Cathepsin L

Overview
NameCathepsin L
Smed IDSMED30023322
Uniprot Best hitCathepsin L OS=Sarcophaga peregrina OX=7386 PE=1 SV=1 (E=2.31162e-61)
Length (bp)613
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cathepsin L (SMED30023322) t-SNE clustered cells

Violin plots show distribution of expression levels for Cathepsin L (SMED30023322) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30023322

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
embryonic pharynxSMED30023322 SMED30023322smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynxSMED30023322 SMED30023322smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynxSMED30023322 SMED30023322smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
embryonic gutSMED30023322 SMED30023322smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic gutSMED30023322 SMED30023322smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
embryonic gutSMED30023322 SMED30023322smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
primitive gutSMED30023322 SMED30023322smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSV (cathepsin V [Source:HGNC Symbol;Acc:HGNC:2538])

HSP 1 Score: 185.267 bits (469), Expect = 2.711e-57
Identity = 93/200 (46.50%), Postives = 131/200 (65.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG L+SLSEQ +VDC     +  CNGGF+     Y+K+NGG++SE+ YPYV+      ++ C ++ E  V  DTGF  + PG E+AL +A+ T+GPIS+A  A       YK+GIY +  C+   ++H VL+VGYG +    + + YW++KNSWGP WG NGY ++ ++K N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVA-----VDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV 334          
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSV (cathepsin V [Source:HGNC Symbol;Acc:HGNC:2538])

HSP 1 Score: 185.267 bits (469), Expect = 2.711e-57
Identity = 93/200 (46.50%), Postives = 131/200 (65.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG L+SLSEQ +VDC     +  CNGGF+     Y+K+NGG++SE+ YPYV+      ++ C ++ E  V  DTGF  + PG E+AL +A+ T+GPIS+A  A       YK+GIY +  C+   ++H VL+VGYG +    + + YW++KNSWGP WG NGY ++ ++K N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVA-----VDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV 334          
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSL (cathepsin L [Source:HGNC Symbol;Acc:HGNC:2537])

HSP 1 Score: 165.236 bits (417), Expect = 1.392e-49
Identity = 89/200 (44.50%), Postives = 122/200 (61.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYG--TDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG LISLSEQ +VDC     +  CNGG +     Y++ NGG++SE+ YPY     +   + C +  +  V  DTGFV +P   E+AL +A+ T+GPIS+A  A       YK GIY +  C+   ++H VL+VGYG  + E     YW++KNSWG  WG  GY +M ++ +N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPY-----EATEESCKYNPKYSVANDTGFVDIPK-QEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV 333          
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSL (cathepsin L [Source:HGNC Symbol;Acc:HGNC:2537])

HSP 1 Score: 165.236 bits (417), Expect = 1.392e-49
Identity = 89/200 (44.50%), Postives = 122/200 (61.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYG--TDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG LISLSEQ +VDC     +  CNGG +     Y++ NGG++SE+ YPY     +   + C +  +  V  DTGFV +P   E+AL +A+ T+GPIS+A  A       YK GIY +  C+   ++H VL+VGYG  + E     YW++KNSWG  WG  GY +M ++ +N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPY-----EATEESCKYNPKYSVANDTGFVDIPK-QEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV 333          
BLAST of Cathepsin L vs. Ensembl Human
Match: CTSK (cathepsin K [Source:HGNC Symbol;Acc:HGNC:2536])

HSP 1 Score: 161.384 bits (407), Expect = 4.460e-48
Identity = 84/194 (43.30%), Postives = 116/194 (59.79%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYP 578
            AFS+ GALEGQL +KTG L++LS Q +VDC S +  C GG++T+   Y+++N GI+SE  YPYV        + C +          G+  +P G+E+AL+ A+  +GP+S+A  AS      Y  G+Y+D  C    +NHAVL VGYG   + G  +WIIKNSWG  WG  GY  M RNK N C +A  + +P
Sbjct:  141 AFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVG-----QEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGI--QKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFP 327          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: cpl-1 (CathePsin L family [Source:UniProtKB/TrEMBL;Acc:H9G333])

HSP 1 Score: 191.43 bits (485), Expect = 7.044e-62
Identity = 98/198 (49.49%), Postives = 126/198 (63.64%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ  RK G L+SLSEQ +VDC +   ++ CNGG +     YI+ N G+++E+ YPY     K  + KC+F K+ +   D G+V  P GDEE L+ A+ T GPISIA  A       YK G+Y+D  C+   ++H VLLVGYGTD E G  YWI+KNSWG  WGE GY R+ RN+ N C +A  + YPLV
Sbjct:    7 AFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPY-----KGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHG-DYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 198          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: cpl-1 (CathePsin L family [Source:UniProtKB/TrEMBL;Acc:H9G333])

HSP 1 Score: 191.43 bits (485), Expect = 7.044e-62
Identity = 98/198 (49.49%), Postives = 126/198 (63.64%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ  RK G L+SLSEQ +VDC +   ++ CNGG +     YI+ N G+++E+ YPY     K  + KC+F K+ +   D G+V  P GDEE L+ A+ T GPISIA  A       YK G+Y+D  C+   ++H VLLVGYGTD E G  YWI+KNSWG  WGE GY R+ RN+ N C +A  + YPLV
Sbjct:    7 AFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPY-----KGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHG-DYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 198          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: cpl-1 (CathePsin L family [Source:UniProtKB/TrEMBL;Acc:H9G333])

HSP 1 Score: 192.2 bits (487), Expect = 2.206e-60
Identity = 98/198 (49.49%), Postives = 126/198 (63.64%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ  RK G L+SLSEQ +VDC +   ++ CNGG +     YI+ N G+++E+ YPY     K  + KC+F K+ +   D G+V  P GDEE L+ A+ T GPISIA  A       YK G+Y+D  C+   ++H VLLVGYGTD E G  YWI+KNSWG  WGE GY R+ RN+ N C +A  + YPLV
Sbjct:  146 AFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPY-----KGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHG-DYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 337          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: tag-196 (pep chromosome:WBcel235:V:8594914:8597500:1 gene:WBGene00007055.1 transcript:F41E6.6.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-196)

HSP 1 Score: 158.303 bits (399), Expect = 5.477e-46
Identity = 88/196 (44.90%), Postives = 117/196 (59.69%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDY--MCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFSTTG +EG  F     L+SLSEQ++VDCDS D  CNGG  ++    I + GG+E E  YPY  GR     + C+  ++ I     G V L P DE  +++ LVT GPISI  +A+  L  Y++G+ H +   C    +NH VL+VGYG D     PYWI+KNSWGP WGE GYF++ R KN+C +   +   LV
Sbjct:  290 AFSTTGNVEGAWFIAKNKLVSLSEQELVDCDSMDQGCNGGLPSNAYKEIIRMGGLEPEDAYPY-DGR----GETCHLVRKDIAVYINGSVEL-PHDEVEMQKWLVTKGPISIGLNANT-LQFYRHGVVHPFKIFCEPFMLNHGVLIVGYGKD--GRKPYWIVKNSWGPNWGEAGYFKLYRGKNVCGVQEMATSALV 476          
BLAST of Cathepsin L vs. Ensembl Celegans
Match: tag-196 (pep chromosome:WBcel235:V:8594914:8597469:1 gene:WBGene00007055.1 transcript:F41E6.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-196)

HSP 1 Score: 158.303 bits (399), Expect = 5.477e-46
Identity = 88/196 (44.90%), Postives = 117/196 (59.69%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDY--MCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFSTTG +EG  F     L+SLSEQ++VDCDS D  CNGG  ++    I + GG+E E  YPY  GR     + C+  ++ I     G V L P DE  +++ LVT GPISI  +A+  L  Y++G+ H +   C    +NH VL+VGYG D     PYWI+KNSWGP WGE GYF++ R KN+C +   +   LV
Sbjct:  290 AFSTTGNVEGAWFIAKNKLVSLSEQELVDCDSMDQGCNGGLPSNAYKEIIRMGGLEPEDAYPY-DGR----GETCHLVRKDIAVYINGSVEL-PHDEVEMQKWLVTKGPISIGLNANT-LQFYRHGVVHPFKIFCEPFMLNHGVLIVGYGKD--GRKPYWIVKNSWGPNWGEAGYFKLYRGKNVCGVQEMATSALV 476          
BLAST of Cathepsin L vs. Ensembl Fly
Match: Cp1 (gene:FBgn0013770 transcript:FBtr0304021)

HSP 1 Score: 191.045 bits (484), Expect = 6.753e-61
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:   58 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 249          
BLAST of Cathepsin L vs. Ensembl Fly
Match: Cp1 (gene:FBgn0013770 transcript:FBtr0087592)

HSP 1 Score: 191.43 bits (485), Expect = 5.466e-60
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:  150 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 341          
BLAST of Cathepsin L vs. Ensembl Fly
Match: Cp1 (gene:FBgn0013770 transcript:FBtr0339955)

