 1 Score: 368.237 bits (944), Expect = 1.227e-116
Identity = 196/435 (45.06%), Postives = 286/435 (65.75%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            ++INVGG    + W  + R   +RL +L    T E +L +CD+Y+    E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE  +    M R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP           E+ +N         + S N     +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   37 VKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETM-REREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLP-----------ELQENDEFG-----QPSDNRKLAHVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 453          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Match: Kcnf1 (potassium voltage-gated channel, subfamily F, member 1 [Source:MGI Symbol;Acc:MGI:2687399])

HSP 1 Score: 280.026 bits (715), Expect = 3.201e-87
Identity = 153/424 (36.08%), Postives = 249/424 (58.73%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQL--CRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEM 1413
            I +NVGG   +L    + ++  +RL +L  C A   + I  LCD+YD    E +FDR P +F+ +  +   G  +     C      E+ +W + + +L  CC+ +   ++E ++E   +V+ I+  L +    ++ ++ +C+  +W  +E PE+S  +R++AV S   I++S++ + + T+P    V+                S   + ++   E +E  CI WFTLEY+LRL S    LHF   F+NI+D +AI PF+++L +T +  R  + L ++ + VQ  RI+R+ R+ KLARHS GLQ+L Y L++S+KELGLL+ ++A+G+ +FS+L Y  E+    T F SIP +FWWAII+MTTVGYGDIYPKT +G+  A+I  + GV+ IALPI  I++NF  +Y  +  +E   K + E+
Sbjct:   37 IVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGV--DAAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQVVD----------------SEGNRVEHPTLENVETACIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMME-LTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLETAAKHELEL 441          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|P17970|KCNAB_DROME (Potassium voltage-gated channel protein Shab OS=Drosophila melanogaster OX=7227 GN=Shab PE=1 SV=2)

HSP 1 Score: 378.252 bits (970), Expect = 7.589e-119
Identity = 199/432 (46.06%), Postives = 278/432 (64.35%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV 1443
            + INVGG    + W  ++R  ++RL +L    T E I+ LCD+Y     E FFDRHPKSF +I N  + G+ +   E C     ++L+YWG+   YL  CC++ + +RKE + EE  K    + R +  +   + KF + +  LW ++E P TS  +R++AV SI FI++ST+ L ++TLP                  L +  +     N    ++E +CI WFTLEY+LR  +      F K  LNIID +AI P+F++L + +  +   D+ + + RVVQVFRI+R+LRVLKLARHS GLQSLG+TL+ SYKELGLL+ F+A+GV +FSSL YFAEKD   TKF SIP  FWWA I+MTTVGYGDI P TA+G+   ++CC+ GVLV+ALPIPIIV+NF+EFYK+++R EK LKR+E +++AK  GS V
Sbjct:  279 VSINVGGVRHEVLWRTLERLPHTRLGRLRECTTHEAIVELCDDYSLADNEYFFDRHPKSFSSILNFYRTGKLHIVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKENVHEEMRKEAESL-RQRDEEEFGEGKFSEYQKYLWELLEKPNTSFAARVIAVISILFIVLSTIALTLNTLP-----------------QLQHIDNGTPQDNPQLAMVEAVCITWFTLEYILRFSASPDKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRVLKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPEAFWWAGITMTTVGYGDICPTTALGKVIGTVCCICGVLVVALPIPIIVNNFAEFYKNQMRREKALKRREALDRAKREGSIV 692          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|Q03717|KCNB1_MOUSE (Potassium voltage-gated channel subfamily B member 1 OS=Mus musculus OX=10090 GN=Kcnb1 PE=1 SV=2)

HSP 1 Score: 372.859 bits (956), Expect = 5.084e-118
Identity = 203/477 (42.56%), Postives = 308/477 (64.57%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN---TFAQNTIGVIQPFIKGNEFGLSRTNVEPLVTWNTNDWKF 1569
            +R+NVGG    + W  + R   +RL +L    T + +L++CD+Y  +  E FFDRHP +F +I N  + GR +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE ++    + R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP    +++  QS    N  L +              +E +CIAWFT+EY+LR +S  +   F K  LN ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N    FA+ +I ++   ++ N  G+++ +       + N WK+
Sbjct:   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETL-REREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQS--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFAR-SIEMMDIVVEKNGEGVAKKDKVQDNHLSPNKWKW 490          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|P15387|KCNB1_RAT (Potassium voltage-gated channel subfamily B member 1 OS=Rattus norvegicus OX=10116 GN=Kcnb1 PE=1 SV=3)

HSP 1 Score: 371.318 bits (952), Expect = 1.564e-117
Identity = 195/435 (44.83%), Postives = 288/435 (66.21%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +R+NVGG    + W  + R   +RL +L    T + +L++CD+Y  +  E FFDRHP +F +I N  + GR +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE ++    + R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP    +++  QS    N  L +              +E +CIAWFT+EY+LR +S  +   F K  LN ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETL-REREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQS--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 449          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|Q14721|KCNB1_HUMAN (Potassium voltage-gated channel subfamily B member 1 OS=Homo sapiens OX=9606 GN=KCNB1 PE=1 SV=2)

