Cathepsin L

Overview
NameCathepsin L
Smed IDSMED30023322
Uniprot Best hitCathepsin L OS=Sarcophaga peregrina PE=1 SV=1 (E=4.80431e-60)
Length (bp)613
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cathepsin L (SMED30023322) t-SNE clustered cells

Violin plots show distribution of expression levels for Cathepsin L (SMED30023322) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSV (cathepsin V [Source:HGNC Symbol;Acc:HGNC:2538])

HSP 1 Score: 185.267 bits (469), Expect = 4.702e-56
Identity = 93/200 (46.50%), Postives = 131/200 (65.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG L+SLSEQ +VDC     +  CNGGF+     Y+K+NGG++SE+ YPYV+      ++ C ++ E  V  DTGF  + PG E+AL +A+ T+GPIS+A  A       YK+GIY +  C+   ++H VL+VGYG +    + + YW++KNSWGP WG NGY ++ ++K N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVA-----VDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV 334          
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSV (cathepsin V [Source:HGNC Symbol;Acc:HGNC:2538])

HSP 1 Score: 185.267 bits (469), Expect = 4.702e-56
Identity = 93/200 (46.50%), Postives = 131/200 (65.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG L+SLSEQ +VDC     +  CNGGF+     Y+K+NGG++SE+ YPYV+      ++ C ++ E  V  DTGF  + PG E+AL +A+ T+GPIS+A  A       YK+GIY +  C+   ++H VL+VGYG +    + + YW++KNSWGP WG NGY ++ ++K N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVA-----VDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV 334          
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSL (cathepsin L [Source:HGNC Symbol;Acc:HGNC:2537])

HSP 1 Score: 165.236 bits (417), Expect = 1.924e-48
Identity = 89/200 (44.50%), Postives = 122/200 (61.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYG--TDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG LISLSEQ +VDC     +  CNGG +     Y++ NGG++SE+ YPY     +   + C +  +  V  DTGFV +P   E+AL +A+ T+GPIS+A  A       YK GIY +  C+   ++H VL+VGYG  + E     YW++KNSWG  WG  GY +M ++ +N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPY-----EATEESCKYNPKYSVANDTGFVDIPK-QEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV 333          
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSL (cathepsin L [Source:HGNC Symbol;Acc:HGNC:2537])

HSP 1 Score: 165.236 bits (417), Expect = 1.924e-48
Identity = 89/200 (44.50%), Postives = 122/200 (61.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYG--TDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG LISLSEQ +VDC     +  CNGG +     Y++ NGG++SE+ YPY     +   + C +  +  V  DTGFV +P   E+AL +A+ T+GPIS+A  A       YK GIY +  C+   ++H VL+VGYG  + E     YW++KNSWG  WG  GY +M ++ +N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPY-----EATEESCKYNPKYSVANDTGFVDIPK-QEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV 333          
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSK (cathepsin K [Source:HGNC Symbol;Acc:HGNC:2536])

HSP 1 Score: 161.384 bits (407), Expect = 5.898e-47
Identity = 84/194 (43.30%), Postives = 116/194 (59.79%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYP 578
            AFS+ GALEGQL +KTG L++LS Q +VDC S +  C GG++T+   Y+++N GI+SE  YPYV        + C +          G+  +P G+E+AL+ A+  +GP+S+A  AS      Y  G+Y+D  C    +NHAVL VGYG   + G  +WIIKNSWG  WG  GY  M RNK N C +A  + +P
Sbjct:  141 AFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVG-----QEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGI--QKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFP 327          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: cpl-1 (CathePsin L family [Source:RefSeq peptide;Acc:NP_001256718])

HSP 1 Score: 191.43 bits (485), Expect = 1.595e-60
Identity = 98/198 (49.49%), Postives = 126/198 (63.64%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ  RK G L+SLSEQ +VDC +   ++ CNGG +     YI+ N G+++E+ YPY     K  + KC+F K+ +   D G+V  P GDEE L+ A+ T GPISIA  A       YK G+Y+D  C+   ++H VLLVGYGTD E G  YWI+KNSWG  WGE GY R+ RN+ N C +A  + YPLV
Sbjct:    7 AFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPY-----KGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHG-DYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 198          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: cpl-1 (CathePsin L family [Source:RefSeq peptide;Acc:NP_001256718])

HSP 1 Score: 191.43 bits (485), Expect = 1.595e-60
Identity = 98/198 (49.49%), Postives = 126/198 (63.64%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ  RK G L+SLSEQ +VDC +   ++ CNGG +     YI+ N G+++E+ YPY     K  + KC+F K+ +   D G+V  P GDEE L+ A+ T GPISIA  A       YK G+Y+D  C+   ++H VLLVGYGTD E G  YWI+KNSWG  WGE GY R+ RN+ N C +A  + YPLV
Sbjct:    7 AFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPY-----KGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHG-DYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 198          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: cpl-1 (CathePsin L family [Source:RefSeq peptide;Acc:NP_001256718])