HSP 1 Score: 191.045 bits (484), Expect = 7.603e-60
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:  147 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 338          
BLAST of Cathepsin L vs. Ensembl Fly
Match: Cp1 (gene:FBgn0013770 transcript:FBtr0087593)

HSP 1 Score: 191.815 bits (486), Expect = 1.054e-59
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:  180 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 371          
BLAST of Cathepsin L vs. Ensembl Fly
Match: CG5367 (gene:FBgn0032228 transcript:FBtr0080055)

HSP 1 Score: 163.31 bits (412), Expect = 5.044e-49
Identity = 82/197 (41.62%), Postives = 124/197 (62.94%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASP-LLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFS   ++ GQ+F++TG ++SLS+QQIVDC     +  C GG + +TL+Y++  GGI  +QDYPYV+ + K     C F  +  V   T +  LP  DE+A++ A+  IGP++I+ +ASP     Y +GIY D +C+   +NHA++++G+G D      YWI+KN WG  WGENGY R+ +  NMC +A  + Y +V
Sbjct:  153 AFSIAESIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGK-----CQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGFGKD------YWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYAIV 338          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: si:dkey-239j18.3 (si:dkey-239j18.3 [Source:ZFIN;Acc:ZDB-GENE-121214-39])

HSP 1 Score: 178.718 bits (452), Expect = 6.488e-55
Identity = 93/200 (46.50%), Postives = 129/200 (64.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A  + YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPSGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATKASYPLM 336          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: zgc:174153 (zgc:174153 [Source:ZFIN;Acc:ZDB-GENE-080215-7])

HSP 1 Score: 178.333 bits (451), Expect = 8.048e-55
Identity = 93/200 (46.50%), Postives = 129/200 (64.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A  + YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPSGNEPALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATKASYPLM 336          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: ctslb (cathepsin Lb [Source:ZFIN;Acc:ZDB-GENE-980526-285])

HSP 1 Score: 178.333 bits (451), Expect = 8.403e-55
Identity = 93/200 (46.50%), Postives = 130/200 (65.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A ++ YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPRGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATSASYPLM 336          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: ctslb (cathepsin Lb [Source:ZFIN;Acc:ZDB-GENE-980526-285])

HSP 1 Score: 178.333 bits (451), Expect = 9.562e-55
Identity = 93/200 (46.50%), Postives = 129/200 (64.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A  + YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGLMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPSGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATKASYPLM 336          
BLAST of Cathepsin L vs. Ensembl Zebrafish
Match: ctslb (cathepsin Lb [Source:ZFIN;Acc:ZDB-GENE-980526-285])

HSP 1 Score: 177.948 bits (450), Expect = 1.124e-54
Identity = 93/200 (46.50%), Postives = 130/200 (65.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            +FS+TGALEGQLFRKTG LIS+SEQ +VDC     +  CNGG +     Y+K+N G++SEQ YPY++ R   P   C +     V   TGFV +P G+E AL  A+  +GP+S+A  AS   L  Y++GIY++  C+  R++HAVL+VGYG    + +G  YWI+KNSW   WG+ GY  M ++K N C +A ++ YPL+
Sbjct:  141 SFSSTGALEGQLFRKTGKLISMSEQNLVDCSRPQGNQGCNGGIMDQAFQYVKENKGLDSEQSYPYLA-RDDLP---CRYDPRFNVAKITGFVDIPRGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLVVGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATSASYPLM 336          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: ctsk (cathepsin K (pycnodysostosis) [Source:NCBI gene;Acc:448216])

HSP 1 Score: 178.333 bits (451), Expect = 9.253e-55
Identity = 87/196 (44.39%), Postives = 127/196 (64.80%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS+ GALEGQL +KTG L+SLS Q +VDCD+ +Y C GG++T+   Y++ NGGI+S+ +YPYV       ++ C++       T  G+  +P G E+AL+ A+  +GP+S++  AS P    YK G+Y+D  C    +NHAVL+VGYG   E G  +WIIKNSWG  WG+ GY  + R+ KN C +A  + +P++
Sbjct:  141 AFSSVGALEGQLMKKTGKLVSLSPQNLVDCDTDNYGCEGGYMTNAFGYVRDNGGIDSDAEYPYVG-----QDEGCHYNPADKAATCKGYKEIPVGSEKALKRAVANVGPVSVSIDASLPSFQFYKKGVYYDSSCNPDAVNHAVLVVGYGN--EKGIKHWIIKNSWGDWWGKKGYVLLARDKKNACGIASLASFPVM 329          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: ctsk (cathepsin K (pycnodysostosis) [Source:NCBI gene;Acc:448216])

HSP 1 Score: 178.333 bits (451), Expect = 1.407e-54
Identity = 87/196 (44.39%), Postives = 127/196 (64.80%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS+ GALEGQL +KTG L+SLS Q +VDCD+ +Y C GG++T+   Y++ NGGI+S+ +YPYV       ++ C++       T  G+  +P G E+AL+ A+  +GP+S++  AS P    YK G+Y+D  C    +NHAVL+VGYG   E G  +WIIKNSWG  WG+ GY  + R+ KN C +A  + +P++
Sbjct:  148 AFSSVGALEGQLMKKTGKLVSLSPQNLVDCDTDNYGCEGGYMTNAFGYVRDNGGIDSDAEYPYVG-----QDEGCHYNPADKAATCKGYKEIPVGSEKALKRAVANVGPVSVSIDASLPSFQFYKKGVYYDSSCNPDAVNHAVLVVGYGN--EKGIKHWIIKNSWGDWWGKKGYVLLARDKKNACGIASLASFPVM 336          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: fcrl2 (Fc receptor-like 2 [Source:Xenbase;Acc:XB-GENE-5904272])

HSP 1 Score: 170.629 bits (431), Expect = 1.172e-51
Identity = 88/200 (44.00%), Postives = 124/200 (62.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYG--TDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTGALEGQ +R TG +ISLSEQ +VDC     +  CNGG +     Y+K NGGI+SE  YPY    T K +++C++        DTGFV +  G E+ L  A+ ++GP+S+A  A       YK+GIY++  C+   ++H VL+VGYG   ++E G  YWI+KNSW   WG +GY  + +++ N C +A  + YPLV
Sbjct:  140 AFSTTGALEGQHYRNTGKMISLSEQNLVDCSRAQGNQGCNGGLMDQAFQYVKDNGGIDSEDSYPY----TAKDDQECHYDPNYNSANDTGFVDVTSGSEKDLMNAVASVGPVSVAVDAGHQSFQFYKSGIYYEPECSSEDLDHGVLVVGYGFEGEDEDGKKYWIVKNSWSEKWGNDGYIYIAKDRHNHCGIATAASYPLV 335          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: fcrl2 (Fc receptor-like 2 [Source:Xenbase;Acc:XB-GENE-5904272])

HSP 1 Score: 170.629 bits (431), Expect = 1.571e-51
Identity = 88/200 (44.00%), Postives = 124/200 (62.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYG--TDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTGALEGQ +R TG +ISLSEQ +VDC     +  CNGG +     Y+K NGGI+SE  YPY    T K +++C++        DTGFV +  G E+ L  A+ ++GP+S+A  A       YK+GIY++  C+   ++H VL+VGYG   ++E G  YWI+KNSW   WG +GY  + +++ N C +A  + YPLV
Sbjct:  147 AFSTTGALEGQHYRNTGKMISLSEQNLVDCSRAQGNQGCNGGLMDQAFQYVKDNGGIDSEDSYPY----TAKDDQECHYDPNYNSANDTGFVDVTSGSEKDLMNAVASVGPVSVAVDAGHQSFQFYKSGIYYEPECSSEDLDHGVLVVGYGFEGEDEDGKKYWIVKNSWSEKWGNDGYIYIAKDRHNHCGIATAASYPLV 342          
BLAST of Cathepsin L vs. Ensembl Xenopus
Match: harbi1 (harbinger transposase derived 1 [Source:Xenbase;Acc:XB-GENE-6077433])

HSP 1 Score: 162.925 bits (411), Expect = 1.134e-48
Identity = 87/196 (44.39%), Postives = 115/196 (58.67%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFST GALEGQL +KTG L+ +S Q +VDC   ++ C GG++T    Y+K+N GI+SE+ YPYV       ++KC +          GF  +  G E AL++A+  +GPIS+   A       YK GIY+D  C    INHAVL VGYG  ++    YWIIKNSWG  WG  GY  M R K N C +A  + YP++
Sbjct:  143 AFSTVGALEGQLMKKTGKLVGISPQNLVDCVKDNFGCGGGYMTTAFKYVKKNKGIDSEEAYPYVG-----MDQKCKYNVSGRAAEIKGFKEVKKGSETALKKAVGLVGPISVGIDAGLDTFFLYKKGIYYDKSCDGDSINHAVLAVGYGKQKKG--KYWIIKNSWGEDWGNKGYILMAREKGNACGIANLASYPVM 331          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: Ctsl (cathepsin L [Source:MGI Symbol;Acc:MGI:88564])