HSP 1 Score: 370.933 bits (951), Expect = 3.024e-117
Identity = 195/435 (44.83%), Postives = 286/435 (65.75%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +R+NVGG    + W  + R   +RL +L    T + +L +CD+Y     E FFDRHP +F +I N  + GR +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE ++    + R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP    +++  QS    N  L +              +E +CIAWFT+EY+LR +S  +   F K  LN ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETL-REREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQS--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 449          
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Match: sp|O18868|KCNB1_PIG (Potassium voltage-gated channel subfamily B member 1 OS=Sus scrofa OX=9823 GN=KCNB1 PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.105e-117
Identity = 194/435 (44.60%), Postives = 286/435 (65.75%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +R+NVGG    + W  + R   +RL +L    T + +L +CD+Y     E FFDRHP +F +I N  + GR +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE ++    + R +  +        + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP    +++  Q+    N  L +              +E +CIAWFT+EY+LR +S  +   F K  LN ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETL-REREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQT--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 449          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: V4AM04 (BTB domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_102339 PE=3 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 1.648e-122
Identity = 216/516 (41.86%), Postives = 314/516 (60.85%), Query Frame = 1
Query:  124 IVNNKRAFIRI--NVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV------LLNTFAQ-------NTIGVIQPFIKGNEFGLSRTNVEPLVTWNTNDWKFMDYSSSGC-------ENDS 1605
            I+ +K++  R+  NVGG    + W  + R  ++RL +L   +T E I+ LCD+Y+    E FFDRHP+SF +I N  ++G+ +   E C     E+L+YWGI   YL  CC++ + ++KE + EE  K    + R +        +  K R ++W+++E P TS+ +R++A+ S+ FI++ST+ L ++T+P       QD+S+            +E + N    ++E +CI WFTLEY+ R  +      F K  LN+ID +AI P+F++L +T+      ++ +++ RVVQ+FRI+R+LR+LKLARHS GLQSLGYTLQ+SYKELGLL+ F+AI + LFSSL YFAEKD   TK+ SIP TFWWA I+MTTVGYGDI+P T +G+   S+CC+ GVLVIALPIPIIV+NF+EFYKD++R EK  KR+E +EKAK  GS V      L + FA+       N+ G       G+      T+  P V    N   + +    GC       +NDS
Sbjct:   26 ILRSKQSTKRVILNVGGVRHEVLWRTLDRMPHTRLGKLRECITHESIMELCDDYNLSENEYFFDRHPRSFASILNFYRSGKLHLVEEMCVLSFSEDLEYWGIDELYLESCCQHKYHQKKEHVFEEIRKEAESI-RQRDEDDFGTGRCAKTRQRVWDLLEKPTTSMAARVVAIISVLFIVLSTIALTLNTIPA-----LQDRSK-----------PKEAADNPQLAVVEAVCIGWFTLEYLARFWASPNKWKFFKGPLNVIDLLAIMPYFISLGLTESNRDTTEQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGYTLQRSYKELGLLLMFLAISILLFSSLAYFAEKDEPETKYKSIPETFWWAAITMTTVGYGDIHPTTVLGKIVGSVCCICGVLVIALPIPIIVNNFAEFYKDQMRREKAFKRREALEKAKRTGSIVSFHSINLRDAFARDVDLMEVNSGGGKGDNQDGSSSDSKGTSPPPCVIKFNNQPNYQNDDVEGCNAKTLHVDNDS 524          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: A0A1Y1LBM9 (BTB domain-containing protein (Fragment) OS=Photinus pyralis OX=7054 PE=3 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 4.187e-121
Identity = 214/481 (44.49%), Postives = 299/481 (62.16%), Query Frame = 1
Query:  133 NKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFG--KC---RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV------LLNTFAQ--NTIGVIQ------PFIKGNEFGLS 1518
            N+R  + INVGG    + W  + R  ++RL +L    T E I+ LCD+Y     E FFDRHPKSF +I N  + G+ +   E C     ++L+YWG+   YL  CC++ + +RKE + EE  K        +  + + + +FG  KC   +  LW+++E P TSI +R++A+ SI FI++ST+ L ++T+P                    Y        N    ++E +CI WF+LEY+LR  +      F K  LN+ID +AI P+F++L + +  +  ND+ + + RVVQVFRI+R+LR+LKLARHS GLQSLG+TL+ SYKELGLL+ F+A+GV +FSSL YFAEK+   TKF SIP TFWWA I+MTTVGYGDIYP TA+G+   S+CC+ GVLVIALPIPIIV+NF+EFYK+++R EK LKR+E +E+AK  GS V      L + FA+  + I VI         I GNE  +S
Sbjct:   39 NRR--VVINVGGVKHEVLWRTLDRLPHTRLGRLRDCNTHEAIIELCDDYSLVDNEYFFDRHPKSFSSILNFYRTGKLHLVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKEHVHEEMRK------EAESLRQRDEEEFGDDKCSQYQKWLWDMLEKPTTSIAARVIAIVSILFIVVSTVALTLNTIPSMQ----------------VYDDRGVAQDNPQLAMVEVVCITWFSLEYILRFSASPNKWKFFKGGLNVIDLLAILPYFVSLFLLETNKNANDQFQDVRRVVQVFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKEEPGTKFISIPETFWWAGITMTTVGYGDIYPTTALGKVIGSVCCICGVLVIALPIPIIVNNFAEFYKNQMRREKALKRREALERAKREGSIVSFHHINLRDAFAKSMDLIDVIVDTGDKCALIGGNEGRIS 495          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: A0A2S1ZNL6 (Shab (Fragment) OS=Neoconocephalus triops OX=642721 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 7.923e-121
Identity = 200/430 (46.51%), Postives = 280/430 (65.12%), Query Frame = 1
Query:  154 INVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV 1443
            INVGG    + W  ++R  ++RL +L    T E I  LCD+Y     E FFDRHPKSF +I N  + G+ +   E C     ++L+YWG+   YL  CC++ + +RKE + EE  K    + R +  +   + K  + +  LW+++E P TSI +R++AV SI FI++ST+ L ++T+P                 +L Y+ +     N    ++E +CI WFTLEYVLR  +      F K  LNIID +AI P+F++L + +  +  ND+ + + RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL+ SYKELGLL+ F+A+GV +FSSL YFAEK+   TKF SIP TFWWA I+MTTVGYGDIYP T +G+    +CC+ GVLV+ALPIPIIV+NF+EFYK+++R EK LKR+E +E+AK  GS V
Sbjct:   60 INVGGVKHEVLWRTLERLPHTRLGRLRDCNTHEAITELCDDYSLIDNEYFFDRHPKSFSSILNFYRTGKLHLVDEMCVLAFSDDLEYWGVDELYLESCCQHKYHQRKEHVHEEMRKEAESL-RQREEEEFGEGKCAQYQKFLWDLLEKPTTSIAARVIAVISILFIVLSTIALTLNTIP-----------------SLQYNENGSFQDNPQLAMVEAVCITWFTLEYVLRFSASPNKWKFFKGGLNIIDLLAILPYFVSLFLLETNKNANDQFQDVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKEEPGTKFISIPETFWWAGITMTTVGYGDIYPTTPLGKVIGGVCCICGVLVVALPIPIIVNNFAEFYKNQMRREKALKRREALERAKREGSIV 471          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: A0A3B4AE97 (BTB domain-containing protein OS=Periophthalmus magnuspinnatus OX=409849 PE=3 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.082e-120
Identity = 201/435 (46.21%), Postives = 289/435 (66.44%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            + +NVGG    + W  + R   +RL +L      E +L +CD+Y+    E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE  +    + R +  + + K    + R KLW+++E P +S+ ++I+A+ SI FIIIST+ L ++TLP    V++  Q     N +L +              +E +CIAWFT+EYVLRLIS      F+K  LNIID +AI P+F+TL +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYP+T +G+    +CC+ GVLVIALPIPIIV+NFSEFY+++ R EK +KR+E +E+AK  GS V LN
Sbjct:   23 VHLNVGGLTHEVLWRTLDRLPRTRLGRLRDCNNHESVLEICDDYNLMENEYFFDRHPMAFSSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETL-RDQDVQEEEKGCCPEQRQKLWDLLEKPSSSVPAKILAMISILFIIISTISLSLNTLPELQVVDEFGQFN--DNPSLAH--------------VEAVCIAWFTMEYVLRLISAPNKWDFIKAPLNIIDLLAILPYFVTLCLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGRIVGGLCCIAGVLVIALPIPIIVNNFSEFYREQKRQEKAIKRREALERAKRSGSIVSLN 439          
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Match: A0A3B4AEK3 (BTB domain-containing protein OS=Periophthalmus magnuspinnatus OX=409849 PE=3 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.193e-120
Identity = 201/435 (46.21%), Postives = 289/435 (66.44%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            + +NVGG    + W  + R   +RL +L      E +L +CD+Y+    E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE  +    + R +  + + K    + R KLW+++E P +S+ ++I+A+ SI FIIIST+ L ++TLP    V++  Q     N +L +              +E +CIAWFT+EYVLRLIS      F+K  LNIID +AI P+F+TL +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYP+T +G+    +CC+ GVLVIALPIPIIV+NFSEFY+++ R EK +KR+E +E+AK  GS V LN
Sbjct:   22 VHLNVGGLTHEVLWRTLDRLPRTRLGRLRDCNNHESVLEICDDYNLMENEYFFDRHPMAFSSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETL-RDQDVQEEEKGCCPEQRQKLWDLLEKPSSSVPAKILAMISILFIIISTISLSLNTLPELQVVDEFGQFN--DNPSLAH--------------VEAVCIAWFTMEYVLRLISAPNKWDFIKAPLNIIDLLAILPYFVTLCLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGRIVGGLCCIAGVLVIALPIPIIVNNFSEFYREQKRQEKAIKRREALERAKRSGSIVSLN 438          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:103042196])

HSP 1 Score: 370.163 bits (949), Expect = 3.528e-118
Identity = 194/440 (44.09%), Postives = 289/440 (65.68%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC-----RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +R+NVGG    + W  + R   +RL +L    T E ++ +CD+Y+    E FFDRHP +F +I N  + G+ +   E CA    +EL YWG+   YL  CC+  + ++KE ++EE ++  + +      K +   +F        R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP   ++++  QS    N  L +              +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   36 VRLNVGGLPHEVLWRTLDRLPRTRLGKLRDCRTHEALMDVCDDYNLDDNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDYWGVDEIYLESCCQARYHQKKEQMNEELKREADTL------KDREGEEFDNTCCSEKRKKLWDLLEKPGSSVAAKILAIISILFIVLSTIALSLNTLPELQEIDEFGQS--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSAPNKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 452          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: KCNB1 (potassium voltage-gated channel subfamily B member 1-like [Source:NCBI gene;Acc:103041067])