HSP 1 Score: 192.2 bits (487), Expect = 4.073e-59
Identity = 98/198 (49.49%), Postives = 126/198 (63.64%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ  RK G L+SLSEQ +VDC +   ++ CNGG +     YI+ N G+++E+ YPY     K  + KC+F K+ +   D G+V  P GDEE L+ A+ T GPISIA  A       YK G+Y+D  C+   ++H VLLVGYGTD E G  YWI+KNSWG  WGE GY R+ RN+ N C +A  + YPLV
Sbjct:  146 AFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPY-----KGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHG-DYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 337          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: tag-196 (pep:known chromosome:WBcel235:V:8594914:8597563:1 gene:WBGene00007055 transcript:F41E6.6.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-196)

HSP 1 Score: 158.303 bits (399), Expect = 4.304e-45
Identity = 88/196 (44.90%), Postives = 117/196 (59.69%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDY--MCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFSTTG +EG  F     L+SLSEQ++VDCDS D  CNGG  ++    I + GG+E E  YPY  GR     + C+  ++ I     G V L P DE  +++ LVT GPISI  +A+  L  Y++G+ H +   C    +NH VL+VGYG D     PYWI+KNSWGP WGE GYF++ R KN+C +   +   LV
Sbjct:  290 AFSTTGNVEGAWFIAKNKLVSLSEQELVDCDSMDQGCNGGLPSNAYKEIIRMGGLEPEDAYPY-DGR----GETCHLVRKDIAVYINGSVEL-PHDEVEMQKWLVTKGPISIGLNANT-LQFYRHGVVHPFKIFCEPFMLNHGVLIVGYGKD--GRKPYWIVKNSWGPNWGEAGYFKLYRGKNVCGVQEMATSALV 476          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: tag-196 (pep:known chromosome:WBcel235:V:8594914:8597500:1 gene:WBGene00007055 transcript:F41E6.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-196)

HSP 1 Score: 158.303 bits (399), Expect = 4.304e-45
Identity = 88/196 (44.90%), Postives = 117/196 (59.69%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDY--MCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFSTTG +EG  F     L+SLSEQ++VDCDS D  CNGG  ++    I + GG+E E  YPY  GR     + C+  ++ I     G V L P DE  +++ LVT GPISI  +A+  L  Y++G+ H +   C    +NH VL+VGYG D     PYWI+KNSWGP WGE GYF++ R KN+C +   +   LV
Sbjct:  290 AFSTTGNVEGAWFIAKNKLVSLSEQELVDCDSMDQGCNGGLPSNAYKEIIRMGGLEPEDAYPY-DGR----GETCHLVRKDIAVYINGSVEL-PHDEVEMQKWLVTKGPISIGLNANT-LQFYRHGVVHPFKIFCEPFMLNHGVLIVGYGKD--GRKPYWIVKNSWGPNWGEAGYFKLYRGKNVCGVQEMATSALV 476          
BLAST of Cathepsin L vs. Ensembl Fly
Match: Cp1 (Cysteine proteinase-1 [Source:FlyBase gene name;Acc:FBgn0013770])

HSP 1 Score: 191.045 bits (484), Expect = 1.540e-59
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:   58 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 249          
BLAST of Cathepsin L vs. Ensembl Fly
Match: Cp1 (Cysteine proteinase-1 [Source:FlyBase gene name;Acc:FBgn0013770])

HSP 1 Score: 191.43 bits (485), Expect = 1.084e-58
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:  150 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 341          
BLAST of Cathepsin L vs. Ensembl Fly
Match: Cp1 (Cysteine proteinase-1 [Source:FlyBase gene name;Acc:FBgn0013770])

HSP 1 Score: 191.045 bits (484), Expect = 1.508e-58
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:  147 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 338          
BLAST of Cathepsin L vs. Ensembl Fly
Match: Cp1 (Cysteine proteinase-1 [Source:FlyBase gene name;Acc:FBgn0013770])

HSP 1 Score: 191.815 bits (486), Expect = 1.986e-58
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:  180 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 371          
BLAST of Cathepsin L vs. Ensembl Fly
Match: CG5367 (pep:known chromosome:BDGP6:2L:10354743:10356597:-1 gene:FBgn0032228 transcript:FBtr0080055 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG5367)

HSP 1 Score: 163.31 bits (412), Expect = 7.272e-48
Identity = 82/197 (41.62%), Postives = 124/197 (62.94%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASP-LLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFS   ++ GQ+F++TG ++SLS+QQIVDC     +  C GG + +TL+Y++  GGI  +QDYPYV+ + K     C F  +  V   T +  LP  DE+A++ A+  IGP++I+ +ASP     Y +GIY D +C+   +NHA++++G+G D      YWI+KN WG  WGENGY R+ +  NMC +A  + Y +V
Sbjct:  153 AFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGK-----CQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGFGKD------YWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYAIV 338          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: si:dkey-239j18.3 (si:dkey-239j18.3 [Source:ZFIN;Acc:ZDB-GENE-121214-39])

