Lysocardiolipin acyltransferase 1

Overview
NameLysocardiolipin acyltransferase 1
Smed IDSMED30023289
Length (bp)1663
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysocardiolipin acyltransferase 1 (SMED30023289) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysocardiolipin acyltransferase 1 (SMED30023289) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysocardiolipin acyltransferase 1 (SMED30023289) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysocardiolipin acyltransferase 1 (SMED30023289) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023289

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30023289SMESG000041961.1 dd_Smed_v4_8322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023289SMESG000041961.1 dd_Smed_v4_8322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023289SMESG000041961.1 dd_Smed_v4_8322_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Human
Match: LCLAT1 (lysocardiolipin acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:26756])

HSP 1 Score: 209.92 bits (533), Expect = 6.304e-62
Identity = 119/331 (35.95%), Postives = 187/331 (56.50%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNED----KPSSFRSSEVELNSVLIKQLISVL 1101
             I+  + +   ++FGS+      L L F +P  +RW  +  +  W+   ++LLE + GVK  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LK+ LK +PG GWAMQ  +YIF+ R  + DK H  +MI+YF ++    ++LIFPEGTDL++ +K RSN +A+K GL +YE VLHPRT GF  + + + R  K+ DA++D+T AYP  +   +E   + G    E+HF   RY +  +  S + +                   + + +  W  KE+ L  +YQ  ++      S     + EL  VL+ +L+S+L
Sbjct:    6 GIYFILTLFWGSFFGSIFMLSPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGDAFVPGERSVIIMNHRTRMDWMFLWNCLMRY-SYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYVLHPRTTGFTFVVDRL-REGKNLDAVHDITVAYPH-NIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDL-------------------QLWCHKRWEEKEERLRSFYQGEKNFYFTGQSVIPPCKSELR-VLVVKLLSIL 313          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Human
Match: LCLAT1 (lysocardiolipin acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:26756])

HSP 1 Score: 209.534 bits (532), Expect = 2.146e-61
Identity = 119/331 (35.95%), Postives = 187/331 (56.50%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNED----KPSSFRSSEVELNSVLIKQLISVL 1101
             I+  + +   ++FGS+      L L F +P  +RW  +  +  W+   ++LLE + GVK  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LK+ LK +PG GWAMQ  +YIF+ R  + DK H  +MI+YF ++    ++LIFPEGTDL++ +K RSN +A+K GL +YE VLHPRT GF  + + + R  K+ DA++D+T AYP  +   +E   + G    E+HF   RY +  +  S + +                   + + +  W  KE+ L  +YQ  ++      S     + EL  VL+ +L+S+L
Sbjct:   44 GIYFILTLFWGSFFGSIFMLSPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGDAFVPGERSVIIMNHRTRMDWMFLWNCLMRY-SYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYVLHPRTTGFTFVVDRL-REGKNLDAVHDITVAYPH-NIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDL-------------------QLWCHKRWEEKEERLRSFYQGEKNFYFTGQSVIPPCKSELR-VLVVKLLSIL 351          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Human
Match: LCLAT1 (lysocardiolipin acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:26756])

HSP 1 Score: 182.57 bits (462), Expect = 2.046e-52
Identity = 88/203 (43.35%), Postives = 132/203 (65.02%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEM 729
             I+  + +   ++FGS+      L L F +P  +RW  +  +  W+   ++LLE + GVK  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LK+ LK +PG GWAMQ  +YIF+ R  + DK H  +MI+YF ++    ++LIFPEGTDL++ +K RSN +A+K GL +YE VLHPRT GF  + + +
Sbjct:   44 GIYFILTLFWGSFFGSIFMLSPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGDAFVPGERSVIIMNHRTRMDWMFLWNCLMRY-SYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYVLHPRTTGFTFVVDRL 245          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Human
Match: LCLAT1 (lysocardiolipin acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:26756])

HSP 1 Score: 105.531 bits (262), Expect = 3.420e-26
Identity = 54/132 (40.91%), Postives = 82/132 (62.12%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERN 516
             I+  + +   ++FGS+      L L F +P  +RW  +  +  W+   ++LLE + GVK  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LK+ LK +PG GWAMQ  +YIF+ R 
Sbjct:    6 GIYFILTLFWGSFFGSIFMLSPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGDAFVPGERSVIIMNHRTRMDWMFLWNCLMRY-SYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRK 136          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Human
Match: LCLAT1 (lysocardiolipin acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:26756])

HSP 1 Score: 104.76 bits (260), Expect = 5.068e-26
Identity = 54/132 (40.91%), Postives = 82/132 (62.12%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERN 516
             I+  + +   ++FGS+      L L F +P  +RW  +  +  W+   ++LLE + GVK  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LK+ LK +PG GWAMQ  +YIF+ R 
Sbjct:    6 GIYFILTLFWGSFFGSIFMLSPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGDAFVPGERSVIIMNHRTRMDWMFLWNCLMRY-SYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRK 136          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Celegans
Match: acl-8 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:O16526])

HSP 1 Score: 193.741 bits (491), Expect = 2.721e-56
Identity = 126/343 (36.73%), Postives = 183/343 (53.35%), Query Frame = 1
Query:  196 LAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSL-RDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNSVLIK-------QLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIFIY 1200
            LA+ +PK +R   D  +  W+    SL+EWV GV FR+ GD I  +E A++IMNHR+RLDWL+ +  L +    L   EKI LK+ LK+IPG GWAM  GSYIFL+RN E DK  L  +++Y+S  E   +IL+F EGTD  + A   S+ +ADK GLPRYE VLHPRT GF  L  E+++       +YD+T AY        E + + G    +VH   ++Y L EI  +G+   K ++                    LW  KEK L ++Y++ E   +S    E    +  I         +++ L+  G I++    L++   VS+ I F L ++  Y
Sbjct:   31 LAWFAPKLWRTCADRLVGFWLTFPCSLIEWVFGVNFRVTGDLIERDEPAILIMNHRTRLDWLFSWNALYKMDPWLLTTEKISLKAPLKKIPGAGWAMSSGSYIFLDRNFENDKPVLERIVKYYSGSEKKYQILLFAEGTDKGERATRLSDAFADKNGLPRYEYVLHPRTTGFKFLM-ELMKKENYIKYVYDLTIAY-SGTIVDTEAKLLAGNFPDKVHLDVKKYKLDEI-PTGEGCEKWLTD-------------------LWATKEKRLKKFYEQEERLEASGDRFEWPETTTGIGYYVAFAFWVLASLIWMGAIYSL---LWVKIYVSIAIIFYLASLRFY 348          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Celegans
Match: acl-9 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q23087])

HSP 1 Score: 183.341 bits (464), Expect = 3.430e-52
Identity = 123/397 (30.98%), Postives = 194/397 (48.87%), Query Frame = 1
Query:  127 FVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSL-RDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDK---PSSFRSSEVEL-NSVLIKQLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIFIYVDI--FQDGVDELVLKLSLKDKYRTFSRSGISQQ 1296
            F    M +SA+FG L      + L F  P+ +R  +D  + +W+    +L  ++ G   R+ GD I   E ALIIMNHR+RLDWL+F+  L +    L   EKI LK  LK +PG GWAMQ  SYIFL+R+ + DK  L N++ Y++  E+  ++L+FPEGTD    A ERS  +++K GL  Y+ VLHPR  GF+H+ + M R   +   IYDV+  + D         F  G    EV +   +Y ++ I  + + + + +                     LW NKE+ L  +Y+   +    P +    E EL N+    Q   +   C   FT ++ +F+    +   ++ + A   Y  +  F  G++ L +     D++    + G+  Q
Sbjct:   24 FFGAAMLLSAFFGVLYIVTPLVVLLFLKPRLWRQMLDRLVGIWVIMPGALCNYIFGANIRIKGDFINHEEPALIIMNHRTRLDWLFFWNALYKMDPWLCTTEKISLKGMLKYVPGAGWAMQAASYIFLDRSFDTDKTKLDNILNYYAETEYKYQLLLFPEGTDKCPKATERSRIHSEKKGLVHYQYVLHPRVTGFVHIVQAMRRA-NNIKYIYDVSIGFGDAIVQSELDIFAHGVCPKEVFYQVIKYPIEAIPQTDEALGQWLVN-------------------LWRNKEEKLKRFYEMPRNVRQFPDTPDGVEYELDNNTDRAQKGLIGFWC---FTTVFWMFMFFESAFMFYWAIIACVFYAAVHKFYGGLEFLAI-----DRFNHSKQYGVVGQ 392          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Celegans
Match: acl-9 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q23087])

HSP 1 Score: 183.341 bits (464), Expect = 3.430e-52
Identity = 123/397 (30.98%), Postives = 194/397 (48.87%), Query Frame = 1
Query:  127 FVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSL-RDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDK---PSSFRSSEVEL-NSVLIKQLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIFIYVDI--FQDGVDELVLKLSLKDKYRTFSRSGISQQ 1296
            F    M +SA+FG L      + L F  P+ +R  +D  + +W+    +L  ++ G   R+ GD I   E ALIIMNHR+RLDWL+F+  L +    L   EKI LK  LK +PG GWAMQ  SYIFL+R+ + DK  L N++ Y++  E+  ++L+FPEGTD    A ERS  +++K GL  Y+ VLHPR  GF+H+ + M R   +   IYDV+  + D         F  G    EV +   +Y ++ I  + + + + +                     LW NKE+ L  +Y+   +    P +    E EL N+    Q   +   C   FT ++ +F+    +   ++ + A   Y  +  F  G++ L +     D++    + G+  Q
Sbjct:   24 FFGAAMLLSAFFGVLYIVTPLVVLLFLKPRLWRQMLDRLVGIWVIMPGALCNYIFGANIRIKGDFINHEEPALIIMNHRTRLDWLFFWNALYKMDPWLCTTEKISLKGMLKYVPGAGWAMQAASYIFLDRSFDTDKTKLDNILNYYAETEYKYQLLLFPEGTDKCPKATERSRIHSEKKGLVHYQYVLHPRVTGFVHIVQAMRRA-NNIKYIYDVSIGFGDAIVQSELDIFAHGVCPKEVFYQVIKYPIEAIPQTDEALGQWLVN-------------------LWRNKEEKLKRFYEMPRNVRQFPDTPDGVEYELDNNTDRAQKGLIGFWC---FTTVFWMFMFFESAFMFYWAIIACVFYAAVHKFYGGLEFLAI-----DRFNHSKQYGVVGQ 392          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Celegans
Match: bus-18 (pep chromosome:WBcel235:V:11773720:11776631:1 gene:WBGene00044631.1 transcript:F55A11.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:bus-18)