HSP 1 Score: 369.392 bits (947), Expect = 5.605e-118
Identity = 197/449 (43.88%), Postives = 291/449 (64.81%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC-----RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN---TFAQNT 1470
            +R+NVGG +  + W  + R   +RL +L    T E I+ +CD+Y+    E FFDRHP +F +I N  + G+ +   E CA    +EL +WGI   YL  CC+  + ++KE ++EE ++    M      + +   +F        R KLW+++E P +S  ++I+A+ SI FI++ST+ L ++TLP    +++  Q+    N  L +              +E +CIAWFT+EY+LR +S      F K  LNIID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N    F +N+
Sbjct:   29 VRLNVGGLLHEVLWRTLDRLPRTRLGKLRDCNTHESIMEVCDDYNLDDNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAETM------REREGEEFDNTCCTEKRMKLWDLLEKPSSSFAAKILAIISILFIVLSTIALSLNTLPELQDIDEFGQA--TDNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNIIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNIKDAFGRNS 454          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: kcnb2 (potassium voltage-gated channel subfamily B member 2-like [Source:NCBI gene;Acc:103023195])

HSP 1 Score: 359.762 bits (922), Expect = 2.926e-114
Identity = 197/438 (44.98%), Postives = 290/438 (66.21%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC---RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +RINVGG +  + W  + R   +RL +L    T + ++ +CD+Y     E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE +   NE++R     L+  K   +   G C   R KLW+++E P +S+ ++++A+ SI FII+ST+ L ++TLP    +++  QS    N +L +              +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYP+T +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   36 VRINVGGLVHEVLWRTLDRLPRTRLGKLRDCNTHDTLMEICDDYSLNDNEYFFDRHPGAFSSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQM---NEELRREAETLR-EKEGEEVDTGCCPDKRQKLWDLLEKPSSSVAAKVLAIISILFIILSTIALSLNTLPELQVIDEFGQSN--DNPSLAH--------------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 452          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: si:dkey-192j17.1 (potassium voltage-gated channel subfamily B member 2 [Source:NCBI gene;Acc:103036535])

HSP 1 Score: 350.132 bits (897), Expect = 2.469e-110
Identity = 206/484 (42.56%), Postives = 305/484 (63.02%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC---RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN---TFAQNTIGVIQPFIKGNEFGLSRTNVEPLVTWNTNDWKFMDYS 1581
            +RINVGG    + W  + R   +RL +L    T E ++ +CD+Y     E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE +   NE++R     L+    + +     C   R KLW+++E P +S+ ++I+A+ SI FII+ST+ L ++TLP    +++  Q+    N  L +              +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYP+T +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N    FA+ ++ ++   ++ +E  LS  N      W  N     D S
Sbjct:   37 VRINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLMEVCDDYSLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQM---NEELRREAETLRERDGEGEFDNTCCSEKRKKLWDLLEKPNSSVAAKILAIISILFIILSTIALSLNTLPELQVIDEFGQAN--DNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFAR-SMELMDVVVEKSEDKLSMDNHLSPSRWGMNKRTASDVS 499          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Match: kcnf1a (potassium voltage-gated channel subfamily F member 1 [Source:NCBI gene;Acc:103046427])

HSP 1 Score: 291.967 bits (746), Expect = 3.427e-92
Identity = 159/446 (35.65%), Postives = 258/446 (57.85%), Query Frame = 1
Query:  130 NNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCR--AVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHND-KLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLK--------RKEEMEKAKNIG 1434
            + + A + +N+GG   +L    ++R+ ++RL +L    A + +E+  LCD+YD  +GE FFDR P +F  I  +   G  +     C    + E+++W +    L  CC+      ++ ++E +EKVR ++ R +  ++ + +   +CR+ LW +ME PE+S+ +R +AVTS  F+++S+  +   T+P  H    +  +                 ++ + E +E  C+AWFTLEYVLRL +      F   F+N++D +AI PF++ L +T V  R    +L +  + VQ  R+LRV RVLKLARHS GL++L + L  S KELGLL++++ +G+ LF++L Y  E+    T F+S+P +FWWAII+MTTVGYGD+YPKT +G+  A++  + GV+ IALPI  I++NF  FY  +  +E   K        R +E EK +  G
Sbjct:   21 SGEDAELLLNIGGVKQVLHADLLKRYPDTRLGELAELCARSPDELSELCDDYDPASGELFFDRDPDAFRCIAEVYIYGEVHMRRGMCPVCFMHEMEFWRVDAELLDECCQSCVSEARDELEEISEKVRAMLERTEEDEAAALSWRERCRAFLWKLMEKPESSVAARAVAVTSFFFVVLSSAAMCAGTVPELHVCCDEAGN---------------AREHPVLEAVEMACMAWFTLEYVLRLAAAPDRARFALSFMNVVDVLAIVPFYVLLALTHVGARLGALELANAQQCVQALRVLRVARVLKLARHSSGLRTLTHALSSSAKELGLLLTYMGVGIFLFAALAYTLEQSHPDTMFTSMPQSFWWAIITMTTVGYGDVYPKTTLGRCNAAVSFLCGVVAIALPIHPIINNFVTFYNKQRALESAAKHEIELMALRSQEEEKREGKG 451          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 370.933 bits (951), Expect = 3.458e-124
Identity = 198/441 (44.90%), Postives = 285/441 (64.63%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKF-GKC----RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLNT 1455
            +R+NVGG +  + W  ++R   +RL +L    T   +  LCD+Y     E FFDRHP +F ++ N  + GR +   E CA    +EL YWG+   YL  CC+  + ++KE + EE  +        +  + +   +F G C    R KLW ++E+P +S+ ++ MA+ SI FI++ST+ L ++TLP     +K + S II N  L                +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   R   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYP T +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +NT
Sbjct:    2 VRLNVGGLVHEVLWRTLERLPRTRLGRLHATNTHGALSELCDDYSIADNEYFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEIYLETCCQARYHQKKEQMSEELRR------EAESAREREGDEFEGTCCADKRRKLWELLENPNSSLAAKGMAIVSILFIVLSTIALSLNTLPDLQ--HKDEFSHIIDNPKLAQ--------------VEAVCIAWFTMEYLLRFMSAPNKWKFFKGALNVIDLMAILPYYITIFLTES-SRGVSQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEPDTKFHSIPASFWWATITMTTVGYGDIYPMTLLGKIIGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRREALERAKRNGSIVSMNT 419          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001869.1 (pep scaffold:Pmarinus_7.0:GL480351:152:3521:-1 gene:ENSPMAG00000001700.1 transcript:ENSPMAT00000001869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.929 bits (681), Expect = 4.815e-85
Identity = 140/281 (49.82%), Postives = 204/281 (72.60%), Query Frame = 1
Query:  616 SRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHND-KLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLNT 1455
            ++++A+ SI FI++ST+ L ++TLP   + +  +   ++ N +L +              +E +CIAWFT EY+LR +S      F K  LN+ID +AI P+++T+ +T+    H+  + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYP+T +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N+
Sbjct:    1 AKVLAIISILFIVLSTIALSLNTLPDLQETD--EYGNVMDNPSLAH--------------VEAVCIAWFTTEYMLRFLSSPNKWKFFKGALNVIDLLAILPYYITIFLTE--SNHSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFRSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRREALERAKRNGSIVSMNS 263          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005395.1 (pep scaffold:Pmarinus_7.0:GL482646:8602:10978:-1 gene:ENSPMAG00000004908.1 transcript:ENSPMAT00000005395.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 264.618 bits (675), Expect = 8.293e-83
Identity = 140/279 (50.18%), Postives = 200/279 (71.68%), Query Frame = 1
Query:  619 RIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLNT 1455
            +++A+ SI FI++ST+ L ++TLP     +K +      N +L +              +E +CIAWFT EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYP+T +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N+
Sbjct:    1 QMLAIISILFIVLSTIALSLNTLP--ELQHKDEYGHFTDNPSLAH--------------VEAVCIAWFTTEYMLRFLSSPNKWKFFKGALNVIDLLAILPYYITIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEQDTKFKSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRREALERAKRNGSIVSMNS 262          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: kcnf1b (potassium voltage-gated channel, subfamily F, member 1b [Source:ZFIN;Acc:ZDB-GENE-090312-39])