HSP 1 Score: 178.718 bits (452), Expect = 9.644e-54
Identity = 93/200 (46.50%), Postives = 129/200 (64.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A  + YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPSGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATKASYPLM 336          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: zgc:174153 (zgc:174153 [Source:ZFIN;Acc:ZDB-GENE-080215-7])

HSP 1 Score: 178.333 bits (451), Expect = 1.193e-53
Identity = 93/200 (46.50%), Postives = 129/200 (64.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A  + YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPSGNEPALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATKASYPLM 336          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: zgc:174153 (zgc:174153 [Source:ZFIN;Acc:ZDB-GENE-080215-7])

HSP 1 Score: 178.333 bits (451), Expect = 1.193e-53
Identity = 93/200 (46.50%), Postives = 129/200 (64.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A  + YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPSGNEPALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATKASYPLM 336          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: ctslb (cathepsin Lb [Source:ZFIN;Acc:ZDB-GENE-980526-285])

HSP 1 Score: 178.333 bits (451), Expect = 1.245e-53
Identity = 93/200 (46.50%), Postives = 130/200 (65.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A ++ YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPRGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATSASYPLM 336          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: si:dkey-269i1.4 (si:dkey-269i1.4 [Source:ZFIN;Acc:ZDB-GENE-121214-37])

HSP 1 Score: 178.333 bits (451), Expect = 1.279e-53
Identity = 93/200 (46.50%), Postives = 129/200 (64.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A  + YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPHGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPKGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGIATMASYPLI 336          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: CTSK (cathepsin K [Source:HGNC Symbol;Acc:HGNC:2536])

HSP 1 Score: 178.718 bits (452), Expect = 3.829e-54
Identity = 87/196 (44.39%), Postives = 127/196 (64.80%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS+ GALEGQL +KTG L+SLS Q +VDCD+ +Y C GG++T+   Y++ NGGI+S+ +YPYV       ++ C++       T  G+  +P G E+AL+ A+  +GP+S++  AS P    YK G+Y+D  C    +NHAVL+VGYG   E G  +WIIKNSWG  WG+ GY  + R+ KN C +A  + +P++
Sbjct:  146 AFSSVGALEGQLMKKTGKLVSLSPQNLVDCDTDNYGCEGGYMTNAFGYVRDNGGIDSDAEYPYVG-----QDEGCHYNPADKAATCKGYKEIPVGSEKALKRAVANVGPVSVSIDASLPSFQFYKKGVYYDSSCNPDAVNHAVLVVGYGN--EKGIKHWIIKNSWGDWWGKKGYVLLARDKKNACGIASLASFPVM 334          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: CTSK (cathepsin K [Source:HGNC Symbol;Acc:HGNC:2536])

HSP 1 Score: 178.333 bits (451), Expect = 4.946e-54
Identity = 87/196 (44.39%), Postives = 127/196 (64.80%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS+ GALEGQL +KTG L+SLS Q +VDCD+ +Y C GG++T+   Y++ NGGI+S+ +YPYV       ++ C++       T  G+  +P G E+AL+ A+  +GP+S++  AS P    YK G+Y+D  C    +NHAVL+VGYG   E G  +WIIKNSWG  WG+ GY  + R+ KN C +A  + +P++
Sbjct:  139 AFSSVGALEGQLMKKTGKLVSLSPQNLVDCDTDNYGCEGGYMTNAFGYVRDNGGIDSDAEYPYVG-----QDEGCHYNPADKAATCKGYKEIPVGSEKALKRAVANVGPVSVSIDASLPSFQFYKKGVYYDSSCNPDAVNHAVLVVGYGN--EKGIKHWIIKNSWGDWWGKKGYVLLARDKKNACGIASLASFPVM 327          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: ctsv (cathepsin V [Source:Xenbase;Acc:XB-GENE-966214])

HSP 1 Score: 170.629 bits (431), Expect = 6.476e-51
Identity = 88/200 (44.00%), Postives = 124/200 (62.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYG--TDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTGALEGQ +R TG +ISLSEQ +VDC     +  CNGG +     Y+K NGGI+SE  YPY    T K +++C++        DTGFV +  G E+ L  A+ ++GP+S+A  A       YK+GIY++  C+   ++H VL+VGYG   ++E G  YWI+KNSW   WG +GY  + +++ N C +A  + YPLV
Sbjct:  141 AFSTTGALEGQHYRNTGKMISLSEQNLVDCSRAQGNQGCNGGLMDQAFQYVKDNGGIDSEDSYPY----TAKDDQECHYDPNYNSANDTGFVDVTSGSEKDLMNAVASVGPVSVAVDAGHQSFQFYKSGIYYEPECSSEDLDHGVLVVGYGFEGEDEDGKKYWIVKNSWSEKWGNDGYIYIAKDRHNHCGIATAASYPLV 336          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: ENSXETT00000019552.3 (cathepsin K-like [Source:Xenbase;Acc:XB-GENE-986812])