HSP 1 Score: 177.563 bits (449), Expect = 5.164e-50
Identity = 118/391 (30.18%), Postives = 200/391 (51.15%), Query Frame = 1
Query:  106 LKPLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSL-RDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIM-GRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNSVLIK-----------QLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIFIYVDIFQDGVDELVL 1239
            L+PLL  F  + +  SA FG+               K +R  +D  +  W+   + LLE+++GV+ R+ GD+I     A+I+MNHR+RLDW+Y +  L +    L    KI LK++LK++PG G+ M    ++FLERN E+DK    + I+YF N++   +IL+FPEGTD S++   +S ++A K GL   + VL+PRT GFLHL  +M R  +  + IYD+T AYP  +   +E+  ++ G +  EVHF  R+  + ++  +     + ++                     W  KE++L ++Y  +E++P + R   VE    + +           +L S++     I  C Y +F +  + L   +    I  Y+     G+D+ ++
Sbjct:    7 LRPLLGWFFGLCILFSALFGNYIITLFLGLPILGRHKQWRNLMDRAISYWMTIPMGLLEFLMGVRIRVSGDEIEFGSPAMIVMNHRTRLDWMYMWCALYQINPWLITSNKISLKAQLKKLPGAGFGMAAAQFVFLERNAEVDKRSFDDAIDYFKNIDKKYQILLFPEGTDKSEWTTLKSREFAKKNGLRHLDYVLYPRTTGFLHLLNKM-REQEYVEYIYDITIAYP-YNIVQSEIDLVLKGASPREVHFHIRKIPISQVPLNEQDASRWLTD-------------------RWTIKEQLLHDFY--SEEQPIN-RQFPVERGDGVWRSWKEPRRHFYVKLTSLMFWTLVISFCSYHIFFVRTLQLGFLYFF-VISFYLSWRYGGIDKYII 372          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Celegans
Match: acl-11 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q95R12])

HSP 1 Score: 74.7146 bits (182), Expect = 3.337e-14
Identity = 59/214 (27.57%), Postives = 99/214 (46.26%), Query Frame = 1
Query:  247 FMWICSSISLLEWVIGVKFRLYG------DKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDE--KIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAK---ERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDK-------------DFACNELQF 816
            +M +C  + + E + GV+  L+G      +K    E A++I NH+S +DW+    +  R G    ++  ++++K+ +  +P  GW +    YI++ R  E     +   +++ +  +    +LIFPEGT  S   K   E SN++ +K G    +NVL PR+ G     +  +      DAIYDVT  Y                DF C   QF
Sbjct:   58 YMRLC--LFVFENLSGVEIYLHGTNEEVVNKTGKPENAVMISNHQSNVDWIIPVMLAARHGDQGNEQAFRVMVKNSIHLVPMFGWYIFQHGYIYVRRFGEFIGAPVLRQLKWLNESDPPYWLLIFPEGTRNSAKKKHLLESSNRFLEKSGRQPMQNVLCPRSGGL----QLALDNLSTLDAIYDVTVMYGQMRMAERRGLAPGMFDFCCGSQQF 265          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Fly
Match: Agpat4 (gene:FBgn0036622 transcript:FBtr0331172)

HSP 1 Score: 87.4261 bits (215), Expect = 3.157e-18
Identity = 57/179 (31.84%), Postives = 86/179 (48.04%), Query Frame = 1
Query:  259 CSSISLLEWVIGVKFRLYGD-----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAY 780
            C  + + EW  G K R+Y D     K    E  L++MNH   +DWL  + I  + G+ L   K   K  L+ +P  GW      +IFL+RN E DK+ +   ++   +      +L+  EGT  +    E S K+A++ GLP  ++ L PRT GF   T  +        AIYD+  A+
Sbjct:   55 CILVCVAEWYAGSKLRVYIDPQDEQKFFGKEHGLLLMNHTYEIDWLTAWMITDKLGN-LGGTKAYAKKMLRYVPVLGWVWWMAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGTRFTPAKHELSVKFAEERGLPLLKHHLIPRTKGF---TTSLPTMRGICPAIYDINLAF 229          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Fly
Match: Agpat4 (gene:FBgn0036622 transcript:FBtr0075422)

HSP 1 Score: 87.4261 bits (215), Expect = 3.157e-18
Identity = 57/179 (31.84%), Postives = 86/179 (48.04%), Query Frame = 1
Query:  259 CSSISLLEWVIGVKFRLYGD-----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAY 780
            C  + + EW  G K R+Y D     K    E  L++MNH   +DWL  + I  + G+ L   K   K  L+ +P  GW      +IFL+RN E DK+ +   ++   +      +L+  EGT  +    E S K+A++ GLP  ++ L PRT GF   T  +        AIYD+  A+
Sbjct:   55 CILVCVAEWYAGSKLRVYIDPQDEQKFFGKEHGLLLMNHTYEIDWLTAWMITDKLGN-LGGTKAYAKKMLRYVPVLGWVWWMAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGTRFTPAKHELSVKFAEERGLPLLKHHLIPRTKGF---TTSLPTMRGICPAIYDINLAF 229          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Fly
Match: Agpat4 (gene:FBgn0036622 transcript:FBtr0075421)

HSP 1 Score: 87.4261 bits (215), Expect = 3.157e-18
Identity = 57/179 (31.84%), Postives = 86/179 (48.04%), Query Frame = 1
Query:  259 CSSISLLEWVIGVKFRLYGD-----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAY 780
            C  + + EW  G K R+Y D     K    E  L++MNH   +DWL  + I  + G+ L   K   K  L+ +P  GW      +IFL+RN E DK+ +   ++   +      +L+  EGT  +    E S K+A++ GLP  ++ L PRT GF   T  +        AIYD+  A+
Sbjct:   55 CILVCVAEWYAGSKLRVYIDPQDEQKFFGKEHGLLLMNHTYEIDWLTAWMITDKLGN-LGGTKAYAKKMLRYVPVLGWVWWMAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGTRFTPAKHELSVKFAEERGLPLLKHHLIPRTKGF---TTSLPTMRGICPAIYDINLAF 229          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Fly
Match: Agpat3 (gene:FBgn0036623 transcript:FBtr0075417)

HSP 1 Score: 87.4261 bits (215), Expect = 3.427e-18
Identity = 59/205 (28.78%), Postives = 94/205 (45.85%), Query Frame = 1
Query:  280 EWVIGVKFRLYGDK-----IISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
            +W  G K  +Y DK         E  L+IMNH+  +DWL  + I  + G  L + K   K  ++ +P  GW      ++FL RN + DK  ++  ++   +    T +L+  EGT  +    E S K+A + G+   ++ L PRT GF   T  +         IYD+  AY   D     +  ++   S E H L RR  L+++
Sbjct:   67 DWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGV-LGNCKAYAKKAIRYVPIIGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVKFAQERGMTVLKHHLIPRTKGF---TASLAPIRGLCPVIYDINLAYRPTDKTPATMLSLLHGKSVEPHLLMRRIPLEQV 267          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Fly
Match: Agpat3 (gene:FBgn0036623 transcript:FBtr0075419)

HSP 1 Score: 87.4261 bits (215), Expect = 3.427e-18
Identity = 59/205 (28.78%), Postives = 94/205 (45.85%), Query Frame = 1
Query:  280 EWVIGVKFRLYGDK-----IISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
            +W  G K  +Y DK         E  L+IMNH+  +DWL  + I  + G  L + K   K  ++ +P  GW      ++FL RN + DK  ++  ++   +    T +L+  EGT  +    E S K+A + G+   ++ L PRT GF   T  +         IYD+  AY   D     +  ++   S E H L RR  L+++
Sbjct:   67 DWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGV-LGNCKAYAKKAIRYVPIIGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPDPTWLLLNAEGTRFTPAKHEASVKFAQERGMTVLKHHLIPRTKGF---TASLAPIRGLCPVIYDINLAYRPTDKTPATMLSLLHGKSVEPHLLMRRIPLEQV 267          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Zebrafish
Match: lclat1 (lysocardiolipin acyltransferase 1 [Source:NCBI gene;Acc:406554])

HSP 1 Score: 204.527 bits (519), Expect = 6.149e-60
Identity = 104/280 (37.14%), Postives = 162/280 (57.86%), Query Frame = 1
Query:  220 FRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEV 1059
            +RW  D  +  W+   ++LLE V+GVK  + GD  I  ER++IIMNHR+RLDW++ +  L+R+ S LR EKI LK+ LK +PG GWAMQ  S+IF++R  E D+ H+SNM++YF  +    ++L+FPEGTDL++  + RS+++A+K GL +YE VLHPRT GF  + + + R   + DA++D+T AYP ++    E   + G    E+HF  +R+++  +      +                   + +    W  KE+ L  +Y   E  P  F +  V
Sbjct:   39 YRWITDRIVATWLTLPVALLELVLGVKVVVTGDGFIPGERSVIIMNHRTRLDWMFLWCCLLRY-SYLRQEKICLKAALKSVPGFGWAMQVASFIFIQRRWEDDRTHMSNMLQYFCRIREPVQLLLFPEGTDLTENTRARSDEFAEKNGLQKYEYVLHPRTTGFTFIVDTL-RGGDNLDAVHDITVAYP-QNIPQTERHLLAGVFPREIHFHVQRFTVASVPAGAAGL-------------------QAWCQERWREKERRLQRFY---ETVPRRFDAPAV 293          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Zebrafish
Match: agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2765])

HSP 1 Score: 82.0333 bits (201), Expect = 2.531e-16
Identity = 61/209 (29.19%), Postives = 99/209 (47.37%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGDKII----SNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKD-FDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
            + LLEW  G +  LY D+        E  +II+NH   +D+L  + I  R+G  L   K++ K EL ++P  GW       +F +R  E D+  + + +    +       L++ EGT  ++   + S + A+  GLP+ +  L PRT GF       ++C K    A+YDVT  + DK      L  I+     +     RR+S++EI
Sbjct:   62 VMLLEWWSGTECTLYTDQATVDKFGKEHVIIILNHNFEVDFLCGWTICERYGV-LGSSKVLAKHELLKVPLIGWTWYFLEIVFCKRKWEEDRDTVFSGLSRLRDYPEYMWFLLYCEGTRFTEKKHQISMQVAESKGLPKLKYHLLPRTKGF----TTTLQCLKGTVKAVYDVTLNFKDKQNP--TLLGIVNGKKYKADLSVRRFSVEEI 263          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Zebrafish
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1924])

HSP 1 Score: 73.9442 bits (180), Expect = 7.692e-14
Identity = 54/190 (28.42%), Postives = 92/190 (48.42%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGD----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMG 825
            ++LLEW  G +  LY D    ++   E A++++NH   +D++  +    RFG  L   K++ K EL  +P  GW       +F +R  E D+  +   +    +       L+  EGT  ++   + S + A+K GLP+ +  L PRT GF  +T + +R      A+YD T      +F  NE+  ++G
Sbjct:   65 VALLEWWSGTECTLYTDPESFRLYGKENAIVVLNHNFEIDFMTGWTFCERFGV-LGSSKVLAKKELSFVPVIGWMWYFLEIVFCKRKWEEDRKTVVQSLRNLQDYPEFFWFLLHCEGTRFTEKKHKISMEVAEKKGLPKLKYHLLPRTKGFC-VTVQNLR--GKVTAVYDSTL-----NFRNNEMPTLLG 245          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Zebrafish
Match: agpat5 (1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) [Source:ZFIN;Acc:ZDB-GENE-060929-914])