HSP 1 Score: 172.94 bits (437), Expect = 1.084e-52
Identity = 90/200 (45.00%), Postives = 128/200 (64.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS +G LEGQ+F KTG LISLSEQ +VDC     +  CNGG +     YIK+NGG++SE+ YPY     +  +  C ++ E  V  DTGFV +P   E+AL +A+ T+GPIS+A  AS P L  Y +GIY++  C+   ++H VLLVGYG +  + +   YW++KNSWG  WG  GY ++ +++ N C +A  + YP+V
Sbjct:  140 AFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPY-----EAKDGSCKYRAEFAVANDTGFVDIPQ-QEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVV 333          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: Ctsl (cathepsin L [Source:MGI Symbol;Acc:MGI:88564])

HSP 1 Score: 172.94 bits (437), Expect = 1.084e-52
Identity = 90/200 (45.00%), Postives = 128/200 (64.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS +G LEGQ+F KTG LISLSEQ +VDC     +  CNGG +     YIK+NGG++SE+ YPY     +  +  C ++ E  V  DTGFV +P   E+AL +A+ T+GPIS+A  AS P L  Y +GIY++  C+   ++H VLLVGYG +  + +   YW++KNSWG  WG  GY ++ +++ N C +A  + YP+V
Sbjct:  140 AFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPY-----EAKDGSCKYRAEFAVANDTGFVDIPQ-QEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVV 333          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: 4930486L24Rik (RIKEN cDNA 4930486L24 gene [Source:MGI Symbol;Acc:MGI:1922258])

HSP 1 Score: 171.4 bits (433), Expect = 3.805e-52
Identity = 87/200 (43.50%), Postives = 125/200 (62.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDC--DSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGT--DEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS TG+LEGQ+F+KTG L+ LSEQ ++DC   +  + C+GGF+ +   Y+K NGG+ +E+ YPY+      P +KC +  E        FV + PG EEAL +A+  +GPIS+A  AS      Y +GIY++  C  V +NHAVL+VGYG   +E  G  YW++KNSWG  WG  GY ++ ++  N C +A  + YP+V
Sbjct:  140 AFSATGSLEGQMFKKTGRLVPLSEQNLLDCMGSNVTHDCSGGFMQNAFQYVKDNGGLATEESYPYIG-----PGRKCRYHAENSAANVRDFVQI-PGREEALMKAVAKVGPISVAVDASHDSFQFYDSGIYYEPQCKRVHLNHAVLVVGYGFEGEESDGNSYWLVKNSWGEEWGMKGYIKIAKDWNNHCGIATLATYPIV 333          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: Ctsk (cathepsin K [Source:MGI Symbol;Acc:MGI:107823])

HSP 1 Score: 169.474 bits (428), Expect = 1.923e-51
Identity = 85/194 (43.81%), Postives = 121/194 (62.37%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYP 578
            AFS+ GALEGQL +KTG L++LS Q +VDC + +Y C GG++T    Y++QNGGI+SE  YPYV       ++ C +          G+  +P G+E+AL+ A+  +GPIS++  AS      Y  G+Y+D  C    +NHAVL+VGYGT  + G+ +WIIKNSWG +WG  GY  + RNK N C +   + +P
Sbjct:  141 AFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVG-----QDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGT--QKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFP 327          
BLAST of Cathepsin L vs. Ensembl Mouse
Match: Ctss (cathepsin S [Source:MGI Symbol;Acc:MGI:107341])

HSP 1 Score: 162.925 bits (411), Expect = 9.327e-49
Identity = 91/200 (45.50%), Postives = 123/200 (61.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDY----ACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMER-NKNMCNMAYNSYYPLV 584
            AFS  GALEGQL  KTG LISLS Q +VDC + +      C GG++T+   YI  NGGIE++  YPY     K  ++KC++  +    T + ++ LP GDE+AL+EA+ T GP+S+   AS      YK+G+Y D  C    +NH VL+VGYGT +  G  YW++KNSWG  +G+ GY RM R NKN C +A    YP +
Sbjct:  150 AFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPY-----KATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTG-NVNHGVLVVGYGTLD--GKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI 341          
BLAST of Cathepsin L vs. UniProt
Match: sp|Q26636|CATL_SARPE (Cathepsin L OS=Sarcophaga peregrina OX=7386 PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.312e-61
Identity = 99/198 (50.00%), Postives = 132/198 (66.67%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  I  TDTGFV +P GDEE +++A+ T+GP+S+A  AS      Y  G+Y++  C +  ++H VL+VGYGTD ESG  YW++KNSWG  WGE GY +M RN+ N C +A  S YP V
Sbjct:  148 AFSSTGALEGQHFRKAGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EGIDDSCHFNKATIGATDTGFVDIPEGDEEKMKKAVATMGPVSVAIDASHESFQLYSEGVYNEPECDEQNLDHGVLVVGYGTD-ESGMDYWLVKNSWGTTWGEQGYIKMARNQNNQCGIATASSYPTV 339          
BLAST of Cathepsin L vs. UniProt
Match: sp|O45734|CPL1_CAEEL (Cathepsin L-like OS=Caenorhabditis elegans OX=6239 GN=cpl-1 PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.806e-59
Identity = 98/198 (49.49%), Postives = 126/198 (63.64%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ  RK G L+SLSEQ +VDC +   ++ CNGG +     YI+ N G+++E+ YPY     K  + KC+F K+ +   D G+V  P GDEE L+ A+ T GPISIA  A       YK G+Y+D  C+   ++H VLLVGYGTD E G  YWI+KNSWG  WGE GY R+ RN+ N C +A  + YPLV
Sbjct:  146 AFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPY-----KGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHG-DYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 337          
BLAST of Cathepsin L vs. UniProt
Match: sp|Q95029|CATL_DROME (Cathepsin L OS=Drosophila melanogaster OX=7227 GN=Cp1 PE=2 SV=2)