HSP 1 Score: 162.54 bits (410), Expect = 9.265e-48
Identity = 87/196 (44.39%), Postives = 115/196 (58.67%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFST GALEGQL +KTG L+ +S Q +VDC   ++ C GG++T    Y+K+N GI+SE+ YPYV       ++KC +          GF  +  G E AL++A+  +GPIS+   A       YK GIY+D  C    INHAVL VGYG  ++    YWIIKNSWG  WG  GY  M R K N C +A  + YP++
Sbjct:  151 AFSTVGALEGQLMKKTGKLVGISPQNLVDCVKDNFGCGGGYMTTAFKYVKKNKGIDSEEAYPYVG-----MDQKCKYNVSGRAAEIKGFKEVKKGSETALKKAVGLVGPISVGIDAGLDTFFLYKKGIYYDKSCDGDSINHAVLAVGYGKQKKG--KYWIIKNSWGEDWGNKGYILMAREKGNACGIANLASYPVM 339          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: ctss (cathepsin S [Source:Xenbase;Acc:XB-GENE-953011])

HSP 1 Score: 150.599 bits (379), Expect = 2.052e-43
Identity = 83/198 (41.92%), Postives = 118/198 (59.60%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS  GALEGQL  KTG L+SLS Q +VDC S   +  C GGF+T    Y+  N GI+S+  YPY        ++KC++       T   +  + PG E+ L++AL +IGPIS+A   + P    Y++G+Y D  C+   +NH VL VGYG    +G  +W++KNSWG  +G+ GY R+ RNK N+C +A  + YP +
Sbjct:  144 AFSAVGALEGQLMLKTGKLVSLSPQNLVDCSSKYGNKGCGGGFMTQAFQYVIDNKGIDSDSYYPY-----HAMDEKCHYDPTGKASTCAKYTEIVPGTEDNLKQALGSIGPISVAIDGTRPSFFLYRSGVYSDPTCSH-EVNHGVLAVGYGN--LNGQDFWLLKNSWGTKYGDQGYVRIARNKGNLCGVASYTCYPEI 333          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: Ctsl (cathepsin L [Source:MGI Symbol;Acc:MGI:88564])

HSP 1 Score: 172.94 bits (437), Expect = 1.578e-51
Identity = 90/200 (45.00%), Postives = 128/200 (64.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS +G LEGQ+F KTG LISLSEQ +VDC     +  CNGG +     YIK+NGG++SE+ YPY     +  +  C ++ E  V  DTGFV +P   E+AL +A+ T+GPIS+A  AS P L  Y +GIY++  C+   ++H VLLVGYG +  + +   YW++KNSWG  WG  GY ++ +++ N C +A  + YP+V
Sbjct:  140 AFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPY-----EAKDGSCKYRAEFAVANDTGFVDIPQ-QEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVV 333          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: 4930486L24Rik (RIKEN cDNA 4930486L24 gene [Source:MGI Symbol;Acc:MGI:1922258])

HSP 1 Score: 171.4 bits (433), Expect = 5.455e-51
Identity = 87/200 (43.50%), Postives = 125/200 (62.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDC--DSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGT--DEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS TG+LEGQ+F+KTG L+ LSEQ ++DC   +  + C+GGF+ +   Y+K NGG+ +E+ YPY+      P +KC +  E        FV + PG EEAL +A+  +GPIS+A  AS      Y +GIY++  C  V +NHAVL+VGYG   +E  G  YW++KNSWG  WG  GY ++ ++  N C +A  + YP+V
Sbjct:  140 AFSATGSLEGQMFKKTGRLVPLSEQNLLDCMGSNVTHDCSGGFMQNAFQYVKDNGGLATEESYPYIG-----PGRKCRYHAENSAANVRDFVQI-PGREEALMKAVAKVGPISVAVDASHDSFQFYDSGIYYEPQCKRVHLNHAVLVVGYGFEGEESDGNSYWLVKNSWGEEWGMKGYIKIAKDWNNHCGIATLATYPIV 333          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: Ctsk (cathepsin K [Source:MGI Symbol;Acc:MGI:107823])

HSP 1 Score: 169.474 bits (428), Expect = 2.715e-50
Identity = 85/194 (43.81%), Postives = 121/194 (62.37%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYP 578
            AFS+ GALEGQL +KTG L++LS Q +VDC + +Y C GG++T    Y++QNGGI+SE  YPYV       ++ C +          G+  +P G+E+AL+ A+  +GPIS++  AS      Y  G+Y+D  C    +NHAVL+VGYGT  + G+ +WIIKNSWG +WG  GY  + RNK N C +   + +P
Sbjct:  141 AFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVG-----QDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGT--QKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFP 327          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: Ctss (cathepsin S [Source:MGI Symbol;Acc:MGI:107341])