HSP 1 Score: 260.381 bits (664), Expect = 1.723e-81
Identity = 160/426 (37.56%), Postives = 249/426 (58.45%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLC-DEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC---RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEM 1413
            + +NVGG   +L+   + R  +S L  L   V      R   D++D  +GE FFDR P++F+ I +    G  + D   C     +E+ +WG+  + L  CCR+   R  EL +E +E V+ +   L+ + +   A+ G+C   R  +W +ME P++S L+R +A+TS +FI++S++ + + T+P           E+        ++ EE   +     IE +CI WFT+E+ LR  S    + F+   +N++D +A+ P+F+ L +T++       L S+ + VQ  RI+RV RV KLARHS GLQ+L Y L+ S+KELGLL+ ++ +GV LFS+L Y  E+    T FSSIPH+FWWAII+MTTVGYGDIYPKT +G+  A++  + G L IALPI  I++NF +FY  +  +E   K + E+
Sbjct:    2 LAVNVGGSRHVLRSELLARLPDSLLATLL--VRPGAARRPAYDDFDPDSGEFFFDRDPRAFDRILDAYHFGEVHMDRSACPMCFKQEMDFWGVGADCLDDCCRF---RYSELQEELDEIVQMVETELRDSGTAGAAQRGRCERARVGVWQLMEKPDSSRLARSLALTSFAFIVVSSVVMCLGTIP-----------ELQPGPGADGAAGEE---HPTIAAIETVCIGWFTVEFALRFFSAPDRVKFMSSPMNVVDLLAVLPYFVVLALTEMGGSVM-GLASMQQGVQALRIMRVARVFKLARHSSGLQTLTYALKSSFKELGLLLLYLGVGVYLFSALGYTVEQSHPETLFSSIPHSFWWAIITMTTVGYGDIYPKTELGKINAAVSFLCG-LAIALPIHPIINNFVKFYNKQRVLEMAAKHQLEL 406          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011463.1 (pep scaffold:Pmarinus_7.0:GL479450:27175:28578:-1 gene:ENSPMAG00000010436.1 transcript:ENSPMAT00000011463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.529 bits (654), Expect = 2.371e-79
Identity = 148/443 (33.41%), Postives = 251/443 (56.66%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLC--RAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYR-------LKITKSKSK----AKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGS 1437
            I +NVGG    L+ + + RF  +RL  L   R  + E +L +CD+YDA   E +FDR P  F  + N  + G+ +   E CA    +E+ YWGI   ++  CC Y +  R E     + + ++           + + ++ +K     + G+ R +LW ++E+P  S+ S++ A TS++ ++IS + + +++ P                +   + ++ ++ ++     +E  CIAWFT E+++R +       F +  LNIID ++I PF++TL+V  V E    +L ++ +VVQV R+ R+ R+LKLARHS GL+SLG TL+ SY+E+GLL+ F+++G+++FS L Y  EKD   ++   IP  +WWA ISMTTVGYGD  P T  G+  A+ C + G++V+ALPI II + F+++Y+ +  ME  +   +  E   ++ +
Sbjct:   20 IHVNVGGLKRTLRHAVLLRFPQTRLALLASRRRHSWEAVLEMCDDYDAARDEFYFDRSPGVFSYVLNFYRTGKLHVMAEVCAHSFSQEIAYWGIHEFFIDSCCSYRYHERMEDYAGRDSEEKSEESSEASSFEDMCLLQADAKRFEHQRCGQHRKRLWLLLENPGFSLSSKVFAATSLATVVISIITMCINSTP----------------EFQLFDANGKELEDPSLMAVECFCIAWFTSEFLVRFLVTPNVRSFSQNPLNIIDLVSILPFYITLVVDSVLES-GGELHNLGQVVQVLRLARIFRILKLARHSTGLRSLGTTLKHSYEEVGLLLLFLSVGISIFSVLTYAVEKDDEGSELRDIPTCWWWATISMTTVGYGDTVPVTVPGKLMATACIMCGIIVVALPITIIFNKFTKYYRIQKAMEMGVGACDGSEDDGDVDA 445          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: EDO47871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL57])

HSP 1 Score: 292.352 bits (747), Expect = 2.275e-93
Identity = 169/447 (37.81%), Postives = 261/447 (58.39%), Query Frame = 1
Query:  151 RINVGGKIFLLQWSAVQRFHNSRL-------------EQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMY-------RLKITKSK----------SKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKR 1401
            ++N+ G  F L WS+++ F  +RL             ++LC  V + E          KT E FF R P+ F+ I    +NG+F+F    C  +   ELKYWGISI  +  CC  +F        +ENE V N+M         L + K +          S++K  + + K+W++ E+P +S +++I+ + S  F+++ST+ L ++T+           S  IK  N       E + N +   IE  CIAWFT+EY++RL+S  R + FLK  +N ID +AI P++  L+      + + +   + R++Q+ RILR++R+ K+ARHSVGLQ+L YT ++S  ELGLL + + +G+TLFSSL+YFAE+   ++ F SIP  FWW+II+MTTVGYGD+YP T +G+   S+CC++G++ IALPIP IVSNFS+FYKD+ +  +  +R
Sbjct:   16 QLNISGVRFELLWSSIKEFPFTRLGKVYFWYEHGDNWQELCDGVKMGE----------KTAEVFFQRDPEIFKTIMCYYRNGKFHFPRTICIEHFQRELKYWGISIKNMGDCCYNHFH-------QENEAVENLMKIKEAFKKDLNMKKEQDEVDLLLEVESRSKLARLKRKMWDLFENPHSSFMAKIVYLLSSFFVMLSTVALCLNTI----------DSLRIKLDN------GETADNAVLAGIEAGCIAWFTVEYLIRLLSAPRIVPFLKSIMNTIDLLAILPYYFELLSLAFDNQLDYRFVEMRRILQILRILRIVRIFKMARHSVGLQTLAYTFKQSTAELGLLGTLLIMGMTLFSSLVYFAEEAEPNSMFKSIPEAFWWSIITMTTVGYGDVYPVTPLGKLVGSLCCISGIIFIALPIPTIVSNFSQFYKDQRKSVEVRRR 429          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 249.595 bits (636), Expect = 4.249e-77
Identity = 162/434 (37.33%), Postives = 244/434 (56.22%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELI---------DEENEKVRNI---MYRL--KITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCL-VVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRK 1404
            + INVGG+        ++   ++RL  +    T         E+D  T E FFDRHP  F  + N  + G+ +   + C     +EL +WGI    +  CC  N+ + +E           D +NE V ++   +Y L     + +++  + K + ++W + E P +SI ++++A  ++ F+IIS++CL  + T+P      K D              + + S+  +  I+E +C+AWFTLE++ RLI     L F K+ +N ID  AI PF+LTLIV       N K   + RVV   R++RV R+ KL+RHS GLQ LG+TL+ S  EL LLV F+ IGV +FSS++++AEKD   T F++IPHTFWWA+++MTT+GYGD+ P T  GQ   S+C V GVL+IALP+P+IVSNFS +Y       K  +RK
Sbjct:   18 VVINVGGQKHETYIGTLKNIPDTRLYWITENGTQ------LPEFDPNTSEFFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDELQVEPCCWLNYKQHREAQANLDPFDHHDSDNESVGDMDMSVYGLVADSIRQRNRTWWKKYQPRIWTMFEEPYSSIPAQVLAFITM-FLIISSVCLFCLETVP------KFD--------------NPKTSEGFVLYILEAVCVAWFTLEFLFRLIFCPDKLSFFKKPMNWIDLGAILPFYLTLIV----RESNFKTIVVLRVV---RLIRVFRIFKLSRHSYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAEKDTKGTHFTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARMKLPRRK 417          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: SHAK3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK45])

HSP 1 Score: 223.016 bits (567), Expect = 2.646e-67
Identity = 148/412 (35.92%), Postives = 238/412 (57.77%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEY-DAKTGECFFDRHPKSFENIWNLLQ-NGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQS---EIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYK 1368
            I INV G  F    + + +F N+ L    +           +EY D+   E FFDR+  +FE I    Q NG+    +        +E+ ++ +  + L         +R E  +   E+   ++ R  + +            ++W + E+P++S+ +R++AV S+S I+IS +   + TLP        D +   +++   N T    E   ++  +  +E +CIAWFTLEYV+RL+S  + L F++ FLN+ID +AI P+++TL +  +      ++ S+  V++V R++RV R+ KL+RHS GLQ LG+TL+ S +EL +L+ F+ I V LFSS +Y+AE++ + +KFSSIP  FWWA+++MTTVGYGD+YP T  G+   SIC ++GVL IALP+P+IVSNF+ FYK
Sbjct:    3 IIINVSGLRFETYEATLAQFPNTLLGSESKR----------EEYFDSDADEYFFDRNRSTFEAILFFYQSNGKLVRPSGVPFLLFKDEVIFFKLGKDNL---------KRLEEEEGYIEETTRVLPRHHLQR------------RIWELFEYPDSSMGARVLAVWSVSVILISIVVFCIETLPTFRCKTSPDGNGCPKLLPGTNSTADHPEPVEKSSAWLALEILCIAWFTLEYVVRLLSSPQKLLFVRSFLNVIDLMAILPYYITLPMKDL------RITSLA-VLRVIRLVRVFRIFKLSRHSRGLQVLGHTLRASSRELAMLIFFLLISVVLFSSAVYYAEEEEAASKFSSIPDAFWWAVVTMTTVGYGDMYPVTPWGKLVGSICAISGVLTIALPVPVIVSNFNYFYK 376          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: SHAK5 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS8])