HSP 1 Score: 191.815 bits (486), Expect = 1.056e-58
Identity = 95/198 (47.98%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TGALEGQ FRK+G L+SLSEQ +VDC +   +  CNGG + +   YIK NGGI++E+ YPY     +  +  C+F K  +  TD GF  +P GDE+ + EA+ T+GP+S+A  AS      Y  G+Y++  C    ++H VL+VG+GTD ESG  YW++KNSWG  WG+ G+ +M RNK N C +A  S YPLV
Sbjct:  180 AFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPY-----EAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTD-ESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV 371          
BLAST of Cathepsin L vs. UniProt
Match: sp|O60911|CATL2_HUMAN (Cathepsin L2 OS=Homo sapiens OX=9606 GN=CTSV PE=1 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 1.302e-56
Identity = 93/200 (46.50%), Postives = 131/200 (65.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG L+SLSEQ +VDC     +  CNGGF+     Y+K+NGG++SE+ YPYV+      ++ C ++ E  V  DTGF  + PG E+AL +A+ T+GPIS+A  A       YK+GIY +  C+   ++H VL+VGYG +    + + YW++KNSWGP WG NGY ++ ++K N C +A  + YP V
Sbjct:  140 AFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVA-----VDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV 334          
BLAST of Cathepsin L vs. UniProt
Match: sp|P09648|CATL1_CHICK (Cathepsin L1 (Fragments) OS=Gallus gallus OX=9031 GN=CTSL PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 3.088e-56
Identity = 93/198 (46.97%), Postives = 125/198 (63.13%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFSTTGALEGQ FR  G L+SLSEQ +VDC     +  CNGG +     Y++ NGGI+SE+ YPY    T K ++ C +K E     DTGFV +P G E AL +A+ ++GP+S+A  A       Y++GIY++  C+   ++H VL+VGYG   E G  YWI+KNSWG  WG+ GY  M ++ KN C +A  + YPLV
Sbjct:   27 AFSTTGALEGQHFRTKGKLVSLSEQNLVDCSRPEGNQGCNGGLMDQAFQYVQDNGGIDSEESYPY----TAKDDEDCRYKAEYNAANDTGFVDIPQGHERALMKAVASVGPVSVAIDAGHSSFQFYQSGIYYEPDCSSEDLDHGVLVVGYGF--EGGKKYWIVKNSWGEKWGDKGYIYMAKDRKNHCGIATAASYPLV 218          
BLAST of Cathepsin L vs. TrEMBL
Match: gnl|BL_ORD_ID|16334458 (tr|A0A183T8C8|A0A183T8C8_SCHSO Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS12726 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.084e-63
Identity = 110/200 (55.00%), Postives = 134/200 (67.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMC--ADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTG++EGQL RK+G L+SLSEQQ+VDC +   +  CNGG + +   YI+  GGI+  +DYPYVSG T+  N +C F + K V T TGFV +  G+EE LR AL   GPISIA  A       Y +GIY D  C  A   +NHAVLLVGYG   E G PYWI+KNSWGP WGE+GY RM RNK N+C +A  S +PLV
Sbjct:  164 AFSTTGSIEGQLKRKSGQLVSLSEQQLVDCSTNYNNLGCNGGLMDNAFEYIQDAGGIQRSEDYPYVSGETESQNDQCGFDRSKAVATVTGFVDVDSGNEEELRRALYFHGPISIAIDAGQQSFMSYHSGIYDDPRCQNAPSELNHAVLLVGYGV--EKGVPYWIVKNSWGPNWGESGYIRMRRNKNNLCGVATASSFPLV 361          
BLAST of Cathepsin L vs. TrEMBL
Match: gnl|BL_ORD_ID|18723700 (tr|A0A0X3NKX4|A0A0X3NKX4_SCHSO Cathepsin L OS=Schistocephalus solidus OX=70667 GN=CATL PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.690e-63
Identity = 110/200 (55.00%), Postives = 134/200 (67.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMC--ADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTG++EGQL RK+G L+SLSEQQ+VDC +   +  CNGG + +   YI+  GGI+  +DYPYVSG T+  N +C F + K V T TGFV +  G+EE LR AL   GPISIA  A       Y +GIY D  C  A   +NHAVLLVGYG   E G PYWI+KNSWGP WGE+GY RM RNK N+C +A  S +PLV
Sbjct:  195 AFSTTGSIEGQLKRKSGQLVSLSEQQLVDCSTNYNNLGCNGGLMDNAFEYIQDAGGIQRSEDYPYVSGETESQNDQCGFDRSKAVATVTGFVDVDSGNEEELRRALYFHGPISIAIDAGQQSFMSYHSGIYDDPRCQNAPSELNHAVLLVGYGV--EKGVPYWIVKNSWGPNWGESGYIRMRRNKNNLCGVATASSFPLV 392          
BLAST of Cathepsin L vs. TrEMBL
Match: gnl|BL_ORD_ID|167409579 (tr|A0A3P7SXS5|A0A3P7SXS5_RODNA Pept_C1 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS5947 PE=3 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.392e-62
Identity = 102/200 (51.00%), Postives = 131/200 (65.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYA---CNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMC--ADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFS  GA+EGQ  R +G L+SLSEQQ+VDC SFD+    CNGG + +   Y+K+ GG+++E+DYPYVSG T++PN  C F     V   TG V +P G EE L+EAL   GPIS+A +A PL    Y  GIY D  C      +NH VLLVGYG   E+G PYW+IKNSWG  WGENGY R++R  N+C +   + YP++
Sbjct:   23 AFSAIGAIEGQYQRASGKLVSLSEQQLVDC-SFDFGNEGCNGGLMDNAFRYVKKAGGVDTEKDYPYVSGVTQEPNDNCSFNAAGAVAKVTGLVDIPSGKEELLKEALAYNGPISVAINAGPLSFMMYHEGIYDDPDCRGGSESLNHGVLLVGYG--HENGIPYWLIKNSWGTGWGENGYVRIKRGGNLCGVETAASYPMI 219          
BLAST of Cathepsin L vs. TrEMBL
Match: gnl|BL_ORD_ID|167410705 (tr|A0A0R3TFW0|A0A0R3TFW0_RODNA Pept_C1 domain-containing protein OS=Rodentolepis nana OX=102285 PE=3 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.430e-62
Identity = 102/200 (51.00%), Postives = 131/200 (65.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYA---CNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMC--ADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFS  GA+EGQ  R +G L+SLSEQQ+VDC SFD+    CNGG + +   Y+K+ GG+++E+DYPYVSG T++PN  C F     V   TG V +P G EE L+EAL   GPIS+A +A PL    Y  GIY D  C      +NH VLLVGYG   E+G PYW+IKNSWG  WGENGY R++R  N+C +   + YP++
Sbjct:   23 AFSAIGAIEGQYQRASGKLVSLSEQQLVDC-SFDFGNEGCNGGLMDNAFRYVKKAGGVDTEKDYPYVSGVTQEPNDNCSFNAAGAVAKVTGLVDIPSGKEELLKEALAYNGPISVAINAGPLSFMMYHEGIYDDPDCRGGSESLNHGVLLVGYG--HENGIPYWLIKNSWGTGWGENGYVRIKRGGNLCGVETAASYPMI 219          
BLAST of Cathepsin L vs. TrEMBL
Match: gnl|BL_ORD_ID|17222191 (tr|A0A3S1HRE2|A0A3S1HRE2_ELYCH Pept_C1 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_007579 PE=3 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 8.873e-62
Identity = 101/198 (51.01%), Postives = 132/198 (66.67%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFSTTG+LEGQ F+KTGNL SLSEQQ+VDC +   +  C GG + +   YIK+N G+++EQ YPY    T K  + C F    +  TDTGFV +  G EEAL++AL  IGPIS+A  A  +    Y+ GIY +  C+ VR++H VL VGYG+  E G  YWI+KNSWG  WG+ GYF++ RN  NMC +A ++ YPLV
Sbjct:   49 AFSTTGSLEGQNFKKTGNLTSLSEQQLVDCSAKFGNKGCKGGLMDNAFKYIKENNGLDTEQSYPY----TAKTGRTCKFNPSAVGATDTGFVDVKRGSEEALQQALAEIGPISVAMDAGHMSFQHYRTGIYTERECSSVRLDHGVLAVGYGS--EGGKDYWIVKNSWGTIWGDEGYFKIARNDHNMCGLATSASYPLV 240          
BLAST of Cathepsin L vs. Ensembl Cavefish
Match: ENSAMXT00000001970.2 (cathepsin L1-like [Source:NCBI gene;Acc:103022163])

HSP 1 Score: 195.282 bits (495), Expect = 1.518e-61
Identity = 101/198 (51.01%), Postives = 134/198 (67.68%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDC-DSF-DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASP-LLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG LISLSEQQ+VDC  SF +  CNGG+ + +  YIK + G+E++  YPY     K   + C F  ++++ T +GF SLP GDE AL+ A+ +IGPIS+    S      YK+G+Y +  C+  ++NHAVLLVGY  D  +G PYW++KNSWG  WG+NGY +M RNK N C +A  + YPLV
Sbjct:  143 AFSATGALEGQMFRKTGKLISLSEQQLVDCSQSFGNLGCNGGWPSKSFDYIKSSKGLEADFTYPY-----KARKEICRFNPQRVIATCSGFKSLPKGDENALKNAVASIGPISVLIDTSKHTFQLYKSGVYDEPGCSSTKLNHAVLLVGYDND-PTGKPYWLVKNSWGINWGDNGYIKMSRNKMNQCGIATIATYPLV 334          
BLAST of Cathepsin L vs. Ensembl Cavefish
Match: ENSAMXT00000034892.1 (cathepsin L1-like [Source:NCBI gene;Acc:107196839])

HSP 1 Score: 195.282 bits (495), Expect = 1.776e-61
Identity = 101/198 (51.01%), Postives = 134/198 (67.68%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDC-DSF-DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASP-LLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG LISLSE+Q+VDC  SF +  CNGG+ + +  YIK N G+E++  YPY     K   + C F  +++V T +GF  LP GDE AL++A+  IGPIS+A   S      YK+G+Y +  C+  R+NHAV+LVGYG +   G  YW++KNSWG  WG+NGY +M RNK N C +A ++ YPLV
Sbjct:  144 AFSATGALEGQMFRKTGKLISLSEKQLVDCSQSFGNRGCNGGWPSKSFEYIKSNQGLEADFTYPY-----KPREETCRFNPQRVVATCSGFECLPQGDENALKKAVAKIGPISVAIDTSKHTFQLYKSGVYDEPGCSSTRLNHAVVLVGYG-NAPRGKQYWLVKNSWGIGWGDNGYIKMSRNKMNQCGIATDATYPLV 335          
BLAST of Cathepsin L vs. Ensembl Cavefish
Match: ENSAMXT00000050895.1 (cathepsin L1-like [Source:NCBI gene;Acc:107196839])

HSP 1 Score: 195.667 bits (496), Expect = 5.046e-61
Identity = 101/198 (51.01%), Postives = 134/198 (67.68%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDC-DSF-DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASP-LLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG LISLSE+Q+VDC  SF +  CNGG+ + +  YIK N G+E++  YPY     K   + C F  +++V T +GF  LP GDE AL++A+  IGPIS+A   S      YK+G+Y +  C+  R+NHAV+LVGYG +   G  YW++KNSWG  WG+NGY +M RNK N C +A ++ YPLV
Sbjct:  193 AFSATGALEGQMFRKTGKLISLSEKQLVDCSQSFGNRGCNGGWPSKSFEYIKSNQGLEADFTYPY-----KPREETCRFNPQRVVATCSGFECLPQGDENALKKAVAKIGPISVAIDTSKHTFQLYKSGVYDEPGCSSTRLNHAVVLVGYG-NAPRGKQYWLVKNSWGIGWGDNGYIKMSRNKMNQCGIATDATYPLV 384          
BLAST of Cathepsin L vs. Ensembl Cavefish
Match: ENSAMXT00000036468.1 (cathepsin L1-like [Source:NCBI gene;Acc:107196839])