HSP 1 Score: 73.9442 bits (180), Expect = 9.051e-14
Identity = 80/343 (23.32%), Postives = 150/343 (43.73%), Query Frame = 1
Query:  130 VAIMMGVS-AYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKE---RSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDK-----PSSFRSSEVELNSVLIKQLISVLLICGNIFTCI 1131
             A+M+G + AY   L++   +L  A    + +    D    ++    +   E   GV+  +YG+     E  + + NH+S  DW+    + +R  +++   + VLK  LK +P  GW       ++++R+   D+  +   +   + +     ++IFPEGT  +   K+    S  +A K GL    ++L PR     H+  E +R  +  DA+YD+T AY     A  + +     A T   FLC+      I          +S +D+       +  + +++  +  K+K+LT +Y+  +       P   R S + L+    K L S+L++ G  F  +
Sbjct:   18 TAVMLGTAPAYL--LSWSVWRLLSAILPARLYHTVDDRAYSVYQSMVLFFFENYTGVEIVIYGEIPKKKENVVYLSNHQSTADWIIADMLAIR-QNAIGHVRYVLKDGLKWLPLYGWYFSQHGGVYVKRSANFDEKAMKKKLSSQTRLSTPMYLVIFPEGTRYNPELKKVISDSQAFAAKQGLAVLNHILTPRMKAS-HVAIETMR--EHLDAVYDITVAYEGTLTADGQRR----PAPTMPEFLCKECPRVHI---------HISRVDIKDIPAEPDVFRGWLHQRFEIKDKLLTTFYESEDPAKKSRFPGEGRKSPLSLS----KTLPSLLILSGLTFPML 337          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Zebrafish
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1924])

HSP 1 Score: 73.9442 bits (180), Expect = 1.031e-13
Identity = 54/190 (28.42%), Postives = 92/190 (48.42%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGD----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMG 825
            ++LLEW  G +  LY D    ++   E A++++NH   +D++  +    RFG  L   K++ K EL  +P  GW       +F +R  E D+  +   +    +       L+  EGT  ++   + S + A+K GLP+ +  L PRT GF  +T + +R      A+YD T      +F  NE+  ++G
Sbjct:   65 VALLEWWSGTECTLYTDPESFRLYGKENAIVVLNHNFEIDFMTGWTFCERFGV-LGSSKVLAKKELSFVPVIGWMWYFLEIVFCKRKWEEDRKTVVQSLRNLQDYPEFFWFLLHCEGTRFTEKKHKISMEVAEKKGLPKLKYHLLPRTKGFC-VTVQNLR--GKVTAVYDSTL-----NFRNNEMPTLLG 245          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Xenopus
Match: tiprl (TOR signaling pathway regulator [Source:Xenbase;Acc:XB-GENE-5917981])

HSP 1 Score: 204.912 bits (520), Expect = 4.089e-60
Identity = 105/260 (40.38%), Postives = 159/260 (61.15%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKI 900
             ++  + + + ++FGS+      L L   SP  +RW  D  +  W+   ++LLE V G K  + GD  I  ER++IIMNHR+RLDW++ +  L+R+ S LR EKI LKS LK +PG GWAMQ  ++IF+ R  E DK H   M++YF +++ + ++LIFPEGTDL+D  K RS+++A+K  L +YE VLHPRT GF  + + + R   + DAI+D+T AYP  +    E   + G    E+HF   RY +  +  S +++
Sbjct:    6 GVYFVLALFLGSFFGSIFMLGPFLPLMLVSPSWYRWITDRIVATWLTLPVALLELVFGAKVVITGDGFIPGERSVIIMNHRTRLDWMFLWNCLLRY-SYLRLEKICLKSSLKAVPGFGWAMQVAAFIFIHRKWEDDKNHFEAMLDYFCDIKEHLQLLIFPEGTDLTDNTKARSDEFAEKNKLQKYEYVLHPRTTGFTFIVDRL-REGNNLDAIHDITVAYP-HNIPQTEKHILNGNFPKEIHFHVCRYPVSSLPVSKEEL 262          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Xenopus
Match: tiprl (TOR signaling pathway regulator [Source:Xenbase;Acc:XB-GENE-5917981])

HSP 1 Score: 205.297 bits (521), Expect = 7.960e-60
Identity = 105/260 (40.38%), Postives = 159/260 (61.15%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKI 900
             ++  + + + ++FGS+      L L   SP  +RW  D  +  W+   ++LLE V G K  + GD  I  ER++IIMNHR+RLDW++ +  L+R+ S LR EKI LKS LK +PG GWAMQ  ++IF+ R  E DK H   M++YF +++ + ++LIFPEGTDL+D  K RS+++A+K  L +YE VLHPRT GF  + + + R   + DAI+D+T AYP  +    E   + G    E+HF   RY +  +  S +++
Sbjct:    6 GVYFVLALFLGSFFGSIFMLGPFLPLMLVSPSWYRWITDRIVATWLTLPVALLELVFGAKVVITGDGFIPGERSVIIMNHRTRLDWMFLWNCLLRY-SYLRLEKICLKSSLKAVPGFGWAMQVAAFIFIHRKWEDDKNHFEAMLDYFCDIKEHLQLLIFPEGTDLTDNTKARSDEFAEKNKLQKYEYVLHPRTTGFTFIVDRL-REGNNLDAIHDITVAYPH-NIPQTEKHILNGNFPKEIHFHVCRYPVSSLPVSKEEL 262          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Xenopus
Match: c19orf44 (chromosome 19 open reading frame 44 [Source:Xenbase;Acc:XB-GENE-5854937])

HSP 1 Score: 74.3294 bits (181), Expect = 9.984e-14
Identity = 60/212 (28.30%), Postives = 98/212 (46.23%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGDK----IISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKD-FDAIYDVTSAYPDKDFACNELQFIMG---RASTEVHFLCRRYSLKEI 879
            + LLEW  G +  L+ D+        E  +II+NH   +D+L  + +  R+G  L   K++ K EL  +P  GW       +F +R  E D+  +   +    +       L++ EGT  ++   + S + ADK GL R ++ L PRT GF       ++C +    A+YDVT      +F  N+   ++G       E     RR+ L+EI
Sbjct:   47 VMLLEWWSGTQCTLFTDQETIDHFGKEHVIIILNHNYEIDFLCGWTMCERYGV-LGSSKVLAKKELLMVPLIGWTWYFLEIVFCKRKWEEDRDMVIQGLRNLRDYPEYMWFLLYCEGTRFTETKHKISMEVADKKGLARLKHHLLPRTRGF----TTAVQCLRGTVSAVYDVT-----LNFRGNKNPSLLGILYGKKYEADMCVRRFPLEEI 248          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Xenopus
Match: mn1 (meningioma (disrupted in balanced translocation) 1 [Source:Xenbase;Acc:XB-GENE-855611])

HSP 1 Score: 71.633 bits (174), Expect = 7.600e-13
Identity = 70/263 (26.62%), Postives = 124/263 (47.15%), Query Frame = 1
Query:  130 VAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTK--ILIFPEGTDLSDYAKE---RSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDF-DAIYDVTSAYP-------DKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
             A M+G +  +  L + C +   A    + +R   D    ++    +   +   GV+  +YGD +   E  L I NH+  +DW+    +L    ++L   + VLK  LK +P  G+       ++++R+ + ++  + N +   S ++ NTK  ++IFPEGT  +    +    S  +A K GLP  ++VL PR       T   I   +D+ DA+YDVT AY         +  A +  +F+  +   ++H L  R S+K+I
Sbjct:   18 TAFMLGTAPTY-LLAWGCWRALSAVLPERIYRSVDDRLYTLYQSMVLFFFQNYTGVEIIIYGD-LPKKENILYISNHQCTVDWI-VADMLAVQQNALGHVRYVLKDGLKFLPLYGFYFSQHGGLYVKRSSKFNEKKMRNKLA--SQIKANTKMYLVIFPEGTRYNPNIPKVIADSQAFAKKEGLPVLKHVLTPRVKA----THVAIDVMQDYLDAVYDVTVAYEGTIGNGGQRKEAPSMTEFLC-KECPKIHILLERISVKDI 270          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Xenopus
Match: mn1 (meningioma (disrupted in balanced translocation) 1 [Source:Xenbase;Acc:XB-GENE-855611])

HSP 1 Score: 71.633 bits (174), Expect = 7.857e-13
Identity = 70/263 (26.62%), Postives = 124/263 (47.15%), Query Frame = 1
Query:  130 VAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTK--ILIFPEGTDLSDYAKE---RSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDF-DAIYDVTSAYP-------DKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
             A M+G +  +  L + C +   A    + +R   D    ++    +   +   GV+  +YGD +   E  L I NH+  +DW+    +L    ++L   + VLK  LK +P  G+       ++++R+ + ++  + N +   S ++ NTK  ++IFPEGT  +    +    S  +A K GLP  ++VL PR       T   I   +D+ DA+YDVT AY         +  A +  +F+  +   ++H L  R S+K+I
Sbjct:   18 TAFMLGTAPTY-LLAWGCWRALSAVLPERIYRSVDDRLYTLYQSMVLFFFQNYTGVEIIIYGD-LPKKENILYISNHQCTVDWI-VADMLAVQQNALGHVRYVLKDGLKFLPLYGFYFSQHGGLYVKRSSKFNEKKMRNKLA--SQIKANTKMYLVIFPEGTRYNPNIPKVIADSQAFAKKEGLPVLKHVLTPRVKA----THVAIDVMQDYLDAVYDVTVAYEGTIGNGGQRKEAPSMTEFLC-KECPKIHILLERISVKDI 270          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Mouse
Match: Lclat1 (lysocardiolipin acyltransferase 1 [Source:MGI Symbol;Acc:MGI:2684937])

HSP 1 Score: 203.756 bits (517), Expect = 4.802e-60
Identity = 119/344 (34.59%), Postives = 189/344 (54.94%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNS---VLIKQLISVL---LICGNIFTCIY 1134
             I+  + +   ++FGS+      L L F +   +RW     +  W+   ++LLE + GV+  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LKS LK +PG GWAMQ  ++IF+ R  + DK H  +MI+YF  +    ++LIFPEGTDL++  K RSN +A+K GL +YE VLHPRT GF  + + + R  K+ DA++D+T AYP  +    E   ++G    E+HF  +RY    +  S + +                   + + +  W  KE+ L  +YQ  ++   + +S+     S   VL+ +L+S++   L C  +   IY
Sbjct:    6 GIYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSRLVATWLTLPVALLETMFGVRVVITGDAFVPGERSVIIMNHRTRVDWMFLWNCLMRY-SYLRVEKICLKSSLKSVPGFGWAMQVAAFIFIHRKWKDDKSHFEDMIDYFCAIHEPLQLLIFPEGTDLTENNKARSNDFAEKNGLQKYEYVLHPRTTGFTFVVDRL-REGKNLDAVHDITVAYP-YNIPQTEKHLLLGDFPKEIHFHVQRYPADSLPTSKEDL-------------------QLWCHRRWEEKEERLRSFYQGEKNFHFTGQSTVPPCKSELRVLVVKLLSIVYWALFCSAMCLLIY 327          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Mouse
Match: Lclat1 (lysocardiolipin acyltransferase 1 [Source:MGI Symbol;Acc:MGI:2684937])