HSP 1 Score: 217.624 bits (553), Expect = 2.066e-65
Identity = 140/370 (37.84%), Postives = 213/370 (57.57%), Query Frame = 1
Query:  277 YDAKTGECFFDRHPKSFENIWNLLQ-NGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSH--KVNKQDQSEIIKNKNLTYSSHEEKS--QNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFS-SIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYK 1368
            +D    E FFDR+ + FE I    Q NGR     +     +LEE++++ +    ++         ++ L DEE ++    M   KI            +++ WN+ E+ ++S  +R++A+ S+S I+ S   L V TLP      ++  + +E ++  N     H E +      +  +E   IAWFTLEY++R +S  +   F++ FLN+ID +AI PF++ LI+  V  + ND   S+   +++ R++RV R+ KL+RHS GLQ LG TL+KS +ELGLL+ F+ IGV +FSS+ Y+AE     T    SIP TFWWA+++MTTVGYGD+ PKT  G+   S C + GVL IALP+P+IVSNF   YK
Sbjct:   36 FDPDLNEYFFDRNKQVFEIILYFYQSNGRLVCPPDLAPEILLEEVEFFDLGETAINAV-------KELLTDEEPDETPRDMPTNKI------------QTQFWNLFEYADSSKAARVIALFSVSIIVASIAVLCVETLPNFAILPIHDPNNTEEVRRVN----KHNEGAILARRWFGYLEAAFIAWFTLEYLVRFLSSPKKCPFVRSFLNVIDILAIVPFYIDLILNSV--QSNDGTLSLA-FLRILRLVRVFRIFKLSRHSSGLQILGLTLRKSLRELGLLIFFLFIGVVIFSSMAYYAEAGTKDTHLGRSIPDTFWWALVTMTTVGYGDLVPKTLWGKLVGSCCALCGVLAIALPVPVIVSNFDAIYK 379          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 215.312 bits (547), Expect = 3.614e-64
Identity = 138/437 (31.58%), Postives = 232/437 (53.09%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRK----------------ELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFY---KDKLRMEKTLKR 1401
            + INVGG       S ++   ++RL  +  A           ++D  TGE FFDRHP  F N+ N  + G+ +   + C     +EL +WGI    +  CC   + + +                E  D+E   +    +         K  + + + ++W +ME P +S L++++A T+++ I++S     + ++                          EK   D+  I+E IC+ WFTLE ++R +       F K+ +N IDF+AI PF+++L     +  +N+ ++++  +  +    R+ R+ KL+RHS GLQ LG+TL+ S++EL LL+ F+ IGV LF+SL+++ EK +  TKF  IP +FWWA+++MTTVGYGD+ P++  G+   S+C V GVL IALP+P+IV+NFS +Y   + +L++ K  +R
Sbjct:    3 VSINVGGVRHETYKSTLKNIPDTRLSWIAEASAGAA------DFDPSTGEYFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDDQQVESCCWLTYRQHRDAQETLAAFEGVEFENEYEDDEEPDLGRYGFNFAAESEPDKTWWERYQPRIWTLMEEPHSSTLAKVIAYTTLTLILVSVGIFCLESM----------------------EKFSEKYLKDLLVILEGICVVWFTLELMVRFVFCPAKCEFFKKIMNWIDFLAIVPFYVSL----GFNNNNNDIDALMIIRLI----RIFRIFKLSRHSSGLQILGHTLRASFRELLLLIFFLLIGVVLFASLIFYCEKKIPGTKFVDIPSSFWWAVVTMTTVGYGDMAPQSPSGKFIGSLCAVCGVLTIALPVPVIVNNFSLYYSHAQARLKLPKKRRR 403          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:101167947])

HSP 1 Score: 367.081 bits (941), Expect = 6.774e-121
Identity = 200/448 (44.64%), Postives = 292/448 (65.18%), Query Frame = 1
Query:  115 TMPIVNNK--RAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            T+ I+ NK     +R+NVGG +  + W  ++R   +RL +L    T + I+ +CD+Y     E FFDRHP +F +I N  + G+ +   E CA    +EL +WGI   YL  CC+  + ++KE ++EE ++    M R +  +  +     + R KLW+++E P +S  ++I+A+ SI FII+ST+ L ++TLP       QD  E             + S N     +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   17 TIDIIRNKTHSRRVRLNVGGLLHEVLWRTLERLPRTRLGKLRDCNTHDSIMEICDDYSLDGNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAENM-REREGEEFTTTCCSEKRKKLWDLLEKPSSSFAAKILAIVSILFIILSTIALSLNTLP-----ELQDTDEF-----------GQASDNPQLAHVEAVCIAWFTMEYLLRFLSSPSKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:101167947])

HSP 1 Score: 364.77 bits (935), Expect = 2.192e-120
Identity = 196/437 (44.85%), Postives = 286/437 (65.45%), Query Frame = 1
Query:  142 AFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
              +R+NVGG +  + W  ++R   +RL +L    T + I+ +CD+Y     E FFDRHP +F +I N  + G+ +   E CA    +EL +WGI   YL  CC+  + ++KE ++EE ++    M R +  +  +     + R KLW+++E P +S  ++I+A+ SI FII+ST+ L ++TLP       QD  E             + S N     +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:    3 TLVRLNVGGLLHEVLWRTLERLPRTRLGKLRDCNTHDSIMEICDDYSLDGNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAENM-REREGEEFTTTCCSEKRKKLWDLLEKPSSSFAAKILAIVSILFIILSTIALSLNTLP-----ELQDTDEF-----------GQASDNPQLAHVEAVCIAWFTMEYLLRFLSSPSKWKFFKGPLNVIDLLAILPYYVTIFLTES-NKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 421          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: ENSORLT00000035166.1 (potassium voltage-gated channel subfamily B member 2-like [Source:NCBI gene;Acc:101155143])

HSP 1 Score: 375.941 bits (964), Expect = 3.171e-120
Identity = 201/435 (46.21%), Postives = 289/435 (66.44%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +R+NVGG I  + W  + R   +RL +L    T E +L +CD+Y     E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE  +    + R K  + + +      R KLW+++E P +S+ ++I+A  SI FIIIST+ L ++TLP    V++  Q     N +L +              +E ICIAWFT+EY+LRL+S      F+K  LNIID +AI P+++TL +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYP+T +G+    +CC+ GVLVIALPIPIIV+NFSEFY+++ R EK +KR+E +E+AK  GS V +N
Sbjct:   39 VRLNVGGLIHEVLWRTLDRLPRTRLGRLRDCNTHESLLEICDDYSLPENEYFFDRHPMAFSSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETL-RDKEGEVEDQGCCPDKRQKLWDLLEKPSSSVAAKILAGISILFIIISTISLSLNTLPELQVVDEFGQ--FSDNPSLAH--------------VEAICIAWFTMEYLLRLLSAPDKWDFIKAPLNIIDLLAILPYYVTLCLTE-SNKSVMQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDSTKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYREQKRQEKAIKRREALERAKRSGSIVSIN 455          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:101167947])