HSP 1 Score: 195.667 bits (496), Expect = 5.046e-61
Identity = 101/198 (51.01%), Postives = 134/198 (67.68%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDC-DSF-DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASP-LLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG LISLSE+Q+VDC  SF +  CNGG+ + +  YIK N G+E++  YPY     K   + C F  +++V T +GF  LP GDE AL++A+  IGPIS+A   S      YK+G+Y +  C+  R+NHAV+LVGYG +   G  YW++KNSWG  WG+NGY +M RNK N C +A ++ YPLV
Sbjct:  193 AFSATGALEGQMFRKTGKLISLSEKQLVDCSQSFGNRGCNGGWPSKSFEYIKSNQGLEADFTYPY-----KPREETCRFNPQRVVATCSGFECLPQGDENALKKAVAKIGPISVAIDTSKHTFQLYKSGVYDEPGCSSTRLNHAVVLVGYG-NAPRGKQYWLVKNSWGIGWGDNGYIKMSRNKMNQCGIATDATYPLV 384          
BLAST of Cathepsin L vs. Ensembl Cavefish
Match: ENSAMXT00000040914.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000030.1:116984:135874:-1 gene:ENSAMXG00000037672.1 transcript:ENSAMXT00000040914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 7.310e-60
Identity = 96/196 (48.98%), Postives = 131/196 (66.84%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TGALEGQ+FRKTG L+SLSEQQ+VDC + ++ C+GG++     Y+ +N G+++E  YPY     +    KC F  + +  T TG+ S   GDE+AL+EA+ TIGPIS+   A  +    Y +G+Y++  C+  +  HAVL+VGYGT  E+G  YW++KNSWG  WGENGY +M RNK N C +A   YYPLV
Sbjct:  140 AFSVTGALEGQMFRKTGRLVSLSEQQLVDCTTRNFGCDGGYLDRAFDYVMKNRGLDTEASYPY-----EDRQWKCRFNPKTVGATCTGYRSTRSGDEKALQEAVATIGPISVVIDAGQVSFQQYTSGVYNEPHCSSGKY-HAVLVVGYGT--ENGQDYWLVKNSWGTLWGENGYIKMSRNKYNQCGIATEPYYPLV 327          
BLAST of Cathepsin L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010475.1 (pep scaffold:Pmarinus_7.0:GL482653:10321:33550:-1 gene:ENSPMAG00000009483.1 transcript:ENSPMAT00000010475.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.889 bits (481), Expect = 1.425e-60
Identity = 99/198 (50.00%), Postives = 130/198 (65.66%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFD--YACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMER-NKNMCNMAYNSYYPLV 584
            +FSTTG+LEGQ  RKTG L+SLSEQ +VDC S +  + CNGG + +   YIK+NGGI+SE+ YPY     K   + C +  +      TG+V +P GDEEAL  A+ ++GP+S+A  AS      Y +GIY D MC+   I+HAVL+VGYG D E G  +W++KNSWG  WGE GY RM R + N+C +A  S YPLV
Sbjct:  103 SFSTTGSLEGQHKRKTGVLVSLSEQNLVDCSSTEGNHGCNGGLMINAFNYIKKNGGIDSEESYPY-----KGQVETCKYDPKNKAAEVTGYVEIPEGDEEALMNAVASVGPVSVAIDASLASFQSYGSGIYKDAMCSH-HIDHAVLVVGYGVD-EMGQKFWLVKNSWGVTWGEQGYVRMARDDNNLCGIATMSSYPLV 293          
BLAST of Cathepsin L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003800.1 (pep scaffold:Pmarinus_7.0:GL485125:12828:20107:1 gene:ENSPMAG00000003453.1 transcript:ENSPMAT00000003800.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.119 bits (479), Expect = 3.293e-60
Identity = 98/198 (49.49%), Postives = 133/198 (67.17%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFD--YACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMER-NKNMCNMAYNSYYPLV 584
            +FSTTG+LEGQ  RKTG L+SLSEQ +VDC S +  Y CNGG + +   YIK+NGGI+SE+ YPY      +  + C +  +      TG+V +P GDEEAL+ A+ ++GP+S+A  AS      Y +GIY D +C+ + INHAVL+VGYG DE+ G  +W++KNSWG  WGE GY RM R + N+C +A  + YPLV
Sbjct:  104 SFSTTGSLEGQHKRKTGVLVSLSEQNLVDCSSTEGNYGCNGGLMINAFNYIKKNGGIDSEESYPY----KGQGVETCKYNPKNKAAEVTGYVEIPEGDEEALKNAVASVGPVSVAIDASLNSFLYYISGIYKDKLCSHI-INHAVLVVGYGVDEK-GDKFWLVKNSWGVQWGEKGYVRMARDDNNLCGIAVTASYPLV 295          
BLAST of Cathepsin L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011285.1 (pep scaffold:Pmarinus_7.0:GL499136:454:1347:-1 gene:ENSPMAG00000010258.1 transcript:ENSPMAT00000011285.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.644 bits (457), Expect = 5.611e-57
Identity = 94/198 (47.47%), Postives = 129/198 (65.15%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFD--YACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTG+LEGQ  RKTG L+SLSEQ +VDC S +    C GG +    TYIK+NGGI+SE  YPY +      ++ C +  +     DTGFV +P G+EEAL+ A+ ++GP+SI   AS      Y +GIY D  C++  ++H VL+VGYG D++    +WI+KNSWG  WG++GY  M R+K N+C +A  + YPLV
Sbjct:  107 AFSTTGSLEGQHKRKTGVLVSLSEQNLVDCSSAEGNNGCKGGLMDLAFTYIKKNGGIDSEASYPYTA-----KDENCKYNPKNKAAEDTGFVDIPSGNEEALKNAVASVGPVSIGIDASLESFQLYSSGIYSDSDCSN-NLDHGVLVVGYGVDDDE-RKFWIVKNSWGTKWGDHGYILMARDKDNLCGIATAASYPLV 297          
BLAST of Cathepsin L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006499.1 (pep scaffold:Pmarinus_7.0:GL477089:42202:47941:1 gene:ENSPMAG00000005817.1 transcript:ENSPMAT00000006499.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 8.557e-55
Identity = 93/200 (46.50%), Postives = 123/200 (61.50%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFD--YACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD--EESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFSTTGALEGQ  RK G L+SLSEQ +VDC   +    C GG +     Y+K NGGI+SE  YPY    T     KC++  +     DTGFV +  GDE+AL+ A+ ++GP+S+A  AS      Y++G+Y +  C+   ++H VL+VGYG     E+G  YWI+KNSW P WG+ GY  M RN KN C +A  + YPLV
Sbjct:  144 AFSTTGALEGQHMRKVGQLVSLSEQNLVDCSRAEGNQGCGGGLMDQAFQYVKDNGGIDSEAAYPY----TGTDGDKCHYDPKFNSANDTGFVDVTSGDEKALKIAVASVGPVSVAIDASHESFQFYQSGVYFEPDCSSQDLDHGVLVVGYGVKGTGENGKKYWIVKNSWSPKWGDEGYVLMARNKKNHCGIATAASYPLV 339          
BLAST of Cathepsin L vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007755.1 (pep scaffold:Pmarinus_7.0:GL476381:1843:17023:-1 gene:ENSPMAG00000007008.1 transcript:ENSPMAT00000007755.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 1.180e-47
Identity = 90/199 (45.23%), Postives = 121/199 (60.80%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDS--FDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSL-PPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TG+LEGQ F  TGNL SLSEQQ+VDC    ++  CNGG     L YI  N GI+SE  YPY     +  + KC FK   +    + +  + P  +EE LR+A+ ++GPI+IA +A       YK+G++++  C D   NHA+L+VGYG+   SG  +WI+KNSWG  WGE GY  M RNK N C +A    YP++
Sbjct:  143 AFSATGSLEGQHFAATGNLTSLSEQQLVDCTKSYYNNGCNGGRSERALQYIIDNNGIDSELSYPY-----EHADGKCRFKPANVATKCSSYQFVEPSSNEEVLRQAVASVGPIAIAMNADLDTFKHYKSGLFNEPSC-DKSPNHAMLVVGYGS--LSGNDFWIVKNSWGEDWGEKGYIYMIRNKDNQCGIASIGIYPII 333          
BLAST of Cathepsin L vs. Ensembl Nematostella
Match: EDO45852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL9])