HSP 1 Score: 203.371 bits (516), Expect = 1.282e-59
Identity = 119/344 (34.59%), Postives = 189/344 (54.94%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNS---VLIKQLISVL---LICGNIFTCIY 1134
             I+  + +   ++FGS+      L L F +   +RW     +  W+   ++LLE + GV+  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LKS LK +PG GWAMQ  ++IF+ R  + DK H  +MI+YF  +    ++LIFPEGTDL++  K RSN +A+K GL +YE VLHPRT GF  + + + R  K+ DA++D+T AYP  +    E   ++G    E+HF  +RY    +  S + +                   + + +  W  KE+ L  +YQ  ++   + +S+     S   VL+ +L+S++   L C  +   IY
Sbjct:    6 GIYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSRLVATWLTLPVALLETMFGVRVVITGDAFVPGERSVIIMNHRTRVDWMFLWNCLMRY-SYLRVEKICLKSSLKSVPGFGWAMQVAAFIFIHRKWKDDKSHFEDMIDYFCAIHEPLQLLIFPEGTDLTENNKARSNDFAEKNGLQKYEYVLHPRTTGFTFVVDRL-REGKNLDAVHDITVAYP-YNIPQTEKHLLLGDFPKEIHFHVQRYPADSLPTSKEDL-------------------QLWCHRRWEEKEERLRSFYQGEKNFHFTGQSTVPPCKSELRVLVVKLLSIVYWALFCSAMCLLIY 327          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Mouse
Match: Lclat1 (lysocardiolipin acyltransferase 1 [Source:MGI Symbol;Acc:MGI:2684937])

HSP 1 Score: 174.481 bits (441), Expect = 7.445e-51
Identity = 86/196 (43.88%), Postives = 125/196 (63.78%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGF 708
             I+  + +   ++FGS+      L L F +   +RW     +  W+   ++LLE + GV+  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LKS LK +PG GWAMQ  ++IF+ R  + DK H  +MI+YF  +    ++LIFPEGTDL++  K RSN +A+K GL +YE VLHPRT GF
Sbjct:    6 GIYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSRLVATWLTLPVALLETMFGVRVVITGDAFVPGERSVIIMNHRTRVDWMFLWNCLMRY-SYLRVEKICLKSSLKSVPGFGWAMQVAAFIFIHRKWKDDKSHFEDMIDYFCAIHEPLQLLIFPEGTDLTENNKARSNDFAEKNGLQKYEYVLHPRTTGF 200          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Mouse
Match: Agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Source:MGI Symbol;Acc:MGI:1915512])

HSP 1 Score: 76.2554 bits (186), Expect = 2.123e-14
Identity = 61/218 (27.98%), Postives = 101/218 (46.33%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGDKII----SNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKD-FDAIYDVTSAYPDKDFACNELQFIMGRAS-TEVHFLC--RRYSLKEILGSGDK 897
            + LLEW  G +  +Y D         E A++++NH+  +D+L  + +  R G  L + K++ K EL  +P  GW       IF  R  E D+  ++  + +  +       LI  EGT  ++   + S + A   GLP  ++ L PRT GF       ++C +D   A+YD T      +F  NE   ++G  +  + H  C  RR  +++I    DK
Sbjct:   62 VMLLEWWSGTECTIYTDPKACPHYGKENAIVVLNHKFEIDFLCGWSLAERLGI-LGNSKVLAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLRDYPEKYLFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKGF----AITVKCLRDVVPAVYDCTL-----NFRNNENPTLLGVLNGKKYHADCYVRRIPMEDIPEDEDK 269          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Mouse
Match: Agpat5 (1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) [Source:MGI Symbol;Acc:MGI:1196345])

