Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30023326
Length (bp)1211
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30023326) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30023326) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30023326) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30023326) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023326

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023326SMESG000078594.1 dd_Smed_v4_4106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023326SMESG000078594.1 dd_Smed_v4_4106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023326SMESG000078594.1 dd_Smed_v4_4106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023326SMESG000078594.1 dd_Smed_v4_4106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023326SMESG000078594.1 dd_Smed_v4_4106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023326SMESG000078594.1 dd_Smed_v4_4106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023326SMESG000078594.1 dd_Smed_v4_4106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023326SMESG000078594.1 dd_Smed_v4_4106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023326SMESG000078594.1 Contig50117uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023326SMESG000078594.1 Contig50117newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5K4EID0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.137e-33
Identity = 91/300 (30.33%), Postives = 158/300 (52.67%), Query Frame = 3
Query:  201 VILSCEIQEL-LST-FVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGXXXXXXXXXXXXVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPI-------KPEGIKSNNLGPDF--------SPIDSKGNIIVR------GRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHGPIDIEVK-NQRERNICI-SPKTEGMYSIESEAVINCTALKMVGANEIVC--RSAESKKS----NVYVLCPGGERAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSA 1007
            VIL C+IQ + LST +  +FR  + + SE C V+  QK+ ++C     D +    YE  IK V W D G+W C Y+  +   T+++  PA  E + +  +       K   IK ++   +         + +DS  +II        G G+RTNPY+LR+G+ +++ C ++C +PR   +W   N +     +    N    N+C  SP T  M + ES   ++C+ L ++G N++ C     + K +    NVY+LC GGER   LT+GE++G+AV   + ++L+ + C++++ + +S+
Sbjct:   37 VILRCQIQGIRLSTKYAVLFRHKETVISEKCFVYQAQKFHLICEPN--DWQIAETYELHIKSVSWADRGDWSCIYAANKTKQTLEVYAPAKLEKMGVSSLTSLPVTNKESMIKDSSSPSELSSSSSLATAGLDSALSIIGTPPSQYIGLGTRTNPYDLRSGLGIQLTCATTCGHPRANITWLVMNETMTKAIMPTNPNIIHENVCSNSPNTIDMTTTESNLHVHCSQLDIIGLNQVQCSVNGPQYKDTLLTRNVYILCAGGERPMHLTSGEVVGIAVGSALGLILVFIGCIILRNNGKSS 334          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4Z2DIS9 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_000503 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.564e-32
Identity = 90/299 (30.10%), Postives = 149/299 (49.83%), Query Frame = 3
Query:  201 VILSCEIQ--ELLSTFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGXXXXXXXXXXXXVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPI------KPEGIKSNNLGPDFSP--------IDSKGNIIVR------GRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHG-PIDIEVKNQRERNICI-SPKTEGMYSIESEAVINCTALKMVGANEIVCRSAESK------KSNVYVLCPGGERAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSA 1007