HSP 1 Score: 199.519 bits (506), Expect = 1.182e-63
Identity = 100/198 (50.51%), Postives = 132/198 (66.67%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFSTTGALEGQ FRKTG L+SLSEQ +VDC     +  C GG + +   YIK+NGGI++E+ YPY++      +  C++ K  I   DTGFV +P GDE AL++AL ++GPISIA  AS      Y  G+Y D  C+  R++H VL VGYGTD+  G  YW++KNSWGP+WGE GY ++ RN  + C +A  + YPLV
Sbjct:  141 AFSTTGALEGQHFRKTGKLVSLSEQNLVDCSGKYGNNGCEGGLMDNAFQYIKENGGIDTEKSYPYLA-----KDGVCHYNKSAIGAKDTGFVDIPTGDENALQQALASVGPISIAIDASQSTFHFYHQGVYDDPDCSSTRLDHGVLAVGYGTDD--GKDYWLVKNSWGPSWGEEGYIKIARNDHDKCGVASKASYPLV 331          
BLAST of Cathepsin L vs. Ensembl Nematostella
Match: EDO36727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHX1])

HSP 1 Score: 188.734 bits (478), Expect = 2.281e-59
Identity = 96/198 (48.48%), Postives = 129/198 (65.15%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTG+LEGQ F+KTG L+SLSEQ +VDC +   +  C GG +     YIK+NGGI++E+ YPY     +  N +C F+K  I   DTGFV +  GDEEAL+ A  T+GPIS+A  A  +    Y +G+Y++  C+   ++H VL+VGYGT +  G+ YW++KNSWG  WG  GY  M RNK N C +A  + YPLV
Sbjct:  140 AFSTTGSLEGQNFKKTGKLVSLSEQNLVDCSTAYGNNGCQGGLMDYAFKYIKENGGIDTEESYPY-----EARNDRCRFQKSNIGAVDTGFVDVTHGDEEALKTAAGTVGPISVAIDAGHMSFQFYHSGVYNNAGCSSTSLDHGVLVVGYGTYQ--GSDYWLVKNSWGERWGMEGYIMMSRNKNNQCGVATQASYPLV 330          
BLAST of Cathepsin L vs. Ensembl Nematostella
Match: EDO46465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPY5])

HSP 1 Score: 175.252 bits (443), Expect = 3.289e-54
Identity = 91/198 (45.96%), Postives = 121/198 (61.11%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+TG+LEGQ FRKTG L+SLSEQ +VDC     +  C GG +     YIK N GI++EQ YPY +      + +C+FK   +  T TG+  +  G E  L+ A+ T+GPIS+A  A       YK G+Y +  C+  +++H VL VGYG   E G  YW++KNSWG  WG NGY +M RNK N C +A  + YPLV
Sbjct:  135 AFSSTGSLEGQHFRKTGKLVSLSEQNLVDCSKKYGNNGCEGGLMDYAFKYIKNNDGIDTEQSYPYTA-----RDGQCHFKPGSVGATVTGYTDVQRGSEGDLQSAVATVGPISVAIDAGHSSFQLYKTGVYSEPDCSSTQLDHGVLAVGYGA--EDGKDYWLVKNSWGEGWGMNGYIKMSRNKDNQCGIATQASYPLV 325          
BLAST of Cathepsin L vs. Ensembl Nematostella
Match: EDO45953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH6])

HSP 1 Score: 171.785 bits (434), Expect = 5.930e-53
Identity = 85/197 (43.15%), Postives = 124/197 (62.94%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTG++EGQ FRKTG+L+SLSEQ ++DC     +  C GG + +   YI+ NGGI++E  YPY+          C+F    +    TG+  +P G E+AL+ A+ T+GP+S+A  AS     Y +G+Y +  C+  +++H VL++GYG    +G  YW++KNSWG +WG  GY  M RNK N C +A ++ YPLV
Sbjct:  138 AFSTTGSVEGQHFRKTGSLVSLSEQNLIDCSGSYGNNGCQGGLMDNAFRYIESNGGIDTESSYPYLG-----QQGSCHFSSSHVGARVTGYQDIPQGSEQALQSAVATVGPVSVAVDASQ-WQFYSSGVYDNPYCSSTQLDHGVLVIGYGN--YNGQDYWLVKNSWGYSWGVEGYIMMSRNKNNQCGIASSASYPLV 326          
BLAST of Cathepsin L vs. Ensembl Nematostella
Match: EDO42751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0K3])

HSP 1 Score: 154.066 bits (388), Expect = 1.247e-46
Identity = 85/187 (45.45%), Postives = 113/187 (60.43%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDY--MCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNM 557
            AFSTTG +EGQ   KTG L+SLSEQ++VDCD+ D  C GG  ++    I++ GG+ESE DYPY     K  + KC F K ++  T    V +   DE+ +   L   GPISI  +A+  +  Y  GI H +   C    +NH VL+VGYG   ++GTPYWIIKNSWGP+WGE GY+ + R    C +
Sbjct:   89 AFSTTGNIEGQYAIKTGKLVSLSEQELVDCDTIDKGCEGGLPSNAYKQIEKLGGLESESDYPY-----KGADSKCKFNKAEVKVTINSSVVISK-DEKEIAAWLAKNGPISIGINAN-AMQFYMGGIAHPWKIFCNPSSLNHGVLIVGYGV--KNGTPYWIIKNSWGPSWGEKGYYLIYRGGGCCGL 266          
BLAST of Cathepsin L vs. Ensembl Medaka
Match: ctsl.1 (cathepsin L1 [Source:NCBI gene;Acc:101171789])

HSP 1 Score: 186.422 bits (472), Expect = 4.692e-58
Identity = 93/198 (46.97%), Postives = 131/198 (66.16%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDC--DSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPL-LSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS TG+LEGQ FRKTG L+SLSEQQ+VDC  D  +  C GG + D   YI+  GGI++E+ YPY     +  + +C +K + +  T TG+V +  GDE+AL+EA+ TIGPIS+   AS +    Y++G+Y +  C+   ++H VL VGYG+  E+G  YW++KNSWG  WG+ GY +M +NK N C +A  + YPLV
Sbjct:  149 AFSATGSLEGQTFRKTGKLVSLSEQQLVDCSGDYGNMGCGGGLMDDAFRYIQATGGIDTEESYPY-----EAEDGECRYKPDAVGATCTGYVDVSSGDEDALQEAVATIGPISVGIDASHISFQLYESGLYDEPQCSSSELDHGVLAVGYGS--ENGQDYWLVKNSWGLTWGDQGYIKMSKNKSNQCGIATAASYPLV 339          
BLAST of Cathepsin L vs. Ensembl Medaka
Match: ctss2.1 (cathepsin S [Source:NCBI gene;Acc:101165175])

HSP 1 Score: 171.014 bits (432), Expect = 4.874e-52
Identity = 92/198 (46.46%), Postives = 122/198 (61.62%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKN-MCNMAYNSYYPLV 584
            AFS  GALEGQL RKTG L+ LS Q +VDC S   ++ CNGGF+     Y+  N GI+S+  YPYV        + C++  E      + +  LP GDE AL+EA+ TIGPIS+A  A+ P  + Y++G+Y D  C+   +NH VL VGYGT   +G  YW++KNSWG  +GE GY RM RNKN  C +A    YP++
Sbjct:  150 AFSAVGALEGQLCRKTGKLVDLSPQNLVDCSSKYGNHGCNGGFMHQAFQYVIDNQGIDSDAGYPYVG-----VTQNCHYSSEYRAANCSQYSFLPEGDEGALKEAIATIGPISVAIDATRPRFAFYRSGVYDDSSCSQ-NVNHGVLAVGYGT--LNGQDYWLVKNSWGTTFGEQGYIRMARNKNDQCGIAMYGCYPIM 339          
BLAST of Cathepsin L vs. Ensembl Medaka
Match: ctsl (cathepsin L [Source:NCBI gene;Acc:100049246])

HSP 1 Score: 167.933 bits (424), Expect = 7.807e-51
Identity = 89/200 (44.50%), Postives = 122/200 (61.00%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCD--SFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSA-SPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEE--SGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFSTTGALEGQ FRKTG L+SLSEQ +VDC     +  CNGG +     Y+K N G++SE  YPY  G   +P   C +  +     DTGFV +P G E AL +A+ ++GP+S+A  A       Y++GIY +  C+   ++H VL+VGYG + E   G  YWI+KNSW   WG+ G+  M +++ N C +A  + YPLV
Sbjct:  141 AFSTTGALEGQQFRKTGKLVSLSEQNLVDCSRPEGNEGCNGGLMDQAFQYVKDNQGLDSEDFYPY-KGTDDQP---CQYNAQYSAVNDTGFVDIPSGKERALMKAVASVGPVSVAIDAGHESFQFYQSGIYFEKECSSDELDHGVLVVGYGFEGEDVDGKKYWIVKNSWSEKWGDKGFIYMAKDRHNHCGIATAASYPLV 336          
BLAST of Cathepsin L vs. Ensembl Medaka
Match: ctsk (cathepsin K [Source:NCBI gene;Acc:101164922])