HSP 1 Score: 67.781 bits (164), Expect = 8.874e-12
Identity = 71/283 (25.09%), Postives = 131/283 (46.29%), Query Frame = 1
Query:  292 GVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDL-SDYAK--ERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNSVL----IKQLISVLLICGNI 1119
            GV+  LYGD   + E  + + NH+S +DW+    +L     +L   + VLK +LK +P  G+       I+++R+ + +   + + ++ + N      ++IFPEGT   + Y K    S  +A + GL   ++VL PR     H+  + ++     DAIYDVT  Y   +    +         +   FLC++           K+      ID  +  E +E +K +++  +  K+++L E+Y    D P   R ++    SV     +K+ +  +LI G++
Sbjct:   71 GVQILLYGDLPKNKENVIYLANHQSTVDWI-VADMLAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAGTPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKA-THVAFDSMKS--HLDAIYDVTVVYEGNEKGSGK----YSNPPSMTEFLCKQ---------CPKLHIHFDRIDRNEVPEEQEHMKKWLHERFEIKDRLLIEFY----DSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSL 332          
BLAST of Lysocardiolipin acyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q5F3X0|LCLT1_CHICK (Lysocardiolipin acyltransferase 1 OS=Gallus gallus OX=9031 GN=LCLAT1 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.543e-63
Identity = 110/260 (42.31%), Postives = 161/260 (61.92%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKI 900
             I+  + + + ++FGS+      L L F SP  +RW  D  +  W+   ++LLE V G K  + GD  I  ER++IIMNHR+R+DW++ +  L+R+ S LR EKI LKS LK IPG GWAMQ  ++IF++R  E DK H  NM+ YF ++    ++LIFPEGTDL+   K RSN +A+K GL +YE VLHPRT GF  +  E +R   + DAI+D+T AYP ++    E   + G    E+HF  +RY ++ +  S +++
Sbjct:    6 GIYFVVALFLGSFFGSIFMLGPFLPLMFISPAWYRWITDRIVATWLTLPVALLEMVFGAKVVVTGDGFIPGERSVIIMNHRTRMDWMFLWNCLLRY-SYLRLEKICLKSSLKSIPGFGWAMQVAAFIFIQRKWEDDKSHFENMLHYFCDIHEPLQLLIFPEGTDLTANTKARSNDFAEKNGLRKYEYVLHPRTTGFTFVV-ECLREGNNLDAIHDITVAYP-QNIPQTEKHLLNGNFPKEIHFHVQRYPIETVPTSKEEL 262          
BLAST of Lysocardiolipin acyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q6UWP7|LCLT1_HUMAN (Lysocardiolipin acyltransferase 1 OS=Homo sapiens OX=9606 GN=LCLAT1 PE=1 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.031e-60
Identity = 119/331 (35.95%), Postives = 187/331 (56.50%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNED----KPSSFRSSEVELNSVLIKQLISVL 1101
             I+  + +   ++FGS+      L L F +P  +RW  +  +  W+   ++LLE + GVK  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LK+ LK +PG GWAMQ  +YIF+ R  + DK H  +MI+YF ++    ++LIFPEGTDL++ +K RSN +A+K GL +YE VLHPRT GF  + + + R  K+ DA++D+T AYP  +   +E   + G    E+HF   RY +  +  S + +                   + + +  W  KE+ L  +YQ  ++      S     + EL  VL+ +L+S+L
Sbjct:   44 GIYFILTLFWGSFFGSIFMLSPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGDAFVPGERSVIIMNHRTRMDWMFLWNCLMRY-SYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYVLHPRTTGFTFVVDRL-REGKNLDAVHDITVAYPH-NIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDL-------------------QLWCHKRWEEKEERLRSFYQGEKNFYFTGQSVIPPCKSELR-VLVVKLLSIL 351          
BLAST of Lysocardiolipin acyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q6NYV8|LCLT1_DANRE (Lysocardiolipin acyltransferase 1 OS=Danio rerio OX=7955 GN=lclat1 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 4.642e-59
Identity = 104/280 (37.14%), Postives = 162/280 (57.86%), Query Frame = 1
Query:  220 FRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEV 1059
            +RW  D  +  W+   ++LLE V+GVK  + GD  I  ER++IIMNHR+RLDW++ +  L+R+ S LR EKI LK+ LK +PG GWAMQ  S+IF++R  E D+ H+SNM++YF  +    ++L+FPEGTDL++  + RS+++A+K GL +YE VLHPRT GF  + + + R   + DA++D+T AYP ++    E   + G    E+HF  +R+++  +      +                   + +    W  KE+ L  +Y   E  P  F +  V
Sbjct:   39 YRWITDRIVATWLTLPVALLELVLGVKVVVTGDGFIPGERSVIIMNHRTRLDWMFLWCCLLRY-SYLRQEKICLKAALKSVPGFGWAMQVASFIFIQRRWEDDRTHMSNMLQYFCRIREPVQLLLFPEGTDLTENTRARSDEFAEKNGLQKYEYVLHPRTTGFTFIVDTL-RGGDNLDAVHDITVAYP-QNIPQTERHLLAGVFPREIHFHVQRFTVASVPAGAAGL-------------------QAWCQERWREKERRLQRFY---ETVPRRFDAPAV 293          
BLAST of Lysocardiolipin acyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q3UN02|LCLT1_MOUSE (Lysocardiolipin acyltransferase 1 OS=Mus musculus OX=10090 GN=Lclat1 PE=1 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 8.967e-59
Identity = 119/344 (34.59%), Postives = 189/344 (54.94%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNS---VLIKQLISVL---LICGNIFTCIY 1134
             I+  + +   ++FGS+      L L F +   +RW     +  W+   ++LLE + GV+  + GD  +  ER++IIMNHR+R+DW++ +  LMR+ S LR EKI LKS LK +PG GWAMQ  ++IF+ R  + DK H  +MI+YF  +    ++LIFPEGTDL++  K RSN +A+K GL +YE VLHPRT GF  + + + R  K+ DA++D+T AYP  +    E   ++G    E+HF  +RY    +  S + +                   + + +  W  KE+ L  +YQ  ++   + +S+     S   VL+ +L+S++   L C  +   IY
Sbjct:    6 GIYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSRLVATWLTLPVALLETMFGVRVVITGDAFVPGERSVIIMNHRTRVDWMFLWNCLMRY-SYLRVEKICLKSSLKSVPGFGWAMQVAAFIFIHRKWKDDKSHFEDMIDYFCAIHEPLQLLIFPEGTDLTENNKARSNDFAEKNGLQKYEYVLHPRTTGFTFVVDRL-REGKNLDAVHDITVAYP-YNIPQTEKHLLLGDFPKEIHFHVQRYPADSLPTSKEDL-------------------QLWCHRRWEEKEERLRSFYQGEKNFHFTGQSTVPPCKSELRVLVVKLLSIVYWALFCSAMCLLIY 327          
BLAST of Lysocardiolipin acyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q9LHN4|LPAT5_ARATH (Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase 5 OS=Arabidopsis thaliana OX=3702 GN=LPAT5 PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 7.412e-32
Identity = 84/254 (33.07%), Postives = 134/254 (52.76%), Query Frame = 1
Query:  118 LSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
            L + V+    +  ++G L+   L+L+    S K   ++    + +W      L E +   K    GDK+   +R L+I NHR+ +DW+YF+ + +R G  + + K VLKS L ++P  GWA     +I +ER  E+D+ +L  ++  F +      + +FPEGTD ++   +RS K+A + GLP   NVL PRT GF+   +E+  C    DA+YDVT  Y  K    + L  + G   +EVH   RR +L +I
Sbjct:   24 LMVLVSTAFMMLIFWGFLSAVVLRLFSIRYSRKCVSFFFGSWLALWP----FLFEKINKTKVIFSGDKVPCEDRVLLIANHRTEVDWMYFWDLALRKGQ-IGNIKYVLKSSLMKLPLFGWAFHLFEFIPVERRWEVDEANLRQIVSSFKDPRDALWLALFPEGTDYTEAKCQRSKKFAAENGLPILNNVLLPRTKGFVSCLQEL-SC--SLDAVYDVTIGY--KTRCPSFLDNVYGIEPSEVHIHIRRINLTQI 267          
BLAST of Lysocardiolipin acyltransferase 1 vs. TrEMBL
Match: C3Y0C7 (PlsC domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_121524 PE=4 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 6.905e-65
Identity = 131/375 (34.93%), Postives = 202/375 (53.87%), Query Frame = 1
Query:  133 AIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNSVLIKQLISVLLIC----GNIFTCIYALFIIPNVSLPIFFILNAIFIYVDIFQDGVDELVLKL 1245
            A +M +S++ G++      L L    PK +R  +D  +  W    ++LLE V GV+ R+ GDKI   ER LIIMNHRSRLDW++ +  L+R G  L  EKI+LK+ LK IPGPGWAMQ G ++F++R  + D+  +  M+ Y  ++ H T++L+FPEGTDL++Y ++RSN YA +  LP+Y  VLHPRT GF+++ E++ R  K  D+I+D+T  YP      NE+    GR   EVHF  RR+ L+ +  +  ++    +T                    W  KE  L E+YQ+   K  +        N    +Q+ ++L +     GN    +  L       L +  I+   +I   +   GV+++ +KL
Sbjct:   15 ASLMFLSSFLGAIFILTPMLPLMLIRPKWYRAVVDQLIGWWETFPVALLELVYGVRVRITGDKIPQGERTLIIMNHRSRLDWMFLWSCLLRRGQ-LSKEKIILKTSLKNIPGPGWAMQVGCFLFIKRRWDEDEKIIKRMLNYLISIRHETQLLLFPEGTDLTEYTRKRSNDYAKEYNLPKYNYVLHPRTTGFVYIVEKL-RKAKQLDSIHDITVGYP-AGVLQNEMDLFAGRFPREVHFHIRRHPLQTLPNTRGQLELWCTT-------------------RWAEKELQLKEFYQRKRFKDLNLVDGRKSGNHFRKEQVKAILWLSIFFWGNFVVVMLYLMANHFFLLKMTSIIAVFYIVEGLLFGGVEDMEIKL 367          
BLAST of Lysocardiolipin acyltransferase 1 vs. TrEMBL
Match: A0A5A9P8X6 (Lysocardiolipin acyltransferase 1 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti023173 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 6.209e-64
Identity = 130/372 (34.95%), Postives = 209/372 (56.18%), Query Frame = 1
Query:  100 MNLKPLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEV-------ELNSVLIKQLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIF 1194
            M +  +  +F  I + + +++GS+      + L   SP  +RW  D  +  W+   ++LLE V GVK  + GD  +  ER++IIMNHR+RLDW++ +  L+RF S LR EKI LK+ LK +PG GWAMQ  S+IF+ R  E D+ H++NM++YF ++    ++L+FPEGTDL+D  + +S+++AD+ GLP+YE VLHPRT GF  + + + R   + DA++D+T AYP ++    E   ++G+   E+HF  +RY +  +  S  ++                   +++    W  KE+ L ++YQ     P +F + E        EL   LIK   +  L+  + F  +  + +   VSL IFF+L  IF
Sbjct:   24 MAMVSVRGLFFIITLFLGSFYGSVFMLGPVVPLMLLSPAWYRWITDRIVATWLTLPVALLELVFGVKVVITGDGFVPGERSVIIMNHRTRLDWMFLWCCLLRF-SYLRLEKICLKAALKVVPGFGWAMQMASFIFIHRRWEDDRTHMTNMLQYFCHIREPVQLLLFPEGTDLTDNTRAKSDEFADRNGLPKYEFVLHPRTTGFTFIVDTL-RKGHNLDAVHDITVAYP-QNIPQTERHLVLGQFPREIHFHVQRYPVSCLPRSAVQL-------------------QSWCQERWAEKEQRLRDFYQA---VPRAFDAPEARVPPCKSELRVTLIK---AASLLYWSSFIALSCVGLWLWVSLRIFFLLMVIF 367          
BLAST of Lysocardiolipin acyltransferase 1 vs. TrEMBL
Match: A0A3B4DRA5 (Lysocardiolipin acyltransferase 1 OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.796e-63
Identity = 129/376 (34.31%), Postives = 205/376 (54.52%), Query Frame = 1
Query:  100 MNLKPLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKN----EDKPSSFRSSEVELNSVLIKQLISVLLICGNIFTCIYALFI-IPNVSLPIFFILNAIFIYVDIF 1212
            M +  +  ++  + + + ++FGS+      L L   SP  +RW  D  +  W+   ++LLE V GVK  + GD  +  ER++IIMNHR+RLDW++ +  L+R+ S LR EK+ LK+ LK +PG GWAMQ  ++IF++R  E D+ H+ NM+EYF ++    ++L+FPEGTDL+D  + RS+++A+K GLP+YE VLHPRT GF  + + + R   + DA++DVT AYP ++    E   ++G    E+HF  RRY L   L  G  ++++                  +    W  KE+ L E+Y  +    +D  +     + EL   L+K           +  C + LFI +  V L ++  L   F+ V  F
Sbjct:    1 MAMVSVRGLYFVVTLFLGSFFGSVFMLGPVLPLMLLSPAWYRWLTDRIVATWLTLPVALLEVVFGVKVVITGDGFVPGERSVIIMNHRTRLDWMFLWCCLLRY-SYLRLEKVCLKAALKAVPGFGWAMQVAAFIFIQRRWEEDRSHMENMLEYFCDIREPLQLLLFPEGTDLTDNTRARSDEFAEKNGLPKYEYVLHPRTTGFTFIVDTL-RKGNNLDAVHDVTVAYP-QNIPQTERHLMLGLFPREIHFHVRRYPLS-TLPEGSDLLQA------------------WCQDRWTEKEQRLREFYGASPRLFDDPEARVPPCKSELRVTLVKA----------VSLCYWTLFITLSFVGLWLWAPLRMYFLLVVAF 344          
BLAST of Lysocardiolipin acyltransferase 1 vs. TrEMBL
Match: A0A3B3QP71 (Lysocardiolipin acyltransferase 1 OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 3.048e-63
Identity = 124/362 (34.25%), Postives = 202/362 (55.80%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYY---QKNEDKPSSFRSSEVELNS-VLIKQLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIF 1194
             ++    + ++++FGS+      L L   SP  +RW  D  +  W+   ++LLE V GVK  + GD  I  ER++I+MNHR+RLDW++ +  L+R+ S LR EKI LK+ LK +PG GWAMQ   ++F++R  E D+ HL +M++YF  +    ++LIFPEGTDL++  + RS+ +A+K GLPRYE VLHPRT GF  + + + R   + DA++D+T AYP+ +    E   I+G+   E+HF  +RY   E+  S +++                   + +    W  KE+ L ++Y   ++ +  P   R    +  + VL+ +  S+L     +  C   L++ P   L I+ +L A+F
Sbjct:    7 GLYFVTTLFLTSFFGSVFMLGPVLPLMLLSPAWYRWLTDRIVATWLTLPVALLELVFGVKVVITGDGFIPGERSVIVMNHRTRLDWMFLWCCLLRY-SYLRLEKICLKAALKAVPGFGWAMQVACFVFIQRRWEQDRRHLGDMLDYFCAIREPLQLLIFPEGTDLTENTRARSDDFAEKNGLPRYEYVLHPRTTGFTFIVDTL-RKGDNLDAVHDITVAYPE-NIPQTERHLILGQFPQEIHFHVQRYPASELPDSAEQL-------------------QAWCQARWAEKEQRLRDFYMGARRFDAAPGVSRVPPCKTAARVLLIKAASLLYWNAFVGLCCVGLWLWP--PLRIYLLLVALF 344          
BLAST of Lysocardiolipin acyltransferase 1 vs. TrEMBL
Match: A0A3B4DRB0 (Lysocardiolipin acyltransferase 1 OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 3.951e-63
Identity = 129/377 (34.22%), Postives = 205/377 (54.38%), Query Frame = 1
Query:   97 AMNLKPLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKN----EDKPSSFRSSEVELNSVLIKQLISVLLICGNIFTCIYALFI-IPNVSLPIFFILNAIFIYVDIF 1212
             M +  +  ++  + + + ++FGS+      L L   SP  +RW  D  +  W+   ++LLE V GVK  + GD  +  ER++IIMNHR+RLDW++ +  L+R+ S LR EK+ LK+ LK +PG GWAMQ  ++IF++R  E D+ H+ NM+EYF ++    ++L+FPEGTDL+D  + RS+++A+K GLP+YE VLHPRT GF  + + + R   + DA++DVT AYP ++    E   ++G    E+HF  RRY L   L  G  ++++                  +    W  KE+ L E+Y  +    +D  +     + EL   L+K           +  C + LFI +  V L ++  L   F+ V  F
Sbjct:   17 GMAMVSVRGLYFVVTLFLGSFFGSVFMLGPVLPLMLLSPAWYRWLTDRIVATWLTLPVALLEVVFGVKVVITGDGFVPGERSVIIMNHRTRLDWMFLWCCLLRY-SYLRLEKVCLKAALKAVPGFGWAMQVAAFIFIQRRWEEDRSHMENMLEYFCDIREPLQLLLFPEGTDLTDNTRARSDEFAEKNGLPKYEYVLHPRTTGFTFIVDTL-RKGNNLDAVHDVTVAYP-QNIPQTERHLMLGLFPREIHFHVRRYPLS-TLPEGSDLLQA------------------WCQDRWTEKEQRLREFYGASPRLFDDPEARVPPCKSELRVTLVKA----------VSLCYWTLFITLSFVGLWLWAPLRMYFLLVVAF 361          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Cavefish
Match: lclat1 (lysocardiolipin acyltransferase 1 [Source:NCBI gene;Acc:406554])

HSP 1 Score: 203.371 bits (516), Expect = 5.994e-60
Identity = 113/327 (34.56%), Postives = 177/327 (54.13%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNE---DKPSS-FRSSEVELNSVLIKQL 1089
             ++  + + + ++FGS       L L   SP  +RW  D  +  W+   + ++           GD  +  ER++IIMNHR+RLDW++ +  L+R+ S LR EKI LK+ LK +PG GWAMQ  S+IF++R  E D+ H++NM+EYF ++    ++L+FPEGTDL+D  + RS+ +A+K GLP+YE VLHPRT GF  + + + R   + DA++D+T AYP K+    E   ++G    E+HF  RRY L  +    D +                   + +    W  KE+ L E+Y  +    D P +     + EL   L+K +
Sbjct:    6 GLYFLVTLFLGSFFGSTFMLGPVLPLMLLSPAWYRWLTDRIVATWLTLPVVVIT----------GDGFVPGERSVIIMNHRTRLDWMFLWCCLLRY-SYLRLEKICLKAALKAVPGFGWAMQVASFIFIQRKWEEDRSHMANMLEYFCDIREPLQLLLFPEGTDLTDNTRARSDDFAEKNGLPKYEYVLHPRTTGFTFIVDTL-RKGNNLDAVHDITVAYP-KNIPQTERHLVLGLFPREIHFHVRRYPLSVLPKQSDLL-------------------QAWCQERWAEKEQRLREFYAASPRLFDNPEARVPPCKSELRVTLVKAI 300          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Cavefish
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1924])