HSP 1 Score: 162.925 bits (411), Expect = 1.180e-47
Identity = 91/200 (45.50%), Postives = 123/200 (61.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDY----ACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMER-NKNMCNMAYNSYYPLV 584
            AFS  GALEGQL  KTG LISLS Q +VDC + +      C GG++T+   YI  NGGIE++  YPY     K  ++KC++  +    T + ++ LP GDE+AL+EA+ T GP+S+   AS      YK+G+Y D  C    +NH VL+VGYGT +  G  YW++KNSWG  +G+ GY RM R NKN C +A    YP +
Sbjct:  150 AFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPY-----KATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTG-NVNHGVLVVGYGTLD--GKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI 341          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: Ctss (cathepsin S [Source:MGI Symbol;Acc:MGI:107341])

HSP 1 Score: 162.925 bits (411), Expect = 1.352e-47
Identity = 91/200 (45.50%), Postives = 123/200 (61.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDY----ACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMER-NKNMCNMAYNSYYPLV 584
            AFS  GALEGQL  KTG LISLS Q +VDC + +      C GG++T+   YI  NGGIE++  YPY     K  ++KC++  +    T + ++ LP GDE+AL+EA+ T GP+S+   AS      YK+G+Y D  C    +NH VL+VGYGT +  G  YW++KNSWG  +G+ GY RM R NKN C +A    YP +
Sbjct:  149 AFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPY-----KATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTG-NVNHGVLVVGYGTLD--GKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI 340          
BLAST of Cathepsin L vs. UniProt
Match: sp|Q26636|CATL_SARPE (Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 4.804e-60
Identity = 99/198 (50.00%), Postives = 132/198 (66.67%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  I  TDTGFV +P GDEE +++A+ T+GP+S+A  AS      Y  G+Y++  C +  ++H VL+VGYGTD ESG  YW++KNSWG  WGE GY +M RN+ N C +A  S YP V
Sbjct:  148 AFSSTGALEGQHFRKAGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EGIDDSCHFNKATIGATDTGFVDIPEGDEEKMKKAVATMGPVSVAIDASHESFQLYSEGVYNEPECDEQNLDHGVLVVGYGTD-ESGMDYWLVKNSWGTTWGEQGYIKMARNQNNQCGIATASSYPTV 339          
BLAST of Cathepsin L vs. UniProt
Match: sp|Q95029|CATL_DROME (Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=2 SV=2)

HSP 1 Score: 191.815 bits (486), Expect = 1.963e-57
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:  180 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 371          
BLAST of Cathepsin L vs. UniProt
Match: sp|O60911|CATL2_HUMAN (Cathepsin L2 OS=Homo sapiens GN=CTSV PE=1 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 2.416e-55
Identity = 93/200 (46.50%), Postives = 131/200 (65.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG L+SLSEQ +VDC     +  CNGGF+     Y+K+NGG++SE+ YPYV+      ++ C ++ E  V  DTGF  + PG E+AL +A+ T+GPIS+A  A       YK+GIY +  C+   ++H VL+VGYG +    + + YW++KNSWGP WG NGY ++ ++K N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVA-----VDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV 334          
BLAST of Cathepsin L vs. UniProt
Match: sp|P09648|CATL1_CHICK (Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 6.625e-55
Identity = 93/198 (46.97%), Postives = 125/198 (63.13%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFSTTGALEGQ FR  G L+SLSEQ +VDC     +  CNGG +     Y++ NGGI+SE+ YPY    T K ++ C +K E     DTGFV +P G E AL +A+ ++GP+S+A  A       Y++GIY++  C+   ++H VL+VGYG   E G  YWI+KNSWG  WG+ GY  M ++ KN C +A  + YPLV
Sbjct:   27 AFSTTGALEGQHFRTKGKLVSLSEQNLVDCSRPEGNQGCNGGLMDQAFQYVQDNGGIDSEESYPY----TAKDDEDCRYKAEYNAANDTGFVDIPQGHERALMKAVASVGPVSVAIDAGHSSFQFYQSGIYYEPDCSSEDLDHGVLVVGYGF--EGGKKYWIVKNSWGEKWGDKGYIYMAKDRKNHCGIATAASYPLV 218          
BLAST of Cathepsin L vs. UniProt
Match: sp|P25975|CATL1_BOVIN (Cathepsin L1 OS=Bos taurus GN=CTSL PE=1 SV=3)