HSP 1 Score: 166.392 bits (420), Expect = 2.503e-50
Identity = 86/196 (43.88%), Postives = 119/196 (60.71%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASP-LLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNK-NMCNMAYNSYYPLV 584
            AFS+ GALEGQL +KTGNL+ LS Q +VDC + +  C GG++T+   Y+++NGGI+SE  YPY+       ++ C +    +     G+  +P GDE AL  AL   GP+S+   AS      Y+ GIY D  C    INHAVL VGYG + + G  +WI+KNSWG  WG  GY  M RN+ N+C +A  + YP++
Sbjct:  142 AFSSVGALEGQLAKKTGNLVDLSPQNLVDCVTENDGCGGGYMTNAFKYVQENGGIDSEAAYPYMG-----EDQPCRYNVSGLAAQIKGYKEVPEGDEHALAVALFKAGPVSVGIDASQNSFLYYQKGIYFDRNCNKEDINHAVLAVGYGVNAK-GKKFWIVKNSWGETWGNKGYVLMARNRGNVCGIANLASYPVM 331          
BLAST of Cathepsin L vs. Ensembl Medaka
Match: ctss (cathepsin S [Source:NCBI gene;Acc:100049247])

HSP 1 Score: 164.851 bits (416), Expect = 9.160e-50
Identity = 88/198 (44.44%), Postives = 124/198 (62.63%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSF--DYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSAS-PLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERN-KNMCNMAYNSYYPLV 584
            AFS  GALEGQL + TG L SLS Q +VDC +   +Y C GGF+++   Y+ +N GI S+  YPY+  R      KC +  +      TG+  LP GDE AL+  + TIGPIS+A  AS P    Y++G+Y D+ C+   +NH VL+VGYGT  E+G  YW++KNSWG  +G+ GY +M RN +N C +A  + +P++
Sbjct:  138 AFSAVGALEGQLKKTTGILTSLSPQNLVDCSTKYGNYGCKGGFMSNAFQYVIKNQGISSDAAYPYIGKR-----DKCKYDSKHRAANCTGYNFLPKGDEFALKVGVATIGPISVAIDASRPKFLFYRHGVYKDHSCSH-NVNHGVLVVGYGT--ENGEDYWLVKNSWGERYGDGGYIKMARNRRNQCGIALYACFPVM 327          
BLAST of Cathepsin L vs. Planmine SMEST
Match: SMESG000034294.1 (SMESG000034294.1)

HSP 1 Score: 337.806 bits (865), Expect = 2.752e-117
Identity = 160/194 (82.47%), Postives = 169/194 (87.11%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFSTTGALEGQLFRKTGNLISLSEQQIVDCD  DY C+GG V D   YIK +GGIESEQ+YPYVSG TKKPN  C FK++K VGTDTGFV LPPGDEEALREALVTIGPISIAFSA+     YKNGIYHD  C++VRINH VLLVGYGTDEESGTPYWIIKNSWGP WGE+GYFR ERNKNMCNMAYNSYYPLV
Sbjct:  166 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDHVDYGCSGGLVPDAFNYIKYSGGIESEQEYPYVSGLTKKPNPNCNFKEKKAVGTDTGFVKLPPGDEEALREALVTIGPISIAFSATEQFKHYKNGIYHDDWCSNVRINHGVLLVGYGTDEESGTPYWIIKNSWGPKWGESGYFRFERNKNMCNMAYNSYYPLV 359          
BLAST of Cathepsin L vs. Planmine SMEST
Match: SMESG000054075.1 (SMESG000054075.1)

HSP 1 Score: 337.806 bits (865), Expect = 3.386e-117
Identity = 159/194 (81.96%), Postives = 170/194 (87.63%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AFSTTGALEGQLFRKTGNLISLSEQQIVDCD  DY C+GG V D L YIK +GGIESEQ+YPY+SG  KKPN  C FK+++ VGTDTGFV LPPGDEEALREALVTIGPISIAFSA+     YKNGIYHD  C++VRINHAVLLVGYGTDEESGTPYWIIKNSWGP WGE+GYFR ERNKNMCNMAYNSYYPLV
Sbjct:  166 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDHVDYGCSGGLVPDALNYIKYSGGIESEQEYPYISGLKKKPNPNCNFKEKEAVGTDTGFVKLPPGDEEALREALVTIGPISIAFSATERFKHYKNGIYHDDWCSNVRINHAVLLVGYGTDEESGTPYWIIKNSWGPKWGESGYFRFERNKNMCNMAYNSYYPLV 359          
BLAST of Cathepsin L vs. Planmine SMEST
Match: SMESG000063517.1 (SMESG000063517.1)

HSP 1 Score: 270.396 bits (690), Expect = 9.074e-91
Identity = 124/194 (63.92%), Postives = 149/194 (76.80%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AF+TTG LE Q++RKTG LISLSEQQIVDCD+ D  C+GGFV D L+YIK NGGIE+E+ YPY+S  T KPN KC F K K+V TDTGFV +P  DE  ++EALVTIGPIS+A SA+  L  Y +GI+H+  C  +++NHAVL+VGYGTD+ SGTPYWIIKNSW   WGENGYFR+ RN N C +A    YPLV
Sbjct:  165 AFATTGTLEAQIWRKTGKLISLSEQQIVDCDTNDDGCDGGFVQDALSYIKSNGGIENEESYPYISSETFKPNSKCNFFKSKVVATDTGFVQMPANDETKMKEALVTIGPISVAISATKSLKRYTSGIFHEDECDKLKLNHAVLIVGYGTDQTSGTPYWIIKNSWSSFWGENGYFRLPRNINACKVAMMPVYPLV 358          
BLAST of Cathepsin L vs. Planmine SMEST
Match: SMESG000063517.1 (SMESG000063517.1)

HSP 1 Score: 270.396 bits (690), Expect = 9.956e-91
Identity = 124/194 (63.92%), Postives = 149/194 (76.80%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AF+TTG LE Q++RKTG LISLSEQQIVDCD+ D  C+GGFV D L+YIK NGGIE+E+ YPY+S  T KPN KC F K K+V TDTGFV +P  DE  ++EALVTIGPIS+A SA+  L  Y +GI+H+  C  +++NHAVL+VGYGTD+ SGTPYWIIKNSW   WGENGYFR+ RN N C +A    YPLV
Sbjct:  162 AFATTGTLEAQIWRKTGKLISLSEQQIVDCDTNDDGCDGGFVQDALSYIKSNGGIENEESYPYISSETFKPNSKCNFFKSKVVATDTGFVQMPANDETKMKEALVTIGPISVAISATKSLKRYTSGIFHEDECDKLKLNHAVLIVGYGTDQTSGTPYWIIKNSWSSFWGENGYFRLPRNINACKVAMMPVYPLV 355          
BLAST of Cathepsin L vs. Planmine SMEST
Match: SMESG000063471.1 (SMESG000063471.1)