            VIL C++Q       +  +F++   + SE C V++ QKY +VC     D ++   YE  IK V W D G+W C Y+      T+++  PA  E + +  +      K   +K +   P  S         +DS  +II        G G+RTNPY+LR G+ ++  C ++C +PR   +W   N +    I   + N+   + C  S  T  M    S   I+CT L ++G N++ C     +        NVYVLCPGGER   LT+GE++G+AV   + ++L+ + C++++ + +S+
Sbjct:   42 VILKCQVQGIRFPMQYAVLFKRKDKLISEKCHVYEGQKYHLVCEPN--DWQRAETYELHIKSVSWADRGDWLCIYAANMTRQTLEVYAPAKLEKMGVSSLTLPMTNKESILKESGSFPGLSSTSSLAAAGMDSALSIIGTPPSQHIGLGTRTNPYDLRPGLGIQFTCETTCGHPRANITWLVINETMTKAIMPTISNKINYDYCNNSLNTINMTKTTSTLQIHCTQLDIIGLNQVQCSVNGPQYKDILLTRNVYVLCPGGERPVYLTSGEVVGIAVGSALGLILVFIGCIILRNNGKSS 338          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4S2LBY7 (Ig-like domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008244 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 5.938e-32
Identity = 86/300 (28.67%), Postives = 146/300 (48.67%), Query Frame = 3
Query:  201 VILSCEIQEL---LSTFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGXXXXXXXXXXXXVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIE--PIKPEGIKSNNLGP-DFSPI--------------DSKGNIIVR--GRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHGPIDIEVKNQ---RERNICISPKTEGMYSIESEAVINCTALKMVGANEIVCRSA------ESKKSNVYVLCPGGERAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSA 1007
            VIL+C+++     L   V   RKD  + SE C+ +   KY + C     +  +   Y+  I  V W D G+W+C Y+       + +  PA  + + +   P  P   +++ + P D SP+               + G    +  G G+RTNPY+LR G+ L++ C ++C YP    SW   N +   +   +      R     +SP T+ M +  S   +NC  L ++G NE+ C          +   +VYVLCPGGER  +LT GE++G+AV   IA++L+ + C++++ S++ +
Sbjct:   39 VILTCQVKGFKRPLDYAVLFKRKDVGI-SEKCQTYQKNKYHLECEPN--NWLQATTYKLYINSVSWADRGDWFCVYAANLTRQHLVVHAPAELKKMAVTSLPFNPLKSENDRITPVDGSPVLAKLSKSSSSSAVSGAPGQPPAQHVGLGTRTNPYDLRPGLGLQLTCETTCGYPEANISWLLLNETASRVGTTIAGPNRIRSETCDLSPSTQDMTTTTSTLNVNCVELGLIGLNEVQCAVTGRQYIDHTPTRHVYVLCPGGERPLQLTNGEVVGIAVGAAIALILLFLGCIILRASRKDS 335          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5J4NCB1 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0012677 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.606e-30
Identity = 82/288 (28.47%), Postives = 139/288 (48.26%), Query Frame = 3
Query:  240 FVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGXXXXXXXXXXXXVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIE------------PIKPEGIKSNNLG---------PDFSPIDSKGNIIVR--GRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHGPIDIEVK--NQRERNIC-ISPKTEGMYSIESEAVINCTALKMVGANEIVCRSAESKKSN------VYVLCPGGERAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSA 1007
            +  +F++     SE C+ +   KY++ C     D +    Y   I  V W D G+W+C Y+       + +  PA  + + +             P    G ++N++G           F      G+++ +  G G+RTNPY+LR G+ L++ C ++C YP    SW   N +           NQ +  +C  S  T  M + +S   +NC  L ++G NE+ C     + SN      VYVLCPGGER  ELT+GE++G+AV   IA++L+ + C++++ S++ +
Sbjct:   10 YSVLFKRADVSISEKCQAYSKSKYQLTCDPD--DWRWATTYTLHINSVSWSDRGDWFCVYAANLTKQHLVVYAPAELKKMGVTNWDFKSSSQQQQPPSSVGREANDVGVSSNLPNGVATFFDNGPSGSLLAQHVGLGTRTNPYDLRPGLGLQLTCETTCGYPDGNISWLLLNKTSSKPGTTTTGPNQIDSFMCNRSASTAEMTTTKSTLNVNCVQLGLIGLNEVQCAVTGRQYSNHTPTRHVYVLCPGGERPLELTSGEVVGIAVGAAIALILVFIGCVILRNSRKDS 295          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A3P6GWC4 (Ig-like domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5585 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.027e-29
Identity = 88/305 (28.85%), Postives = 145/305 (47.54%), Query Frame = 3