HSP 1 Score: 369.777 bits (948), Expect = 1.964e-118
Identity = 200/448 (44.64%), Postives = 292/448 (65.18%), Query Frame = 1
Query:  115 TMPIVNNK--RAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            T+ I+ NK     +R+NVGG +  + W  ++R   +RL +L    T + I+ +CD+Y     E FFDRHP +F +I N  + G+ +   E CA    +EL +WGI   YL  CC+  + ++KE ++EE ++    M R +  +  +     + R KLW+++E P +S  ++I+A+ SI FII+ST+ L ++TLP       QD  E             + S N     +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF SIP +FWWA I+MTTVGYGDIYPKT +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   17 TIDIIRNKTHSRRVRLNVGGLLHEVLWRTLERLPRTRLGKLRDCNTHDSIMEICDDYSLDGNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAENM-REREGEEFTTTCCSEKRKKLWDLLEKPSSSFAAKILAIVSILFIILSTIALSLNTLP-----ELQDTDEF-----------GQASDNPQLAHVEAVCIAWFTMEYLLRFLSSPSKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 446          
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Match: si:dkey-192j17.1 (potassium voltage-gated channel subfamily B member 2 [Source:NCBI gene;Acc:101174303])

HSP 1 Score: 365.54 bits (937), Expect = 2.941e-116
Identity = 192/435 (44.14%), Postives = 284/435 (65.29%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLN 1452
            +R+NVGG    + W  + R   +RL +L    T E ++ +CD+Y     E FFDRHP +F +I N  + G+ +   E CA    +EL YWGI   YL  CC+  + ++KE ++EE  +    M   +           + R KLW+++E P +S+ ++I+A+ SI FI++ST+ L ++TLP    +++  Q+    N  L +              +E +CIAWFT+EY+LR +S      F K  LN+ID +AI P+++T+ +T+   +   + +++ RVVQ+FRI+R+LR+LKLARHS GLQSLG+TL++SY ELGLL+ F+A+G+ +FSSL++FAEKD   TKF+SIP +FWWA I+MTTVGYGDIYP+T +G+    +CC+ GVLVIALPIPIIV+NFSEFYK++ R EK +KR+E +E+AK  GS V +N
Sbjct:   38 VRLNVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLMEVCDDYSLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAESMREREGDGEFDNTCCPEKRRKLWDLLEKPSSSVAAKILAIISILFIVLSTIALSLNTLPELQVMDEFGQAN--DNPQLAH--------------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTE-SNKSVLQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMN 455          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000022140.1 (SMESG000022140.1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 328/329 (99.70%), Postives = 329/329 (100.00%), Query Frame = 1
Query:  625 MAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLNTFAQNTIGVIQPFIKGNEFGLSRTNVEPLVTWNTNDWKFMDYSSSGCENDSDL 1611
            MAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGVLVIALPIPIIVSNFSEFYKDKLR+EKTLKRKEEMEKAKNIGSFVLLNTFAQNTIGVIQPFIKGNEFGLSRTNVEPLVTWNTNDWKFMDYSSSGCENDSDL
Sbjct:    1 MAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGVLVIALPIPIIVSNFSEFYKDKLRIEKTLKRKEEMEKAKNIGSFVLLNTFAQNTIGVIQPFIKGNEFGLSRTNVEPLVTWNTNDWKFMDYSSSGCENDSDL 329          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000054120.1 (SMESG000054120.1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.290e-128
Identity = 205/436 (47.02%), Postives = 296/436 (67.89%), Query Frame = 1
Query:  136 KRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV 1443
            K   +++NVGG+   + W  ++R   +RL  L +A+T ++IL +CD+YD    E +FDRHPKSF  +  + + G  +   + C     ++L YWGI+ N +  CC + +  ++E +++E +KV++I        S   ++F + R +LW++M++P+TSI ++I AV S+ FI++S +CLV+ T      ++      I    N T + +  +++  + + IE ICI WFT EYV RL S     +FLK  +N+ID +AI P++++LI T  +      L+S+ +V+QVFRILRVLR+LKLARHS GLQ+LGYTLQKSYKELG+LV FIA+GV LFSSL+YFAEKD    KF SIP TFWWAII+MTTVGYGD+ P++ +G+   S CC+ GVLVIALPIPIIV+NF+++YKD+LR EKTLKRKE+M KAK  GS +
Sbjct:   68 KTTRVKLNVGGECHEVMWKTLKRMPFTRLGLLRKALTHDQILEICDDYDLTKNEYYFDRHPKSFLCVLTMFRTGNLHMLEDLCIVNFADDLDYWGINENLMESCCHHRYHMKRERVNDEIKKVKDINDESNQIDSFGTSRFHQFRRRLWDLMDNPQTSIAAQITAVISVLFILVSIICLVIGTTEFGGPIS----GNITSVSNSTQTKYGYENETHLLDRIETICITWFTFEYVCRLFSCPNKKNFLKSPMNMIDILAIFPYYISLIFTNYFHHLTQSLDSMRKVIQVFRILRVLRILKLARHSTGLQALGYTLQKSYKELGMLVMFIALGVLLFSSLIYFAEKDWG-GKFVSIPATFWWAIITMTTVGYGDMVPESGLGKFIGSFCCICGVLVIALPIPIIVNNFADYYKDQLRREKTLKRKEDMAKAKEQGSII 498          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000004060.1 (SMESG000004060.1)

HSP 1 Score: 383.645 bits (984), Expect = 2.927e-127
Identity = 208/443 (46.95%), Postives = 306/443 (69.07%), Query Frame = 1
Query:  148 IRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSK-SKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYS--SHEEKSQNDI-YE------IIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHN-DKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFV 1443
            +++NVGG+I  + W+ ++R  ++RL +L +A    EIL++CD+YD +  E FFDRHPKSF+ +  + ++G  +   + C     E+L+YWGI+ + + +CC++N+  RKE + EE +K+  I    K  + +   +   + ++K+WN  E P+TS ++R++AV SI+FI++S LCL ++T+    +VNK     +I N +++ S  S  +  + +I +E      +IE +CI+WFT+EYVLRL S      F K  +N ID +AI PF+ ++I    +   N + L S+ ++VQVFRILR+LRVLKLARH +GLQ+LGYTL+KSYKELGLL+ FIA+GV LFSSL+YFAEKD+  + F SIP TFWWAII+MTTVGYGD+ PK+ +G+   S CC+ GVLVIALPIPIIV+NF+EFYK+++R EK LK+KEEM K    GS +
Sbjct:   48 VKLNVGGQIHEIMWTTLKRMPHTRLGKLLQASAHCEILKICDDYDLEKNEYFFDRHPKSFDCVITMFRSGSLHMQEDMCVMSFSEDLEYWGINESLMEHCCQHNYHMRKEQMQEELKKINLICCDAKKCEDEIENSTSMRIKNKIWNTFEKPQTSTMARVLAVISITFILLSVLCLTLNTM-HQFQVNKT----LITNYSISLSNGSFRQVIKREIEFEDYPAMFVIECVCISWFTIEYVLRLCSSPNKRKFFKSLMNTIDIVAILPFYASVIFINAFNSSNVESLVSMRKIVQVFRILRILRVLKLARHFMGLQALGYTLKKSYKELGLLMMFIALGVLLFSSLMYFAEKDIDGS-FVSIPSTFWWAIITMTTVGYGDMTPKSPLGKLIGSFCCICGVLVIALPIPIIVNNFAEFYKNEIRREKALKQKEEMAKGTESGSLL 484          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000047530.1 (SMESG000047530.1)