HSP 1 Score: 264.618 bits (675), Expect = 1.986e-88
Identity = 124/194 (63.92%), Postives = 145/194 (74.74%), Query Frame = 3
Query:    3 AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIKQNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEALREALVTIGPISIAFSASPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTDEESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV 584
            AF+ TG LE Q++RKTG LISLSEQQIVDCD+ D  C GGFV D L+YIK NGGIE+E++YPYVSG+T   N KC F K K+V TDTGFV +P  DEE L+EALVTIGPIS   SA   L  Y  GI++D  C  +R+NHAVL+VGYGTD+ SGTPYWIIKNSW  +WGE GYFR+ RN N C +A    YPLV
Sbjct:  165 AFAATGTLEAQIWRKTGKLISLSEQQIVDCDTNDNNCYGGFVQDALSYIKSNGGIENEENYPYVSGKTADMNPKCNFVKSKVVATDTGFVKMPANDEEKLKEALVTIGPISALLSAPKSLIKYSKGIFYDKECEKLRVNHAVLIVGYGTDQTSGTPYWIIKNSWNASWGEKGYFRLPRNINACKIASVPVYPLV 358          
The following BLAST results are available for this feature:
BLAST of Cathepsin L vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTSV2.711e-5746.50cathepsin V [Source:HGNC Symbol;Acc:HGNC:2538][more]
CTSV2.711e-5746.50cathepsin V [Source:HGNC Symbol;Acc:HGNC:2538][more]
CTSL1.392e-4944.50cathepsin L [Source:HGNC Symbol;Acc:HGNC:2537][more]
CTSL1.392e-4944.50cathepsin L [Source:HGNC Symbol;Acc:HGNC:2537][more]
CTSK4.460e-4843.30cathepsin K [Source:HGNC Symbol;Acc:HGNC:2536][more]
back to top
BLAST of Cathepsin L vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpl-17.044e-6249.49CathePsin L family [Source:UniProtKB/TrEMBL;Acc:H... [more]
cpl-17.044e-6249.49CathePsin L family [Source:UniProtKB/TrEMBL;Acc:H... [more]
cpl-12.206e-6049.49CathePsin L family [Source:UniProtKB/TrEMBL;Acc:H... [more]
tag-1965.477e-4644.90pep chromosome:WBcel235:V:8594914:8597500:1 gene:W... [more]
tag-1965.477e-4644.90pep chromosome:WBcel235:V:8594914:8597469:1 gene:W... [more]
back to top
BLAST of Cathepsin L vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cp16.753e-6147.98gene:FBgn0013770 transcript:FBtr0304021[more]
Cp15.466e-6047.98gene:FBgn0013770 transcript:FBtr0087592[more]
Cp17.603e-6047.98gene:FBgn0013770 transcript:FBtr0339955[more]
Cp11.054e-5947.98gene:FBgn0013770 transcript:FBtr0087593[more]
CG53675.044e-4941.62gene:FBgn0032228 transcript:FBtr0080055[more]
back to top
BLAST of Cathepsin L vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-239j18.36.488e-5546.50si:dkey-239j18.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
zgc:1741538.048e-5546.50zgc:174153 [Source:ZFIN;Acc:ZDB-GENE-080215-7][more]
ctslb8.403e-5546.50cathepsin Lb [Source:ZFIN;Acc:ZDB-GENE-980526-285][more]
ctslb9.562e-5546.50cathepsin Lb [Source:ZFIN;Acc:ZDB-GENE-980526-285][more]
ctslb1.124e-5446.50cathepsin Lb [Source:ZFIN;Acc:ZDB-GENE-980526-285][more]
back to top
BLAST of Cathepsin L vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsk9.253e-5544.39cathepsin K (pycnodysostosis) [Source:NCBI gene;Ac... [more]
ctsk1.407e-5444.39cathepsin K (pycnodysostosis) [Source:NCBI gene;Ac... [more]
fcrl21.172e-5144.00Fc receptor-like 2 [Source:Xenbase;Acc:XB-GENE-590... [more]
fcrl21.571e-5144.00Fc receptor-like 2 [Source:Xenbase;Acc:XB-GENE-590... [more]
harbi11.134e-4844.39harbinger transposase derived 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Cathepsin L vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctsl1.084e-5245.00cathepsin L [Source:MGI Symbol;Acc:MGI:88564][more]
Ctsl1.084e-5245.00cathepsin L [Source:MGI Symbol;Acc:MGI:88564][more]
4930486L24Rik3.805e-5243.50RIKEN cDNA 4930486L24 gene [Source:MGI Symbol;Acc:... [more]
Ctsk1.923e-5143.81cathepsin K [Source:MGI Symbol;Acc:MGI:107823][more]
Ctss9.327e-4945.50cathepsin S [Source:MGI Symbol;Acc:MGI:107341][more]
back to top
BLAST of Cathepsin L vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26636|CATL_SARPE2.312e-6150.00Cathepsin L OS=Sarcophaga peregrina OX=7386 PE=1 S... [more]
sp|O45734|CPL1_CAEEL2.806e-5949.49Cathepsin L-like OS=Caenorhabditis elegans OX=6239... [more]
sp|Q95029|CATL_DROME1.056e-5847.98Cathepsin L OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|O60911|CATL2_HUMAN1.302e-5646.50Cathepsin L2 OS=Homo sapiens OX=9606 GN=CTSV PE=1 ... [more]
sp|P09648|CATL1_CHICK3.088e-5646.97Cathepsin L1 (Fragments) OS=Gallus gallus OX=9031 ... [more]
back to top
BLAST of Cathepsin L vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|163344581.084e-6355.00tr|A0A183T8C8|A0A183T8C8_SCHSO Uncharacterized pro... [more]
gnl|BL_ORD_ID|187237002.690e-6355.00tr|A0A0X3NKX4|A0A0X3NKX4_SCHSO Cathepsin L OS=Schi... [more]
gnl|BL_ORD_ID|1674095793.392e-6251.00tr|A0A3P7SXS5|A0A3P7SXS5_RODNA Pept_C1 domain-cont... [more]
gnl|BL_ORD_ID|1674107053.430e-6251.00tr|A0A0R3TFW0|A0A0R3TFW0_RODNA Pept_C1 domain-cont... [more]
gnl|BL_ORD_ID|172221918.873e-6251.01tr|A0A3S1HRE2|A0A3S1HRE2_ELYCH Pept_C1 domain-cont... [more]
back to top
BLAST of Cathepsin L vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000001970.21.518e-6151.01cathepsin L1-like [Source:NCBI gene;Acc:103022163][more]
ENSAMXT00000034892.11.776e-6151.01cathepsin L1-like [Source:NCBI gene;Acc:107196839][more]
ENSAMXT00000050895.15.046e-6151.01cathepsin L1-like [Source:NCBI gene;Acc:107196839][more]
ENSAMXT00000036468.15.046e-6151.01cathepsin L1-like [Source:NCBI gene;Acc:107196839][more]
ENSAMXT00000040914.17.310e-6048.98pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Cathepsin L vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010475.11.425e-6050.00pep scaffold:Pmarinus_7.0:GL482653:10321:33550:-1 ... [more]
ENSPMAT00000003800.13.293e-6049.49pep scaffold:Pmarinus_7.0:GL485125:12828:20107:1 g... [more]
ENSPMAT00000011285.15.611e-5747.47pep scaffold:Pmarinus_7.0:GL499136:454:1347:-1 gen... [more]
ENSPMAT00000006499.18.557e-5546.50pep scaffold:Pmarinus_7.0:GL477089:42202:47941:1 g... [more]
ENSPMAT00000007755.11.180e-4745.23pep scaffold:Pmarinus_7.0:GL476381:1843:17023:-1 g... [more]
back to top
BLAST of Cathepsin L vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cathepsin L vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458521.182e-6350.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367272.281e-5948.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464653.289e-5445.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459535.930e-5343.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427511.247e-4645.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cathepsin L vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsl.14.692e-5846.97cathepsin L1 [Source:NCBI gene;Acc:101171789][more]
ctss2.14.874e-5246.46cathepsin S [Source:NCBI gene;Acc:101165175][more]
ctsl7.807e-5144.50cathepsin L [Source:NCBI gene;Acc:100049246][more]
ctsk2.503e-5043.88cathepsin K [Source:NCBI gene;Acc:101164922][more]
ctss9.160e-5044.44cathepsin S [Source:NCBI gene;Acc:100049247][more]
back to top
BLAST of Cathepsin L vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034294.12.752e-11782.47SMESG000034294.1[more]
SMESG000054075.13.386e-11781.96SMESG000054075.1[more]
SMESG000063517.19.074e-9163.92SMESG000063517.1[more]
SMESG000063517.19.956e-9163.92SMESG000063517.1[more]
SMESG000063471.11.986e-8863.92SMESG000063471.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023322 ID=SMED30023322|Name=Cathepsin L|organism=Schmidtea mediterranea sexual|type=transcript|length=613bp
ACGCATTCTCTACGACAGGCGCGTTAGAAGGTCAACTATTCAGAAAAACT
GGAAATTTGATAAGTTTATCTGAACAACAGATTGTTGATTGTGATAGTTT
TGATTATGCATGTAACGGTGGATTTGTGACTGATACTTTAACTTATATTA
AACAAAATGGAGGAATTGAATCTGAGCAAGATTATCCATATGTGTCAGGA
AGGACGAAGAAACCTAATAAAAAATGTTATTTCAAAAAAGAAAAAATAGT
GGGAACAGATACTGGTTTCGTATCTTTACCTCCAGGAGATGAAGAAGCTC
TGAGAGAAGCTCTAGTAACAATTGGGCCAATTTCAATAGCTTTTTCCGCG
TCGCCTTTGTTATCAGGATATAAGAATGGGATATATCATGATTACATGTG
TGCTGATGTTCGCATCAATCATGCAGTTTTACTAGTAGGATATGGAACGG
ATGAAGAATCAGGAACACCTTATTGGATAATAAAAAACAGTTGGGGTCCC
GCATGGGGAGAAAATGGATATTTTCGAATGGAAAGAAATAAAAACATGTG
CAACATGGCATACAATTCATACTATCCATTGGTTTGATTGAACGACTTCT
TATGAGTGTGTGT
back to top

protein sequence of SMED30023322-orf-1

>SMED30023322-orf-1 ID=SMED30023322-orf-1|Name=SMED30023322-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
AFSTTGALEGQLFRKTGNLISLSEQQIVDCDSFDYACNGGFVTDTLTYIK
QNGGIESEQDYPYVSGRTKKPNKKCYFKKEKIVGTDTGFVSLPPGDEEAL
REALVTIGPISIAFSASPLLSGYKNGIYHDYMCADVRINHAVLLVGYGTD
EESGTPYWIIKNSWGPAWGENGYFRMERNKNMCNMAYNSYYPLV*
back to top
Aliases
The feature 'Cathepsin L' has the following synonyms
Synonym
CTSL-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002031embryonic gut
PLANA:0002087primitive gut
PLANA:0000023embryonic pharynx
PLANA:0000085primitive gut cell
PLANA:0000058embryonic digestive system
PLANA:0000059embryonic gut cell
Vocabulary: INTERPRO
TermDefinition
IPR000668Peptidase_C1A_C
IPR025660Pept_his_AS
IPR025661Pept_asp_AS
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000003Stage 3
PLANA:0000005Stage 5