Query:  201 VILSCEIQELL---STFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGXXXXXX-XXXXXXVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPIK----------PEGIKSNNLGPDFSPIDSKGNIIVRGRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHG-PIDIEVKNQRERNICIS-PKTEGMYSIESEAVINCTALKMVGANEIVCR---SAESKKS-NVYVLCPGGERAWELTTGEIIGLAVSVGIAILLICVLCLMVK-RSKRSAYRTPPDVSTNTYSSG 1052
            V L C +   L   ++   +F  +  M++E C+ +   +YE+ C     +         F IK V W D G+W C  S     V +++  P     + +E +           P G +S++L P  SP          G G+RTNPY+LR+G+AL +KC + C YP  V  W+  N++   P  +   ++     C   P+T  M +  +   + C   +++G N++ C    SAE   S ++Y+LCPGGE    LT+GEI+GL V+      L    C++++ RSK  A      + +N++S G
Sbjct:   14 VTLRCTVSNRLVHQTSLSVLFLSNGTMQAENCKAYKPAQYEVTCETGGQNSDSATHTYLFHIKSVNWTDRGKWTCLLSGSTSEVNLEVHAPPKMAPIEVERVSVPSSGDAHRPPTGAESDSLVPANSPHAPP----FYGLGTRTNPYDLRSGLALYLKCQTECGYPEAVPQWTVNNVTDSQPRKLPSTHRVSTYACDGKPETREMSTSTTFLNVCCEHHQLIGINKLQCSITGSAEPTASRHIYLLCPGGEVPMTLTSGEIVGLGVAAVALFSLFVTGCVLLRGRSKEGA------IISNSHSRG 308          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000078594.1 (SMESG000078594.1)

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 316/317 (99.68%), Postives = 316/317 (99.68%), Query Frame = 3
Query:  111 ANKLSCGQENFAIREIKKIPDQDYYEQNTTVILSCEIQELLSTFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGXXXXXXXXXXXXVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPIKPEGIKSNNLGPDFSPIDSKGNIIVRGRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHGPIDIEVKNQRERNICISPKTEGMYSIESEAVINCTALKMVGANEIVCRSAESKKSNVYVLCPGGERAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSAYRTPPDVSTNTYSSGVKV 1061
            ANKLSCGQENFAIREIKKIPDQDYYEQNTTVILSCEIQELLSTFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGKKFIKYEFKIKKVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPIKPEGIKSNNLGPDFSPIDSKGNIIVRGRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHGPIDIEVKNQRERNICI PKTEGMYSIESEAVINCTALKMVGANEIVCRSAESKKSNVYVLCPGGERAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSAYRTPPDVSTNTYSSGVKV
Sbjct:   14 ANKLSCGQENFAIREIKKIPDQDYYEQNTTVILSCEIQELLSTFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGKKFIKYEFKIKKVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPIKPEGIKSNNLGPDFSPIDSKGNIIVRGRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHGPIDIEVKNQRERNICILPKTEGMYSIESEAVINCTALKMVGANEIVCRSAESKKSNVYVLCPGGERAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSAYRTPPDVSTNTYSSGVKV 330          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000056440.1 (SMESG000056440.1)

HSP 1 Score: 132.88 bits (333), Expect = 2.541e-35
Identity = 89/291 (30.58%), Postives = 156/291 (53.61%), Query Frame = 3
Query:  168 PDQDYYEQNTTVILSCEIQELLSTFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGXXXXXXXXXXXXVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPIKPEGIKSNNLGPDFSPIDSKGNIIVRGRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHGPIDIEVK-NQRERNICISPKTEGMYSIESEAVINCTALKMVGANEIVCRSAESKKS-------NVYVLCPGGE-RAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSAYR 1013
            P+    + N  ++L+C IQ +  + +   RKD ++ SE C+V++  +Y + C +         +Y+F+IKK+ W+D G+W C    Y  S+ +DI VP++  +++IEPI  + + S+NLGP+  P   + +II++GRG + NPY+LR  I++ + C S CSYP +   + + N S+   ++  K +  E N C   + +   S  S    NC A K+ G   + C +   K S        +Y+LCP    + W++T GE+I   +   +  +L+  L LM+ R K   ++