HSP 1 Score: 380.563 bits (976), Expect = 3.163e-124
Identity = 210/487 (43.12%), Postives = 309/487 (63.45%), Query Frame = 1
Query:   67 IMVDK*HNLNGFFKKITMPIVN------NKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQDQSEIIKNKNLTYSSHEEK-------SQNDIYEIIEYICIAWFTLEYVLRLISVARPLHFLKEFLNIIDFIAIAPFFLTLIVTKVYERHN-DKLESITRVVQVFRILRVLRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEKDVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGXXXXXXXXXXXXSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLNTFAQNTIGVIQ 1485
            ++VD  H  + +  K   P +       ++   I +NVGG IF   W  +    N+RL +L R     E++ LCD Y+ +  E +FDR+  SF  I +  + G  +     C     E+L+YW I+  ++  CC   +  RKEL+ EE  K  + +      +  S    G+CR KLW I++ P TS L+++ AV S+ FI+IST+ L ++TLP   +VN  +    +   + T   H++          N   E++EY+CI+WF++EY+LR+ S    + FL E LN+ID IAI PF+++LI+ ++  +HN + L SI++VVQ+FRILRVLRVLKLARHS GLQSLGYTL++SYKELG+L+ F+A+GV LFSSL +FAEK+ +  +F SIP  FWWA I+MTTVGYGD+ PKT +G+   S CC+ GVLV+ALPIPIIV+NF+++YKD+LR EK ++R EE+E+A+  GS V +++F + +I   Q
Sbjct:  161 LLVDTKHRRDSYGNKSNYPTIEEIQSCRSRSRRITLNVGGVIFQTLWRTLDYLPNTRLGRLSRCEGHNELMDLCDGYNLENAEFYFDRNATSFGCILDFYRTGMLHMSDLTCVMTFSEDLQYWQINDVFIYSCCLSKYHHRKELMLEEIRKEAHALENKDNVEKFSTEFSGRCRKKLWYILDKPSTSRLAQVTAVVSVLFILISTIGLTINTLP-QLQVNVTETHHNLSKHSKTSEGHKQAVYTHYVLRDNPSLEMVEYVCISWFSVEYILRIWSCPSRIKFLCETLNVIDLIAILPFYISLILLEIENKHNLESLLSISKVVQIFRILRVLRVLKLARHSTGLQSLGYTLRRSYKELGMLLMFVALGVLLFSSLAFFAEKEENEIQFRSIPAAFWWAAITMTTVGYGDMAPKTPLGKVIGSFCCLCGVLVVALPIPIIVNNFADYYKDQLRKEKAVRRNEELERARRSGSIVSVSSFGRRSISEFQ 646          
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Match: SMESG000048635.1 (SMESG000048635.1)

HSP 1 Score: 360.533 bits (924), Expect = 5.000e-123
Identity = 174/190 (91.58%), Postives = 177/190 (93.16%), Query Frame = 1
Query:  118 MPIVNNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTL 687
            MPIVNNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSR      +S  II+ L   + TL
Sbjct:    1 MPIVNNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRLCDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYWGISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKCRSKLWNIMEHPETSILSR------VSITIINLLSTYMKTL 184          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNB16.298e-11844.83potassium voltage-gated channel subfamily B member... [more]
KCNB16.298e-11844.83potassium voltage-gated channel subfamily B member... [more]
KCNB28.930e-11744.83potassium voltage-gated channel subfamily B member... [more]
KCNF11.088e-8635.61potassium voltage-gated channel modifier subfamily... [more]
KCNG45.784e-8435.51potassium voltage-gated channel modifier subfamily... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exp-23.178e-7135.49pep chromosome:WBcel235:V:6141569:6143548:1 gene:W... [more]
exp-25.062e-7135.49pep chromosome:WBcel235:V:6141471:6143548:1 gene:W... [more]
exp-26.104e-7135.49pep chromosome:WBcel235:V:6139836:6143548:1 gene:W... [more]
exp-21.008e-7035.49pep chromosome:WBcel235:V:6140958:6143548:1 gene:W... [more]
kvs-41.885e-6835.01Probable voltage-gated potassium channel subunit k... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shab2.522e-12246.30gene:FBgn0262593 transcript:FBtr0305207[more]
Shab1.850e-12046.30gene:FBgn0262593 transcript:FBtr0305208[more]
Shab2.162e-12046.30gene:FBgn0262593 transcript:FBtr0305201[more]
Shab3.177e-12046.30gene:FBgn0262593 transcript:FBtr0305203[more]
Shab3.668e-12046.30gene:FBgn0262593 transcript:FBtr0305202[more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnb12.190e-11843.86potassium voltage-gated channel, Shab-related subf... [more]
kcnb13.200e-11843.86potassium voltage-gated channel, Shab-related subf... [more]
kcnb15.162e-11843.86potassium voltage-gated channel, Shab-related subf... [more]
kcnb11.897e-11743.86potassium voltage-gated channel, Shab-related subf... [more]
kcnb13.047e-11743.86potassium voltage-gated channel, Shab-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNB21.792e-11644.32potassium channel, voltage gated Shab related subf... [more]
meltf1.494e-8937.67melanotransferrin [Source:Xenbase;Acc:XB-GENE-9681... [more]
sv2b8.018e-8934.35synaptic vesicle glycoprotein 2B [Source:Xenbase;A... [more]
KCNS21.050e-8636.56potassium voltage-gated channel, modifier subfamil... [more]
KCNV23.830e-8534.01potassium channel, voltage gated modifier subfamil... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnb17.268e-11942.56potassium voltage gated channel, Shab-related subf... [more]
Kcnb17.268e-11942.56potassium voltage gated channel, Shab-related subf... [more]
Kcnb21.227e-11645.06potassium voltage gated channel, Shab-related subf... [more]
Kcnb21.227e-11645.06potassium voltage gated channel, Shab-related subf... [more]
Kcnf13.201e-8736.08potassium voltage-gated channel, subfamily F, memb... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17970|KCNAB_DROME7.589e-11946.06Potassium voltage-gated channel protein Shab OS=Dr... [more]
sp|Q03717|KCNB1_MOUSE5.084e-11842.56Potassium voltage-gated channel subfamily B member... [more]
sp|P15387|KCNB1_RAT1.564e-11744.83Potassium voltage-gated channel subfamily B member... [more]
sp|Q14721|KCNB1_HUMAN3.024e-11744.83Potassium voltage-gated channel subfamily B member... [more]
sp|O18868|KCNB1_PIG8.105e-11744.60Potassium voltage-gated channel subfamily B member... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AM041.648e-12241.86BTB domain-containing protein (Fragment) OS=Lottia... [more]
A0A1Y1LBM94.187e-12144.49BTB domain-containing protein (Fragment) OS=Photin... [more]
A0A2S1ZNL67.923e-12146.51Shab (Fragment) OS=Neoconocephalus triops OX=64272... [more]
A0A3B4AE971.082e-12046.21BTB domain-containing protein OS=Periophthalmus ma... [more]
A0A3B4AEK31.193e-12046.21BTB domain-containing protein OS=Periophthalmus ma... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnb13.528e-11844.09potassium voltage-gated channel subfamily B member... [more]
KCNB15.605e-11843.88potassium voltage-gated channel subfamily B member... [more]
kcnb22.926e-11444.98potassium voltage-gated channel subfamily B member... [more]
si:dkey-192j17.12.469e-11042.56potassium voltage-gated channel subfamily B member... [more]
kcnf1a3.427e-9235.65potassium voltage-gated channel subfamily F member... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004235.13.458e-12444.90pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
ENSPMAT00000001869.14.815e-8549.82pep scaffold:Pmarinus_7.0:GL480351:152:3521:-1 gen... [more]
ENSPMAT00000005395.18.293e-8350.18pep scaffold:Pmarinus_7.0:GL482646:8602:10978:-1 g... [more]
kcnf1b1.723e-8137.56potassium voltage-gated channel, subfamily F, memb... [more]
ENSPMAT00000011463.12.371e-7933.41pep scaffold:Pmarinus_7.0:GL479450:27175:28578:-1 ... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO478712.275e-9337.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398044.249e-7737.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK32.646e-6735.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK52.066e-6537.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427243.614e-6431.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnb16.774e-12144.64potassium voltage-gated channel subfamily B member... [more]
kcnb12.192e-12044.85potassium voltage-gated channel subfamily B member... [more]
ENSORLT00000035166.13.171e-12046.21potassium voltage-gated channel subfamily B member... [more]
kcnb11.964e-11844.64potassium voltage-gated channel subfamily B member... [more]
si:dkey-192j17.12.941e-11644.14potassium voltage-gated channel subfamily B member... [more]
back to top
BLAST of Potassium voltage-gated channel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022140.10.000e+099.70SMESG000022140.1[more]
SMESG000054120.11.290e-12847.02SMESG000054120.1[more]
SMESG000004060.12.927e-12746.95SMESG000004060.1[more]
SMESG000047530.13.163e-12443.12SMESG000047530.1[more]
SMESG000048635.15.000e-12391.58SMESG000048635.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023329 ID=SMED30023329|Name=Potassium voltage-gated channel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1715bp
TTTCATTGGATAAGAAAAATGTGTGTATATTTTAAAGTTTGAAATGTGCT
GCTTATCCCAAATCCAATTATGGTAGATAAATGACACAATTTGAATGGAT
TTTTCAAGAAAATAACAATGCCTATTGTTAATAATAAACGGGCATTTATC
AGAATCAATGTCGGTGGGAAAATCTTTCTGCTTCAATGGAGTGCAGTGCA
AAGATTTCACAATTCTAGATTGGAACAGCTTTGTCGAGCAGTGACTTTGG
AGGAAATTTTGAGATTATGTGATGAATACGATGCAAAAACTGGAGAGTGC
TTTTTTGATAGACATCCGAAATCGTTTGAAAATATTTGGAATTTATTGCA
AAATGGTAGGTTTTATTTTGACACAGAATTCTGTGCTTCTTATGTGCTAG
AGGAATTGAAATATTGGGGAATTTCCATAAACTATTTGTCTTATTGTTGT
CGATACAATTTCGACAGACGAAAAGAATTAATTGATGAAGAAAATGAAAA
AGTCCGAAACATTATGTATAGATTGAAAATAACCAAAAGTAAATCAAAGG
CAAAATTTGGTAAATGTCGTTCAAAATTATGGAATATAATGGAACATCCA
GAAACTTCAATATTATCAAGAATTATGGCCGTCACATCGATATCATTTAT
AATAATTTCTACACTTTGCTTGGTTGTCAGCACTCTTCCTGGGTCCCATA
AAGTTAACAAACAAGATCAGTCAGAAATTATCAAAAATAAAAATTTGACA
TATTCATCTCATGAAGAAAAGTCTCAAAACGACATTTACGAAATCATTGA
GTACATTTGCATAGCGTGGTTCACGTTGGAATACGTTCTGCGATTGATAT
CCGTAGCGCGGCCACTTCATTTTTTAAAAGAATTTTTAAACATTATTGAT
TTCATTGCAATTGCACCTTTTTTTCTAACATTGATTGTGACAAAAGTTTA
CGAGCGTCACAATGATAAGTTGGAGTCTATTACTCGAGTTGTGCAGGTTT
TTCGAATCTTACGAGTTCTTCGTGTTTTAAAGTTAGCTCGACATTCAGTT
GGACTTCAATCATTAGGATATACACTTCAGAAAAGCTACAAAGAATTGGG
TCTTCTAGTTAGTTTTATTGCAATTGGAGTTACTCTTTTCTCTAGTTTAC
TTTATTTTGCGGAAAAAGATGTCTCTCATACAAAGTTTTCAAGTATTCCT
CATACCTTTTGGTGGGCAATAATTAGTATGACAACCGTAGGTTATGGAGA
TATATATCCAAAAACTGCTATTGGTCAAACGTTTGCGTCGATTTGCTGCG
TAACTGGTGTCCTTGTAATAGCCTTACCAATACCAATAATTGTAAGTAAT
TTTTCCGAATTTTACAAAGATAAGTTAAGAATGGAAAAGACTTTAAAAAG
GAAGGAAGAAATGGAAAAAGCAAAGAATATTGGAAGTTTTGTTCTTTTAA
ATACTTTTGCTCAAAATACAATAGGTGTTATTCAACCTTTTATTAAAGGC
AATGAATTTGGTTTATCTCGCACAAATGTAGAGCCTCTTGTAACCTGGAA
CACAAATGACTGGAAATTCATGGACTATTCTTCATCTGGTTGTGAAAACG
ATTCTGATTTGTAAAGTATTATATTTAATAGATGATTCAAACAAAACGTA
ACTTTAAAGTGAATGGATATTTGCGCATATGTATTGAGAAACATAATTTT
TACGTGTCAACAGAG
back to top