HSP 1 Score: 180.259 bits (456), Expect = 2.125e-53
Identity = 94/200 (47.00%), Postives = 129/200 (64.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG L+SLSEQ +VDC     +  CNGG + +   YIK NGG++SE+ YPY++  T      C +K E     DTGFV +P   E+AL +A+ T+GPIS+A  A       YK+GIY+D  C+   ++H VL+VGYG +  + +   +WI+KNSWGP WG NGY +M +++ N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGKLVSLSEQNLVDCSRAQGNQGCNGGLMDNAFQYIKDNGGLDSEESYPYLATDT----NSCNYKPECSAANDTGFVDIPQ-REKALMKAVATVGPISVAIDAGHTSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDSNNNKFWIVKNSWGPEWGWNGYVKMAKDQNNHCGIATAASYPTV 334          
BLAST of Cathepsin L vs. TrEMBL
Match: tr|A0A183T8C8|A0A183T8C8_SCHSO (Uncharacterized protein OS=Schistocephalus solidus PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.019e-62
Identity = 110/200 (55.00%), Postives = 134/200 (67.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMC--ADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTG++EGQL RK+G L+SLSEQQ+VDC +   +  CNGG + +   YI+  GGI+  +DYPYVSG T+  N +C F + K V T TGFV +  G+EE LR AL   GPISIA  A       Y +GIY D  C  A   +NHAVLLVGYG   E G PYWI+KNSWGP WGE+GY RM RNK N+C +A  S +PLV
Sbjct:  164 AFSTTGSIEGQLKRKSGQLVSLSEQQLVDCSTNYNNLGCNGGLMDNAFEYIQDAGGIQRSEDYPYVSGETESQNDQCGFDRSKAVATVTGFVDVDSGNEEELRRALYFHGPISIAIDAGQQSFMSYHSGIYDDPRCQNAPSELNHAVLLVGYGV--EKGVPYWIVKNSWGPNWGESGYIRMRRNKNNLCGVATASSFPLV 361          
BLAST of Cathepsin L vs. TrEMBL
Match: tr|A0A0X3NKX4|A0A0X3NKX4_SCHSO (Cathepsin L OS=Schistocephalus solidus GN=CATL PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.408e-62
Identity = 110/200 (55.00%), Postives = 134/200 (67.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMC--ADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTG++EGQL RK+G L+SLSEQQ+VDC +   +  CNGG + +   YI+  GGI+  +DYPYVSG T+  N +C F + K V T TGFV +  G+EE LR AL   GPISIA  A       Y +GIY D  C  A   +NHAVLLVGYG   E G PYWI+KNSWGP WGE+GY RM RNK N+C +A  S +PLV
Sbjct:  195 AFSTTGSIEGQLKRKSGQLVSLSEQQLVDCSTNYNNLGCNGGLMDNAFEYIQDAGGIQRSEDYPYVSGETESQNDQCGFDRSKAVATVTGFVDVDSGNEEELRRALYFHGPISIAIDAGQQSFMSYHSGIYDDPRCQNAPSELNHAVLLVGYGV--EKGVPYWIVKNSWGPNWGESGYIRMRRNKNNLCGVATASSFPLV 392          
BLAST of Cathepsin L vs. TrEMBL
Match: tr|A0A0P6IIA0|A0A0P6IIA0_9CRUS (Cathepsin L OS=Daphnia magna PE=3 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.105e-62
Identity = 103/198 (52.02%), Postives = 133/198 (67.17%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS TGALEGQ FRKTG L+SLSEQ +VDC     +  CNGG + +   YIK+NGGI++E+ YPY     +  +  C++KK  +  TD GFV +P GDEEAL +AL T+GP+S+A  AS      Y  G+Y +  C   +++H VL VGYGTDEESG  YW++KNSWG +WG+ GY RM RNK N C +A  S YPLV
Sbjct:  151 SFSATGALEGQHFRKTGQLVSLSEQNLVDCSGSYGNNGCNGGLMDNAFQYIKENGGIDTEKAYPY-----EGIDDTCHYKKTDVGATDKGFVDIPTGDEEALMKALATVGPVSVAIDASHESFQFYSEGVYFEPQCDSQQLDHGVLAVGYGTDEESGNDYWLVKNSWGTSWGDKGYIRMARNKDNHCGIATQSSYPLV 343          
BLAST of Cathepsin L vs. TrEMBL
Match: tr|A0A0R3TFW0|A0A0R3TFW0_HYMNN (Uncharacterized protein OS=Hymenolepis nana PE=3 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.718e-61
Identity = 102/200 (51.00%), Postives = 131/200 (65.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYA---CNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMC--ADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFS  GA+EGQ  R +G L+SLSEQQ+VDC SFD+    CNGG + +   Y+K+ GG+++E+DYPYVSG T++PN  C F     V   TG V +P G EE L+EAL   GPIS+A +A PL    Y  GIY D  C      +NH VLLVGYG   E+G PYW+IKNSWG  WGENGY R++R  N+C +   + YP++
Sbjct:   23 AFSAIGAIEGQYQRASGKLVSLSEQQLVDC-SFDFGNEGCNGGLMDNAFRYVKKAGGVDTEKDYPYVSGVTQEPNDNCSFNAAGAVAKVTGLVDIPSGKEELLKEALAYNGPISVAINAGPLSFMMYHEGIYDDPDCRGGSESLNHGVLLVGYG--HENGIPYWLIKNSWGTGWGENGYVRIKRGGNLCGVETAASYPMI 219          
BLAST of Cathepsin L vs. TrEMBL
Match: tr|A0A0K1L960|A0A0K1L960_EUDNI (Cathepsin L3 OS=Eudiplozoon nipponicum PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 2.796e-60
Identity = 106/200 (53.00%), Postives = 132/200 (66.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVR--INHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTG+LEGQ FRKTGNL+SLSEQQ+VDC S   +  CNGG + +   YIK   GI+ E  YPYVSG T      CYFK+E I   DTG+V +P  DE AL+EA+  +GP+S+A +A       YK GIY    C      ++H VL+VGYG+  E+G  YWI+KNSWGP WGE+GY RM RN  N+C +A  + YPLV
Sbjct:  171 AFSTTGSLEGQHFRKTGNLVSLSEQQLVDCSSSYGNMGCNGGLMDNAFAYIKATNGIDYEDKYPYVSGDTGSAEDTCYFKEEDIGAVDTGYVDIPTEDEAALQEAVANVGPVSVAINAGRADFMMYKQGIYKPDECPGQMNDLDHGVLVVGYGS--ENGQDYWIVKNSWGPDWGESGYIRMARNSGNLCGIATAASYPLV 368          
The following BLAST results are available for this feature:
BLAST of Cathepsin L vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