Sbjct:   29 PNSIPIKLNGNIVLTCIIQNISKSPLLFSRKD-DLVSEKCKVYNKSQYGITCKNGT-------EYKFEIKKMSWIDKGKWKCMVGLYSTSIMLDIYVPSNV-SISIEPISKK-VFSSNLGPESIPSSHENSIILKGRGQKLNPYDLRKNISVNLICKSDCSYPVVNQVYIFKNFSNFSKELSKKPDNTEINTCDIEQNKT--STISRLKFNCQAFKLTGLINLTCSTFIDKHSILNISQRTIYILCPTEPIQWWKMTNGEMINTVIGCFMGFVLLMFLFLMICRWKSYKHK 307          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000056440.1 (SMESG000056440.1)

HSP 1 Score: 116.701 bits (291), Expect = 2.942e-30
Identity = 69/220 (31.36%), Postives = 117/220 (53.18%), Query Frame = 3
Query:  381 VEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPIKPEGIKSNNLGPDFSPIDSKGNIIVRGRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHGPIDIEVK-NQRERNICISPKTEGMYSIESEAVINCTALKMVGANEIVCRSAESKKS-------NVYVLCPGGE-RAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSAYR 1013
            + W+D G+W C    Y  S+ +DI VP++  +++IEPI  + + S+NLGP+  P   + +II++GRG + NPY+LR  I++ + C S CSYP +   + + N S+   ++  K +  E N C   + +   S  S    NC A K+ G   + C +   K S        +Y+LCP    + W++T GE+I   +   +  +L+  L LM+ R K   ++
Sbjct:    1 MSWIDKGKWKCMVGLYSTSIMLDIYVPSNV-SISIEPISKK-VFSSNLGPESIPSSHENSIILKGRGQKLNPYDLRKNISVNLICKSDCSYPVVNQVYIFKNFSNFSKELSKKPDNTEINTCDIEQNKT--STISRLKFNCQAFKLTGLINLTCSTFIDKHSILNISQRTIYILCPTEPIQWWKMTNGEMINTVIGCFMGFVLLMFLFLMICRWKSYKHK 216          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000003800.1 (SMESG000003800.1)

HSP 1 Score: 118.242 bits (295), Expect = 4.103e-30
Identity = 88/280 (31.43%), Postives = 140/280 (50.00%), Query Frame = 3
Query:  183 YEQNTTVILSCEIQELLSTFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGXXXXXXXXXXXXVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPIKPEGIKSNNLGPDFSPIDSKGNI--IVRGRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHSWSYANMSHGPIDIEVKNQRERNICISPKTEGMYSIESEAVINCTALKMVGANEIVCRSAESKKS-NVYVLCPGGERAWELTTGEIIGLAVSVGIAILLICVLCLMVKRSKRSAYR 1013
            Y    +V + C +Q +    V    K+KN+   G        Y      K    K+   Y  +IK++ W  +GEW C      + + I I VP +     +EPIKPE ++        S ++   ++  I+ G+G +TNP++L     +K+ C + CS P+  HSW Y N++     I   +    +  +S   +G Y  ES  +I C   +MVG+NE+ C+  +   S +VYVLCPGG R W LT GEIIGL+++  +A L++ VL  M  +   ++YR
Sbjct:   34 YRIGESVKIKCIVQNVKDLSVLFRHKEKNIAENG------HSYNKEFIVKQYPDKQSTIYTLEIKELRWAHNGEWDCVQGLSTRKLVISIIVPGT-----VEPIKPE-LELPATDKRRSQMELSNHLPQILLGKGIKTNPFDLTRDARIKLYCKTGCSNPQSHHSWMYNNITMSKRIINATSVSLSSCSLSLAEDG-YFTESVILIGCREFQMVGSNEVTCKINDYNDSQSVYVLCPGGHRPWTLTNGEIIGLSIAFALAALML-VLFFMSAKKIINSYR 299          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000011613.1 (SMESG000011613.1)

HSP 1 Score: 66.2402 bits (160), Expect = 8.240e-12
Identity = 80/319 (25.08%), Postives = 144/319 (45.14%), Query Frame = 3
Query:  153 EIKKIPDQDYYEQNTTVILSC--EIQELLSTFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGXXXXXXXXXXXXVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPIKPEGIKSNNLGPDFSPIDSKGNI-IVRGRGSRTNPYNL--RTGIALKIKCYSSCSYPRIVHSWSYA------NMSHGPIDIEVKNQRERNICISPKTEGMYSIESEAVINCTALKMVGANEIVCRSAESKK-----SNVYVLCPGGER--------------AWELTTGEIIGLAVSVGI-AILLICVLCLMVK-RSKRSAYR 1013