HSP 1 Score: 81.6481 bits (200), Expect = 2.041e-16
Identity = 53/172 (30.81%), Postives = 88/172 (51.16%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGD----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVT 771
            +++LEW  G +  LY D    K+   E A++I+NH   +D+L  +    RFG  L   K++ K EL  +P  GW       +F +R  E D+  ++  ++   +   N   L++ EGT  ++   + S + A+K GLP+ +  L PRT GF  +T + +R      A+YD T
Sbjct:   62 VAMLEWWSGTECSLYTDPESYKLYGKENAIVILNHNFEVDFLCGWTFCERFGV-LGSSKVLAKQELAYMPVIGWMWYFLEIVFCKRKWEEDRRTVAQSLQRLQDYPENFWFLLYCEGTRFTEKKHKISMEVAEKKGLPKLKYHLLPRTKGFC-VTAQNLR--GKVTAVYDST 229          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Cavefish
Match: agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:NCBI gene;Acc:103047807])

HSP 1 Score: 78.5666 bits (192), Expect = 2.781e-15
Identity = 53/180 (29.44%), Postives = 87/180 (48.33%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGDK----IISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKD-FDAIYDVTSAYPDKD 792
            + LLEW  G    LY D+    +   E  +II+NH   +D+L  + +  R+G  L   K++ K EL ++P  GW       +F +R  E D+  +   +    +       L++ EGT  ++   + S + A+  GLP+ +  L PRT GF       ++C K    A+YDVT  + DK+
Sbjct:   62 VMLLEWWSGTDCTLYTDQATVDMFGKEHVIIILNHNFEIDFLCGWTMCERYGV-LGSSKVLAKHELLKVPLIGWTWYFLEIVFCKRKWEEDRDTVFKGLHQLRDYPEYMWFLLYCEGTRFTEKKHQISMQVAESKGLPKLKYHLLPRTKGF----TTTMQCLKGTVKAVYDVTLNFKDKE 236          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Cavefish
Match: agpat5 (1-acylglycerol-3-phosphate O-acyltransferase 5 [Source:NCBI gene;Acc:103034858])

HSP 1 Score: 65.0846 bits (157), Expect = 5.636e-11
Identity = 65/250 (26.00%), Postives = 111/250 (44.40%), Query Frame = 1
Query:  130 VAIMMGVS-AYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLL---EWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAK---ERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCR 858
             A+M+G + AYF S +     +W   +S    R Y  V  +++      +L   E   GV+  +YGD     E  + + NH+S  DW+    + +R  S+L   + VLK  LK +P  GW       ++++R+   ++  +   +   + +     ++IFPEGT  +   K     S  +A K G    +++L PR        + M    +  DA+YDVT AY     A  + +     A +   FLC+
Sbjct:   18 AAVMLGTAPAYFLSWS-----MWRVLSSLLPTRLYHRVDDYIYTVYQSMVLFFFENYTGVEIIIYGDIPKKKENVVYLSNHQSTADWIIADMLAIR-QSALGHVRYVLKDGLKWLPLYGWYFSQHGGVYVKRSARFEEKTMRRKLLSQTKLGTPMYLVIFPEGTRYNPEYKGVISDSQAFAAKEGFAVLKHILTPRMKASYVAIQSMK---EHLDAVYDVTVAYEGTLTAGGQRR----TAPSMPEFLCK 254          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Sea Lamprey
Match: lclat1 (lysocardiolipin acyltransferase 1 [Source:NCBI gene;Acc:406554])

HSP 1 Score: 219.55 bits (558), Expect = 1.393e-66
Identity = 123/342 (35.96%), Postives = 186/342 (54.39%), Query Frame = 1
Query:  115 LLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNSVLIKQLISVL-LICGNIFTCIYA 1137
            L  ++ A M+ + ++ GS+      L L   +P  +RW  D  +  W+   ++LLE V GVK  + GD     ER++IIMNHR+RLDW++ +  L+R  S LR EKI LKS LK +PG GWAMQ  +++F+ R  E D+ H++  ++YF+ ++   ++L FPEGTDL+   K RS+++A+K GLP+YE+VLHPRT GF H+ + +    K  D ++DVT AYP   F  NELQ + GR   E+HF  RR+ +  +    D    +    D                  W +KE ML  +Y       +       +  S L  + +  L L+   +FTC+ A
Sbjct:    5 LGGVYFATMLFLGSFLGSVFMLGPFLPLLLVNPPWYRWLTDRIVATWLTLPVALLELVFGVKVVVTGDGFRPGERSVIIMNHRTRLDWMFLWNCLLR-SSYLRLEKICLKSTLKHVPGFGWAMQVAAFVFIARRWEQDEQHIARHLDYFTAIDQRLQLLFFPEGTDLTANTKARSDQFAEKNGLPKYEHVLHPRTTGFTHIVQRLHSGGK-LDCVHDVTVAYP-CSFPQNELQLLAGRFPHEIHFHVRRHPVSTL--PLDSAGLAAWCCDR-----------------WLDKEAMLRSFYNGAVVAAAPMEPPVPQCKSELRVRCVQWLSLVWWTVFTCVAA 324          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Sea Lamprey
Match: agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2765])

HSP 1 Score: 68.9366 bits (167), Expect = 7.965e-13
Identity = 49/185 (26.49%), Postives = 85/185 (45.95%), Query Frame = 1
Query:  328 SNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDF-DAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
              E A++++NH   +D+L  + +  R+G  L   K++ K EL ++P  GW       +F +R  E D+  +   +    +       L++ EGT  ++     S + A   GLP+ ++ L PRT GF       + C +    A+YDVT  +  KD     L  I+     +     RR+ LK++
Sbjct:   86 GKEHAIVVLNHNYEVDFLCGWTMCERYGV-LGASKVLAKRELLKVPLIGWTWYFLEIVFCKRRWEEDRQAVLQGLHRIRDYPEYVWFLLYCEGTRFTEKKHRISMEVAKAKGLPKLKHHLLPRTKGF----TTTVHCLRGMAGAVYDVTLNF--KDNKNPSLLGILYGKKYQADMCVRRFPLKDL 263          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Sea Lamprey
Match: agpat5 (1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) [Source:ZFIN;Acc:ZDB-GENE-060929-914])

HSP 1 Score: 68.5514 bits (166), Expect = 8.596e-13
Identity = 68/288 (23.61%), Postives = 122/288 (42.36%), Query Frame = 1
Query:  292 GVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAK---ERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKD-FDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDK------PSSFRSSEVELNSVLIKQLISVLLICGNIFT 1125
            G++  LYGD     E  + + NH+S +DW+    + +R  ++L   + VLK  LK +P  GW       ++++R    ++  +   ++     +    ++IFPEGT  +  A    E S  +A+K GLP   +VL PR    +  T   +    D   AIYD+T AY     A    +     A +   FLC             ++      ID+ +        K +++  +  K+K++ ++Y++   K      P S ++S + L   L   +    L    + T
Sbjct:   71 GLEVVLYGDLPSEKENVIYLSNHQSTVDWVVADMLAVR-QNALGHVRYVLKDGLKWLPLYGWYFSQHGGVYVKRRDHYNEKAIERKLKAQMEAQIPMYLVIFPEGTRYNPEAANVIEASKAFANKEGLPELSHVLTPR----IRATHAALNAMSDHLHAIYDITVAYEGTLDAAGRRK----TAPSMPEFLC---------CESPRVHIHFERIDIQEVPHEPHFFKLWLHERFEKKDKLMADFYERAAMKGGEWGFPGSPKASRLRLRRTLPSAVFLATLTLPMLLT 340          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Yeast
Match: YDR018C_mRNA (Probable membrane protein with three predicted transmembrane domains; similar to C. elegans F55A11.5 and maize 1-acyl-glycerol-3-phosphate acyltransferase; YDR018C has a paralog, CST26, that arose from the whole genome duplication [Source:SGD;Acc:S000002425])

HSP 1 Score: 72.7886 bits (177), Expect = 3.083e-14
Identity = 68/267 (25.47%), Postives = 118/267 (44.19%), Query Frame = 1
Query:  334 ERALIIMNHRSRLDWLYFYGILMRFGSSLRDE-KIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSN--------------MIEYFSNVEHNTK------ILIFPEGTDLSDYAKERSNKYADKMGLPRYE--NVLHPRTAGFLHLTEEMIRCFKDFDAIYDVT--------SAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSS 1041
            +RA+II NH+   DW+Y +   + F S+L     I+LK  L+ IP  G+ M+   +IFL RN + D+  L+N              +  Y S      +      +++FPEGT+LS   +E+S  +  +  L   +  ++L P + G     E++       DAIYDVT        + Y    F   ++ F+MG    +V F  R + + EI    D++                     ++  +W  K+++L +YY   + K ++
Sbjct:  109 DRAIIIANHQMYADWIYLW--WLSFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEKALTNSLVSMDLNARCKGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHLDHVQLRHLLLPHSKGLKFAVEKLA---PSLDAIYDVTIGYSPALRTEYVGTKFTLKKI-FLMGVYPEKVDFYIREFRVNEIPLQDDEVF------------------FNWLLGVWKEKDQLLEDYYNTGQFKSNA 351          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Yeast
Match: CST26 (Acyltransferase; enzyme mainly responsible for the introduction of saturated very long chain fatty acids into neo-synthesized molecules of phosphatidylinositol; required for incorporation of stearic acid into phosphatidylinositol; affects chromosome stability when overexpressed; CST26 has a paralog, YDR018C, that arose from the whole genome duplication [Source:SGD;Acc:S000000246])

HSP 1 Score: 64.6994 bits (156), Expect = 1.118e-11
Identity = 71/319 (22.26%), Postives = 134/319 (42.01%), Query Frame = 1
Query:  340 ALIIMNHRSRLDWLYFYGILMRFGSSLRDEK-IVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTK------------------------------------ILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPD-KDFACNEL------QFIMGRASTEVHFLCRRYSLKEI-LGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYY---------QKNEDKPSSFRSSEVELNSVLIKQLISVLLICGNIFTCIY 1134
            ++ I NH+   DW++ +   + + S+L     I+LK  L  IP  G+ M+  ++IF+ R    DK+ LSN +   + ++ N +                                    +++FPEGT+LS   +++S KYA K+G   ++NVL P + G   L   + +     +++YD+T  Y   K     EL       F+ G+    V    R + +K+I L   ++  + +  I                   W+ K+ ++  YY         + N     SF+ + +EL  VLI   ++++ +   ++  I+
Sbjct:  106 SVAICNHQIYTDWIFLW--WLAYTSNLGANVFIILKKSLASIPILGFGMRNYNFIFMSRKWAQDKITLSNSL---AGLDSNARGAGSLAGKSPERITEEGESIWNPEVIDPKQIHWPYNLILFPEGTNLSADTRQKSAKYAAKIGKKPFKNVLLPHSTG---LRYSLQKLKPSIESLYDITIGYSGVKQEEYGELIYGLKSIFLEGKYPKLVDIHIRAFDVKDIPLEDENEFSEWLYKI-------------------WSEKDALMERYYSTGSFVSDPETNHSVTDSFKINRIELTEVLILPTLTIIWLVYKLYCFIF 397          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Yeast
Match: SLC1 (1-acyl-sn-glycerol-3-phosphate acyltransferase; catalyzes the acylation of lysophosphatidic acid to form phosphatidic acid, a key intermediate in lipid metabolism; enzymatic activity detected in lipid particles and microsomes [Source:SGD;Acc:S000002210])