protein sequence of SMED30023329-orf-1

>SMED30023329-orf-1 ID=SMED30023329-orf-1|Name=SMED30023329-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MPIVNNKRAFIRINVGGKIFLLQWSAVQRFHNSRLEQLCRAVTLEEILRL
CDEYDAKTGECFFDRHPKSFENIWNLLQNGRFYFDTEFCASYVLEELKYW
GISINYLSYCCRYNFDRRKELIDEENEKVRNIMYRLKITKSKSKAKFGKC
RSKLWNIMEHPETSILSRIMAVTSISFIIISTLCLVVSTLPGSHKVNKQD
QSEIIKNKNLTYSSHEEKSQNDIYEIIEYICIAWFTLEYVLRLISVARPL
HFLKEFLNIIDFIAIAPFFLTLIVTKVYERHNDKLESITRVVQVFRILRV
LRVLKLARHSVGLQSLGYTLQKSYKELGLLVSFIAIGVTLFSSLLYFAEK
DVSHTKFSSIPHTFWWAIISMTTVGYGDIYPKTAIGQTFASICCVTGVLV
IALPIPIIVSNFSEFYKDKLRMEKTLKRKEEMEKAKNIGSFVLLNTFAQN
TIGVIQPFIKGNEFGLSRTNVEPLVTWNTNDWKFMDYSSSGCENDSDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR003968K_chnl_volt-dep_Kv
IPR003971K_chnl_volt-dep_Kv9
IPR027359Volt_channel_dom_sf
IPR005821Ion_trans_dom
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ_sf
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005251delayed rectifier potassium channel activity
GO:0005267potassium channel activity
GO:0005515protein binding
GO:0032182ubiquitin-like protein binding
GO:0044325ion channel binding
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0005622intracellular
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0016328lateral plasma membrane
GO:0030054cell junction
GO:0030424axon
GO:0030425dendrite
GO:0032809neuronal cell body membrane
GO:0042383sarcolemma
GO:0042995cell projection
GO:0043005neuron projection
GO:0043204perikaryon
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0051260protein homooligomerization
GO:0001508action potential
GO:0006810transport
GO:0006887exocytosis
GO:0006904vesicle docking involved in exocytosis
GO:0007215glutamate receptor signaling pathway
GO:0010701positive regulation of norepinephrine secretion
GO:0031669cellular response to nutrient levels
GO:0033605positive regulation of catecholamine secretion
GO:0034765regulation of ion transmembrane transport
GO:0042593glucose homeostasis
GO:0045956positive regulation of calcium ion-dependent exocytosis
GO:0046676negative regulation of insulin secretion
GO:0071333cellular response to glucose stimulus
GO:0071805potassium ion transmembrane transport
GO:0072661protein targeting to plasma membrane
GO:0090314positive regulation of protein targeting to membrane
GO:0098900regulation of action potential
GO:1900454positive regulation of long term synaptic depression
GO:2000671regulation of motor neuron apoptotic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 60..79
score: 43.71
coord: 226..249
score: 39.09
coord: 252..272
score: 49.88
coord: 161..189
score: 33.52
coord: 386..412
score: 57.88
coord: 326..349
score: 55.15
coord: 357..379
score: 68.8
coord: 297..323
score: 59.22
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 310..420
e-value: 5.3E-33
score: 115.0
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 6..127
e-value: 1.8E-25
score: 91.3
NoneNo IPR availablePANTHERPTHR11537:SF63POTASSIUM VOLTAGE-GATED CHANNEL SUBFAMILY B MEMBER 1coord: 10..445
NoneNo IPR availableCDDcd18382BTB_POZ_Kv6_KCNGcoord: 11..118
e-value: 1.12712E-27
score: 104.823
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 167..414
NoneNo IPR availableTMHMMTMhelixcoord: 327..349
NoneNo IPR availableTMHMMTMhelixcoord: 256..278
NoneNo IPR availableTMHMMTMhelixcoord: 364..381
NoneNo IPR availableTMHMMTMhelixcoord: 388..410
NoneNo IPR availableTMHMMTMhelixcoord: 165..187
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 60..70
score: 65.53
coord: 326..340
score: 49.33
coord: 397..408
score: 77.43
coord: 302..310
score: 68.24
IPR003971Potassium channel, voltage dependent, Kv9PRINTSPR01494KV9CHANNELcoord: 29..45
score: 38.24
coord: 396..414
score: 56.58
coord: 14..26
score: 43.27
coord: 99..111
score: 49.04
coord: 52..65
score: 48.21
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 169..418
e-value: 1.3E-47
score: 162.1
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 138..309
e-value: 3.4E-46
score: 158.7
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 11..110
e-value: 8.8E-21
score: 74.1
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 10..445
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 10..117