CTSV4.702e-5646.50cathepsin V [Source:HGNC Symbol;Acc:HGNC:2538][more]
CTSV4.702e-5646.50cathepsin V [Source:HGNC Symbol;Acc:HGNC:2538][more]
CTSL1.924e-4844.50cathepsin L [Source:HGNC Symbol;Acc:HGNC:2537][more]
CTSL1.924e-4844.50cathepsin L [Source:HGNC Symbol;Acc:HGNC:2537][more]
CTSK5.898e-4743.30cathepsin K [Source:HGNC Symbol;Acc:HGNC:2536][more]
back to top
BLAST of Cathepsin L vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
cpl-11.595e-6049.49CathePsin L family [Source:RefSeq peptide;Acc:NP_... [more]
cpl-11.595e-6049.49CathePsin L family [Source:RefSeq peptide;Acc:NP_... [more]
cpl-14.073e-5949.49CathePsin L family [Source:RefSeq peptide;Acc:NP_... [more]
tag-1964.304e-4544.90pep:known chromosome:WBcel235:V:8594914:8597563:1 ... [more]
tag-1964.304e-4544.90pep:known chromosome:WBcel235:V:8594914:8597500:1 ... [more]
back to top
BLAST of Cathepsin L vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Cp11.540e-5947.98Cysteine proteinase-1 [Source:FlyBase gene name;Ac... [more]
Cp11.084e-5847.98Cysteine proteinase-1 [Source:FlyBase gene name;Ac... [more]
Cp11.508e-5847.98Cysteine proteinase-1 [Source:FlyBase gene name;Ac... [more]
Cp11.986e-5847.98Cysteine proteinase-1 [Source:FlyBase gene name;Ac... [more]
CG53677.272e-4841.62pep:known chromosome:BDGP6:2L:10354743:10356597:-1... [more]
back to top
BLAST of Cathepsin L vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-239j18.39.644e-5446.50si:dkey-239j18.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
zgc:1741531.193e-5346.50zgc:174153 [Source:ZFIN;Acc:ZDB-GENE-080215-7][more]
zgc:1741531.193e-5346.50zgc:174153 [Source:ZFIN;Acc:ZDB-GENE-080215-7][more]
ctslb1.245e-5346.50cathepsin Lb [Source:ZFIN;Acc:ZDB-GENE-980526-285][more]
si:dkey-269i1.41.279e-5346.50si:dkey-269i1.4 [Source:ZFIN;Acc:ZDB-GENE-121214-3... [more]
back to top
BLAST of Cathepsin L vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
CTSK3.829e-5444.39cathepsin K [Source:HGNC Symbol;Acc:HGNC:2536][more]
CTSK4.946e-5444.39cathepsin K [Source:HGNC Symbol;Acc:HGNC:2536][more]
ctsv6.476e-5144.00cathepsin V [Source:Xenbase;Acc:XB-GENE-966214][more]
ENSXETT00000019552.39.265e-4844.39cathepsin K-like [Source:Xenbase;Acc:XB-GENE-98681... [more]
ctss2.052e-4341.92cathepsin S [Source:Xenbase;Acc:XB-GENE-953011][more]
back to top
BLAST of Cathepsin L vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Ctsl1.578e-5145.00cathepsin L [Source:MGI Symbol;Acc:MGI:88564][more]
4930486L24Rik5.455e-5143.50RIKEN cDNA 4930486L24 gene [Source:MGI Symbol;Acc:... [more]
Ctsk2.715e-5043.81cathepsin K [Source:MGI Symbol;Acc:MGI:107823][more]
Ctss1.180e-4745.50cathepsin S [Source:MGI Symbol;Acc:MGI:107341][more]
Ctss1.352e-4745.50cathepsin S [Source:MGI Symbol;Acc:MGI:107341][more]
back to top
BLAST of Cathepsin L vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26636|CATL_SARPE4.804e-6050.00Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1[more]
sp|Q95029|CATL_DROME1.963e-5747.98Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=2... [more]
sp|O60911|CATL2_HUMAN2.416e-5546.50Cathepsin L2 OS=Homo sapiens GN=CTSV PE=1 SV=2[more]
sp|P09648|CATL1_CHICK6.625e-5546.97Cathepsin L1 (Fragments) OS=Gallus gallus GN=CTSL ... [more]
sp|P25975|CATL1_BOVIN2.125e-5347.00Cathepsin L1 OS=Bos taurus GN=CTSL PE=1 SV=3[more]
back to top
BLAST of Cathepsin L vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A183T8C8|A0A183T8C8_SCHSO1.019e-6255.00Uncharacterized protein OS=Schistocephalus solidus... [more]
tr|A0A0X3NKX4|A0A0X3NKX4_SCHSO2.408e-6255.00Cathepsin L OS=Schistocephalus solidus GN=CATL PE=... [more]
tr|A0A0P6IIA0|A0A0P6IIA0_9CRUS3.105e-6252.02Cathepsin L OS=Daphnia magna PE=3 SV=1[more]
tr|A0A0R3TFW0|A0A0R3TFW0_HYMNN3.718e-6151.00Uncharacterized protein OS=Hymenolepis nana PE=3 S... [more]
tr|A0A0K1L960|A0A0K1L960_EUDNI2.796e-6053.00Cathepsin L3 OS=Eudiplozoon nipponicum PE=2 SV=1[more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000668Peptidase C1A, papain C-terminalSMARTSM00645pept_c1coord: 1..193
e-value: 1.7E-68
score: 243.6
IPR000668Peptidase C1A, papain C-terminalPFAMPF00112Peptidase_C1coord: 1..192
e-value: 2.0E-60
score: 204.5
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 1..194
e-value: 1.0E-70
score: 238.2
NoneNo IPR availableSUPERFAMILYSSF54001Cysteine proteinasescoord: 1..193
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
NoneNo IPR availableTMHMMTMhelixcoord: 13..30
IPR025660Cysteine peptidase, histidine active sitePROSITEPS00639THIOL_PROTEASE_HIScoord: 138..148
IPR025661Cysteine peptidase, asparagine active sitePROSITEPS00640THIOL_PROTEASE_ASNcoord: 157..176