HSP 1 Score: 46.2098 bits (108), Expect = 6.352e-6
Identity = 30/113 (26.55%), Postives = 60/113 (53.10%), Query Frame = 1
Query:  274 LLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKIL-IFPEGT 609
            +++ ++G+  ++ G++ ++ +  ++I NH+S LD ++  G +   G +     +  K  LK +P  GW M      FL+R+   + +   N  +   NV+ N + L +FPEGT
Sbjct:   54 VMKLMLGLDVKVVGEENLAKKPYIMIANHQSTLD-IFMLGRIFPPGCT-----VTAKKSLKYVPFLGWFMALSGTYFLDRSKRQEAIDTLN--KGLENVKKNKRALWVFPEGT 158          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Nematostella
Match: EDO35690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKS7])

HSP 1 Score: 195.667 bits (496), Expect = 2.881e-57
Identity = 125/400 (31.25%), Postives = 198/400 (49.50%), Query Frame = 1
Query:  112 PLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFL----HLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYY-------QKNEDKPSSFRSSEVELNSVLIKQLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIFIYVDIFQDGVDELVLKLSLKDKYRTFSR 1278
            P+  +   + +  S++FGS+      L L    PK FRWY D+ + +W+    ++LE V  VK  + G++   N+RALI+MNHR RLDW++++ +L R+G  LR EKI+LK +LK +PGPGWAMQ   YIFL R  E D+ +LS++++YF    +  ++LIFPEGT+L   +K +S+ +A K   P YE VLHPR  GF      L +E++    D    YDV  ++ ++D        ++G    E+HF  +R+ +  +  S  + ++                        W  KE  L E+Y         NE+  +     E E  + L + L+  +      F  +Y +  I       F+++   +I   +   G D    KL L    R +SR
Sbjct:    5 PIGGVLFLLTLYFSSFFGSIFIMGPSLPLLLWHPKWFRWYNDLAIGLWLKLPPAILELVFNVKVYITGERPPRNDRALIVMNHRCRLDWMFYWCVLHRYGQ-LRHEKIILKDDLKNVPGPGWAMQNSMYIFLRRRWEHDQGYLSSVLQYFKEASYPLQLLIFPEGTNLDIASKAKSDSFAKKNNRPSYEYVLHPRVRGFTFCMEKLGKELLHSIHDVTIGYDVNKSFSERD-------LLLGTFPKEMHFHIQRHPIGNVNSSNAEEMEKWCCER------------------WEEKENRLKEFYTLGQGFRHFNEEVTAQDSQREGEARTELWQALVFWVAFIFLSFLSVYHILAIRWY----FYVVFVFYILQSVLGIGTD----KLQLWSHDRQYSR 370          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Nematostella
Match: EDO40659 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J2])

HSP 1 Score: 190.66 bits (483), Expect = 2.507e-55
Identity = 98/256 (38.28%), Postives = 159/256 (62.11%), Query Frame = 1
Query:  112 PLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
            P+       ++  S++FG +      L L   +P+ FRW+ D  + MW+  + ++LE + GVK  + GDK  + + +LIIMNHR   DW++++ +L+R+G+ L+  +I++K  L+RIPG GW MQ   YIFL R  E D+ +L+ +++YF ++ +  +++IFPEGT+L D ++  S+ +A K  LP YE VLHPR  GF+H  E++    +  DAI+DVT AY D+++   E   I+G    E+HF  +RY + EI
Sbjct:    5 PIGGFLYLAILYFSSFFGVIFILGPSLPLLLLNPRWFRWFNDKAISMWLVLAPAMLELIHGVKVTITGDKPPTGDTSLIIMNHRCHFDWMFYWSVLVRYGN-LQYLRIIMKDVLRRIPGIGWGMQQAMYIFLRRRWEQDEGYLNTILDYFKDLNYPLQLMIFPEGTNLEDRSRVHSDSFARKNNLPIYEYVLHPRVRGFVHCVEKLRHGPRRMDAIHDVTIAY-DRNYCFTEKDIILGDFPREIHFHIKRYPISEI 258          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Nematostella
Match: EDO40658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J1])

HSP 1 Score: 120.553 bits (301), Expect = 1.034e-30
Identity = 58/137 (42.34%), Postives = 87/137 (63.50%), Query Frame = 1
Query:  469 PGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
            PGW MQ   YIFL R  E D+ +L+ +++YF ++ +  +++IFPEGT+L D ++  S+ +A K  LP YE VLHPR  GF+H  E++    +  DAI+DVT AY D+++   E   I+G    E+HF  +RY + EI
Sbjct:   16 PGWGMQQAMYIFLRRRWEQDEGYLNTILDYFKDLNYPLQLMIFPEGTNLEDRSRVHSDSFARKNNLPIYEYVLHPRVRGFVHCVEKLRHGPRRMDAIHDVTIAY-DRNYCFTEKDIILGDFPREIHFHIKRYPISEI 151          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Nematostella
Match: EDO29842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2H2])

HSP 1 Score: 85.1149 bits (209), Expect = 6.592e-18
Identity = 63/232 (27.16%), Postives = 108/232 (46.55%), Query Frame = 1
Query:  226 WYIDVTMFMWICSSIS---------LLEWVIGVKFRLYGD----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKD-FDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
            W  + T++ WI   +          L++W      RLYG+    +    E A+ + NHRS +DWL  + +  R   +L   K  +K  LK +P  G++     Y F+ RN + D+  L N ++   +  +   I IF EGT L+    + S +YA    +P  ++ L PR  GF       ++  KD   A+YD+  A+ +  +    ++ ++     E+H L RR  +K+I
Sbjct:   40 WTFNKTLYRWINMHVVYLHWSQLTFLVDWWSETDLRLYGNEEDFRYFGKESAICVANHRSDVDWLIGWVMADRV-DTLGTTKCYMKGYLKYLPIMGFSWLSSEYAFVSRNWQKDQRVLQNSLDTLQDFPYPFWIAIFAEGTRLTQEKLQASIEYARSKNIPELQHHLLPRPRGF----SITVQHLKDKVSAVYDMEVAFVEGKYPT--MKGLLLGVKYEIHLLIRRIPVKDI 264          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Nematostella
Match: EDO36141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJL6])

HSP 1 Score: 66.6254 bits (161), Expect = 3.861e-12
Identity = 53/180 (29.44%), Postives = 84/180 (46.67%), Query Frame = 1
Query:  370 LDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLS---DYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDF-DAIYDVTSAY------PDKDFACNELQFIMGRASTEVHFLCRRYSLKEI 879
            +DWL    + +R GS L   + +LK  LK +P  G+       I++ R+   D  H+   ++          ++IFPEGT  +     + E+S  +A+  GLP  ++VL PRT      TE  +    D+ DA+YDVT AY      P    A   +   +     +VH  C RY+ ++I
Sbjct:   16 VDWLVADLLAIRQGS-LGRIRYILKDGLKFLPLYGFYFGQHGGIYVRRSGPRDHYHIIRKLDQLKKNNTPMWLVIFPEGTRYNIDRPESIEKSKAFAEGEGLPVLQHVLTPRTKA----TEASLEAVGDYIDAVYDVTIAYKGVTENPLPRTAAKGMPDFLASWGQQVHIYCHRYTPEQI 190          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Medaka
Match: lclat1 (lysocardiolipin acyltransferase 1 [Source:NCBI gene;Acc:101155556])

HSP 1 Score: 208.764 bits (530), Expect = 1.252e-61
Identity = 126/393 (32.06%), Postives = 208/393 (52.93%), Query Frame = 1
Query:  121 SIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKN-----EDKPSSFRSSEVELNSVLIKQLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIFIYVDIFQDGVDELVLKLSLKDKYRTFSRSG 1284
             ++  + + + ++FGS+      L L   SP  +RW  D  +  W+   +SLLE V GVK  + GD  I  ER++IIMNHR+RLDW++ +  L+R+ S LR EKI LK+ LK +PG GWAMQ   ++F+ R  ++DK HL NM++YF +++   ++L+FPEGTDL++  K +S+ +A+K  LP+ E VLHPR+ GF  + +++ +   + DA++D+T AYP K+    E   I+G    E+HF   RY +  +  +   +                   + +    W  KE  L ++Y         D  +     + EL   LIK   S+L     I  C   L++   V L    ++ A+++    F  G++  +L+LS    +++ S + 
Sbjct:    7 GLYFVVTLFLGSFFGSIFMLGPVLPLMLVSPAWYRWLTDRIVATWLTLPVSLLELVFGVKVVITGDGFIPGERSVIIMNHRTRLDWMFLWCCLLRY-SYLRLEKICLKAGLKAVPGFGWAMQVACFVFIHRRWDVDKKHLENMLDYFCDIKEPLQLLLFPEGTDLTENTKTKSDAFAEKNKLPKLEYVLHPRSTGFTFIVDKLQKG-DNLDAVHDITVAYP-KNIPQTERHLILGHFPREIHFHVIRYPVSSLPAASSDL-------------------ELWCRERWAEKEVRLRDFYSSQPRGFVRDGVALVPPCKSELRVSLIKA-ASLLYWTSFIALCFTGLWLWTPVRL-YCLVMIAVYVVQQKFFGGME--LLELSFHQYWKSRSENA 373          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Medaka
Match: agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:NCBI gene;Acc:101155591])

HSP 1 Score: 80.4925 bits (197), Expect = 5.851e-16
Identity = 55/180 (30.56%), Postives = 87/180 (48.33%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGDK----IISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKD-FDAIYDVTSAYPDKD 792
            + LLEW  G +  LY D+    +   E  +II+NH   +D+L  + I  R+G  L   K++ K EL ++P  GW       +F +R  E D+  +   +    +       L++ EGT  ++   + S + A+  GLP+ +  L PRT GF       +RC K    A+YDVT  + DK 
Sbjct:   62 VMLLEWWSGTECTLYTDQATVDMFGKEHVIIILNHNFEIDFLCGWTICERYGV-LGGSKVLAKHELLKVPLIGWTWYFLEIVFCKRRWEEDRDTVFKGLGRLRDYPEYMWFLLYCEGTRFTEKKHQISMQVAESKGLPQLKYHLLPRTKGF----TTTLRCLKGTVKAVYDVTLNFQDKQ 236          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Medaka
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 [Source:NCBI gene;Acc:101156844])