            EI +IP +D+     +V++SC  +IQ L      MFR++  + S  C  +  +K+ M C +K+     +      I+ V W++ GE+ C    +   + + + VP+    L        G  S N  P    ++S+  I  ++G+GS+ NPY L  R   ++ + C S+ S+P     W+         MS      E+K+   + +   P+ +G+Y   S   ++C   K     ++ C +++ K+     ++ Y LCP  E                 ++TTGEI+ + +   I +ILLI  + L+ + RSK    R
Sbjct:   25 EIFQIPKKDFVTVKESVLISCRGKIQSLDGF---MFRRNGIIISLNCSQWGPEKFRMSC-NKI---GSWNYMNLTIESVSWMNRGEYICVNDPHVVKLDLPVSVPSVLSIL-------VGEISYNTKPAI--VNSQYQIEKLKGKGSKENPYKLLSRDIKSVNVNCSSNFSFPPPKIQWTVTQIFPNDQMSGAQPFNEIKS--SKFLTDEPENKGLYLTSSVLQLDCQQQKWHSLLKVQCYNSDRKERVENSASAYFLCPDSESYIKANSSRVTTKKVLGKITTGEIVNIIIGCLIGSILLISGIVLICRHRSKDDLDR 325          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4EID01.137e-3330.33Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2DIS91.564e-3230.10Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A4S2LBY75.938e-3228.67Ig-like domain-containing protein OS=Opisthorchis ... [more]
A0A5J4NCB18.606e-3028.47Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A3P6GWC41.027e-2928.85Ig-like domain-containing protein OS=Mesocestoides... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078594.10.000e+099.68SMESG000078594.1[more]
SMESG000056440.12.541e-3530.58SMESG000056440.1[more]
SMESG000056440.12.942e-3031.36SMESG000056440.1[more]
SMESG000003800.14.103e-3031.43SMESG000003800.1[more]
SMESG000011613.18.240e-1225.08SMESG000011613.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023326 ID=SMED30023326|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1211bp
CAATAATTCCATCTTAGTTATTTCGATGATTATTTAATTCTTGTGTTACA
TTTAGTGATATATTATTAATAATGTTACTCTTAATAAATTATGTTTTTTT
ATTGGTTTTAGCCAACAAATTGTCATGTGGTCAGGAAAATTTTGCCATCA
GAGAGATTAAAAAGATTCCAGATCAAGATTATTATGAACAAAACACAACT
GTGATATTGTCATGCGAAATACAAGAATTGCTTAGTACATTTGTTACCAT
GTTTAGAAAAGATAAAAATATGAGATCTGAGGGTTGCCGAGTATTTGATA
CTCAAAAATACGAAATGGTTTGTTCTGACAAAGTCATAGACGGGAAGAAA
TTTATAAAATATGAATTTAAAATCAAAAAAGTCGAATGGTTAGATCATGG
AGAATGGTATTGCTTTTATTCTAATTACCGAAAATCAGTAACGATAGATA
TCAAAGTGCCTGCTTCATTTGAAGCCCTCAATATCGAGCCAATTAAACCA
GAAGGAATTAAAAGCAATAATTTAGGGCCTGATTTTTCCCCAATTGATTC
TAAAGGAAATATAATTGTCAGAGGTCGCGGATCAAGAACTAATCCTTATA
ATTTACGCACCGGAATTGCCTTAAAGATAAAATGTTATTCATCCTGCAGC
TACCCGCGTATAGTTCACTCATGGAGCTATGCAAATATGTCTCACGGACC
GATCGATATCGAAGTGAAAAATCAAAGAGAGCGCAACATATGCATCTCAC
CGAAAACCGAAGGAATGTATTCAATAGAAAGTGAAGCCGTTATCAATTGT
ACGGCACTGAAAATGGTCGGTGCAAACGAAATCGTTTGTCGGTCAGCAGA
ATCCAAAAAATCAAATGTCTATGTTCTTTGTCCAGGTGGCGAGAGGGCAT
GGGAGCTGACGACCGGTGAGATAATCGGTCTGGCGGTGTCAGTGGGCATC
GCAATCCTGTTGATCTGCGTGCTATGTCTGATGGTGAAGCGCTCGAAACG
GTCAGCTTATCGCACCCCTCCAGATGTCAGCACAAACACTTACAGCTCCG
GTGTCAAGGTCTGACGCCGATTCCTCATTCCTGTCCGGGTTGCGATGTTC
TCTATTTATTAGTTACTCAATCCTATTTGCAATTTTATTTCTCTTCTAGA
TTTTCTATTTGTGATCATTTTTTATCATTGAAATAATAATAATAATAATA
ATCAAAATTTC
back to top

protein sequence of SMED30023326-orf-1

>SMED30023326-orf-1 ID=SMED30023326-orf-1|Name=SMED30023326-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=331bp
MLLLINYVFLLVLANKLSCGQENFAIREIKKIPDQDYYEQNTTVILSCEI
QELLSTFVTMFRKDKNMRSEGCRVFDTQKYEMVCSDKVIDGKKFIKYEFK
IKKVEWLDHGEWYCFYSNYRKSVTIDIKVPASFEALNIEPIKPEGIKSNN
LGPDFSPIDSKGNIIVRGRGSRTNPYNLRTGIALKIKCYSSCSYPRIVHS
WSYANMSHGPIDIEVKNQRERNICISPKTEGMYSIESEAVINCTALKMVG
ANEIVCRSAESKKSNVYVLCPGGERAWELTTGEIIGLAVSVGIAILLICV
LCLMVKRSKRSAYRTPPDVSTNTYSSGVKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.714
NoneNo IPR availableTMHMMTMhelixcoord: 283..305
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 34..128