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000668Peptidase_C1A_C
IPR025660Pept_his_AS
IPR025661Pept_asp_AS
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000002Stage 2
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000004Stage 4
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000023temporary embryonic pharynx
PLANA:0000085primitive gut cell
PLANA:0000058embryonic digestive system
PLANA:0000059embryonic gut cell
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023322 ID=SMED30023322|Name=Cathepsin L|organism=Schmidtea mediterranea sexual|type=transcript|length=613bp
ACGCATTCTCTACGACAGGCGCGTTAGAAGGTCAACTATTCAGAAAAACT
GGAAATTTGATAAGTTTATCTGAACAACAGATTGTTGATTGTGATAGTTT
TGATTATGCATGTAACGGTGGATTTGTGACTGATACTTTAACTTATATTA
AACAAAATGGAGGAATTGAATCTGAGCAAGATTATCCATATGTGTCAGGA
AGGACGAAGAAACCTAATAAAAAATGTTATTTCAAAAAAGAAAAAATAGT
GGGAACAGATACTGGTTTCGTATCTTTACCTCCAGGAGATGAAGAAGCTC
TGAGAGAAGCTCTAGTAACAATTGGGCCAATTTCAATAGCTTTTTCCGCG
TCGCCTTTGTTATCAGGATATAAGAATGGGATATATCATGATTACATGTG
TGCTGATGTTCGCATCAATCATGCAGTTTTACTAGTAGGATATGGAACGG
ATGAAGAATCAGGAACACCTTATTGGATAATAAAAAACAGTTGGGGTCCC
GCATGGGGAGAAAATGGATATTTTCGAATGGAAAGAAATAAAAACATGTG
CAACATGGCATACAATTCATACTATCCATTGGTTTGATTGAACGACTTCT
TATGAGTGTGTGT
back to top

protein sequence of SMED30023322-orf-1

>SMED30023322-orf-1 ID=SMED30023322-orf-1|Name=SMED30023322-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIK
QNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEAL
REALVTIGPISIAFSASPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD
EESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV*
back to top
Aliases
The feature 'Cathepsin L' has the following synonyms
Synonym
CTSL-like