HSP 1 Score: 78.1814 bits (191), Expect = 3.177e-15
Identity = 52/179 (29.05%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGDK----IISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKD 792
            +++LEW  G +  LY D     +   E A++++NH   +D+L  +    RFG  L   K++ K EL  +P  GW       +F +R  E D+  ++  ++   +   N   L+F EGT  +    + S + A+  GLP+ +  L PRT GF  +T + +R      A+YD T  + D +
Sbjct:   62 VAVLEWWSGTECTLYTDPKSYPLYGKENAIVLLNHNFEIDFLCGWTFCERFGV-LGSSKVLAKQELAYVPVIGWMWYFLEIVFCKRKWEEDRRLVAQSLQNLRDYPENYWFLLFCEGTRFTPEKHQASMQVAESKGLPKLKYHLLPRTKGFW-MTVQNLR--GTVSAVYDSTLNFRDNE 236          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Medaka
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 [Source:NCBI gene;Acc:101156844])

HSP 1 Score: 77.7962 bits (190), Expect = 5.249e-15
Identity = 52/179 (29.05%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGDK----IISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKD 792
            +++LEW  G +  LY D     +   E A++++NH   +D+L  +    RFG  L   K++ K EL  +P  GW       +F +R  E D+  ++  ++   +   N   L+F EGT  +    + S + A+  GLP+ +  L PRT GF  +T + +R      A+YD T  + D +
Sbjct:   90 VAVLEWWSGTECTLYTDPKSYPLYGKENAIVLLNHNFEIDFLCGWTFCERFGV-LGSSKVLAKQELAYVPVIGWMWYFLEIVFCKRKWEEDRRLVAQSLQNLRDYPENYWFLLFCEGTRFTPEKHQASMQVAESKGLPKLKYHLLPRTKGFW-MTVQNLR--GTVSAVYDSTLNFRDNE 264          
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Medaka
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 [Source:NCBI gene;Acc:101156844])

HSP 1 Score: 77.411 bits (189), Expect = 6.384e-15
Identity = 52/179 (29.05%), Postives = 88/179 (49.16%), Query Frame = 1
Query:  268 ISLLEWVIGVKFRLYGDK----IISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKD 792
            +++LEW  G +  LY D     +   E A++++NH   +D+L  +    RFG  L   K++ K EL  +P  GW       +F +R  E D+  ++  ++   +   N   L+F EGT  +    + S + A+  GLP+ +  L PRT GF  +T + +R      A+YD T  + D +
Sbjct:   62 VAVLEWWSGTECTLYTDPKSYPLYGKENAIVLLNHNFEIDFLCGWTFCERFGV-LGSSKVLAKQELAYVPVIGWMWYFLEIVFCKRKWEEDRRLVAQSLQNLRDYPENYWFLLFCEGTRFTPEKHQASMQVAESKGLPKLKYHLLPRTKGFW-MTVQNLR--GTVSAVYDSTLNFRDNE 236          
BLAST of Lysocardiolipin acyltransferase 1 vs. Planmine SMEST
Match: SMESG000041961.1 (SMESG000041961.1)

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 413/413 (100.00%), Postives = 413/413 (100.00%), Query Frame = 1
Query:  100 MNLKPLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDXXXXXXXXXXXXXXINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNSVLIKQLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIFIYVDIFQDGVDELVLKLSLKDKYRTFSRSGISQQHRKHSNDGKIIKEE 1338
            MNLKPLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDLFKEEETEEKLKTFINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNSVLIKQLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIFIYVDIFQDGVDELVLKLSLKDKYRTFSRSGISQQHRKHSNDGKIIKEE
Sbjct:    1 MNLKPLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMFMWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDKIVKSVSTIDLFKEEETEEKLKTFINVLWNNKEKMLTEYYQKNEDKPSSFRSSEVELNSVLIKQLISVLLICGNIFTCIYALFIIPNVSLPIFFILNAIFIYVDIFQDGVDELVLKLSLKDKYRTFSRSGISQQHRKHSNDGKIIKEE 413          
BLAST of Lysocardiolipin acyltransferase 1 vs. Planmine SMEST
Match: SMESG000046088.1 (SMESG000046088.1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.941e-22
Identity = 70/222 (31.53%), Postives = 110/222 (49.55%), Query Frame = 1
Query:  259 CSSISLLEWVIGVKFRLYGD----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTK--ILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYP---DKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDK 897
            C    + +W   +K RLY +    K + +E ALIIMNH+  +DWL  + +  ++G  L      +K  LK IP  GW  +    IFL+R+   DKL +SN      +  HN +  +L++PEGT  +D   + SNK A    +    N L PR  GF+ +    IR   +   IYD+T A+P   + + A   +  ++     E H L RRY ++++    D+
Sbjct:   29 CQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGC-LGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHA-IR--NNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDE 246          
BLAST of Lysocardiolipin acyltransferase 1 vs. Planmine SMEST
Match: SMESG000046088.1 (SMESG000046088.1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.952e-22
Identity = 70/222 (31.53%), Postives = 110/222 (49.55%), Query Frame = 1
Query:  259 CSSISLLEWVIGVKFRLYGD----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTK--ILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYP---DKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDK 897
            C    + +W   +K RLY +    K + +E ALIIMNH+  +DWL  + +  ++G  L      +K  LK IP  GW  +    IFL+R+   DKL +SN      +  HN +  +L++PEGT  +D   + SNK A    +    N L PR  GF+ +    IR   +   IYD+T A+P   + + A   +  ++     E H L RRY ++++    D+
Sbjct:   33 CQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGC-LGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHA-IR--NNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDE 250          
BLAST of Lysocardiolipin acyltransferase 1 vs. Planmine SMEST
Match: SMESG000046088.1 (SMESG000046088.1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.208e-22
Identity = 69/222 (31.08%), Postives = 109/222 (49.10%), Query Frame = 1
Query:  259 CSSISLLEWVIGVKFRLYGD----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTK--ILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYP---DKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDK 897
            C    + +W   +K RLY +    K + +E ALIIMNH+  +DWL  + +  ++G  L      +K  LK IP  GW  +    IFL+R+   DKL +SN      +  HN +  +L++PEGT  +D   + SNK A    +    N L PR  GF+ +   +    K    IYD+T A+P   + + A   +  ++     E H L RRY ++++    D+
Sbjct:   28 CQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGC-LGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVK---VIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDE 245          
BLAST of Lysocardiolipin acyltransferase 1 vs. Planmine SMEST
Match: SMESG000046088.1 (SMESG000046088.1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.250e-22
Identity = 70/222 (31.53%), Postives = 110/222 (49.55%), Query Frame = 1
Query:  259 CSSISLLEWVIGVKFRLYGD----KIISNERALIIMNHRSRLDWLYFYGILMRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNMIEYFSNVEHNTK--ILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRTAGFLHLTEEMIRCFKDFDAIYDVTSAYP---DKDFACNELQFIMGRASTEVHFLCRRYSLKEILGSGDK 897
            C    + +W   +K RLY +    K + +E ALIIMNH+  +DWL  + +  ++G  L      +K  LK IP  GW  +    IFL+R+   DKL +SN      +  HN +  +L++PEGT  +D   + SNK A    +    N L PR  GF+ +    IR   +   IYD+T A+P   + + A   +  ++     E H L RRY ++++    D+
Sbjct:   63 CQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGC-LGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHA-IR--NNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDE 280          
The following BLAST results are available for this feature:
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LCLAT16.304e-6235.95lysocardiolipin acyltransferase 1 [Source:HGNC Sym... [more]
LCLAT12.146e-6135.95lysocardiolipin acyltransferase 1 [Source:HGNC Sym... [more]
LCLAT12.046e-5243.35lysocardiolipin acyltransferase 1 [Source:HGNC Sym... [more]
LCLAT13.420e-2640.91lysocardiolipin acyltransferase 1 [Source:HGNC Sym... [more]
LCLAT15.068e-2640.91lysocardiolipin acyltransferase 1 [Source:HGNC Sym... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acl-82.721e-5636.73ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-93.430e-5230.98ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-93.430e-5230.98ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
bus-185.164e-5030.18pep chromosome:WBcel235:V:11773720:11776631:1 gene... [more]
acl-113.337e-1427.57ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Agpat43.157e-1831.84gene:FBgn0036622 transcript:FBtr0331172[more]
Agpat43.157e-1831.84gene:FBgn0036622 transcript:FBtr0075422[more]
Agpat43.157e-1831.84gene:FBgn0036622 transcript:FBtr0075421[more]
Agpat33.427e-1828.78gene:FBgn0036623 transcript:FBtr0075417[more]
Agpat33.427e-1828.78gene:FBgn0036623 transcript:FBtr0075419[more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lclat16.149e-6037.14lysocardiolipin acyltransferase 1 [Source:NCBI gen... [more]
agpat32.531e-1629.191-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
agpat47.692e-1428.421-acylglycerol-3-phosphate O-acyltransferase 4 (ly... [more]
agpat59.051e-1423.321-acylglycerol-3-phosphate O-acyltransferase 5 (ly... [more]
agpat41.031e-1328.421-acylglycerol-3-phosphate O-acyltransferase 4 (ly... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tiprl4.089e-6040.38TOR signaling pathway regulator [Source:Xenbase;Ac... [more]
tiprl7.960e-6040.38TOR signaling pathway regulator [Source:Xenbase;Ac... [more]
c19orf449.984e-1428.30chromosome 19 open reading frame 44 [Source:Xenbas... [more]
mn17.600e-1326.62meningioma (disrupted in balanced translocation) 1... [more]
mn17.857e-1326.62meningioma (disrupted in balanced translocation) 1... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lclat14.802e-6034.59lysocardiolipin acyltransferase 1 [Source:MGI Symb... [more]
Lclat11.282e-5934.59lysocardiolipin acyltransferase 1 [Source:MGI Symb... [more]
Lclat17.445e-5143.88lysocardiolipin acyltransferase 1 [Source:MGI Symb... [more]
Agpat42.123e-1427.981-acylglycerol-3-phosphate O-acyltransferase 4 (ly... [more]
Agpat58.874e-1225.091-acylglycerol-3-phosphate O-acyltransferase 5 (ly... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F3X0|LCLT1_CHICK2.543e-6342.31Lysocardiolipin acyltransferase 1 OS=Gallus gallus... [more]
sp|Q6UWP7|LCLT1_HUMAN1.031e-6035.95Lysocardiolipin acyltransferase 1 OS=Homo sapiens ... [more]
sp|Q6NYV8|LCLT1_DANRE4.642e-5937.14Lysocardiolipin acyltransferase 1 OS=Danio rerio O... [more]
sp|Q3UN02|LCLT1_MOUSE8.967e-5934.59Lysocardiolipin acyltransferase 1 OS=Mus musculus ... [more]
sp|Q9LHN4|LPAT5_ARATH7.412e-3233.07Probable 1-acyl-sn-glycerol-3-phosphate acyltransf... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Y0C76.905e-6534.93PlsC domain-containing protein OS=Branchiostoma fl... [more]
A0A5A9P8X66.209e-6434.95Lysocardiolipin acyltransferase 1 OS=Triplophysa t... [more]
A0A3B4DRA52.796e-6334.31Lysocardiolipin acyltransferase 1 OS=Pygocentrus n... [more]
A0A3B3QP713.048e-6334.25Lysocardiolipin acyltransferase 1 OS=Paramormyrops... [more]
A0A3B4DRB03.951e-6334.22Lysocardiolipin acyltransferase 1 OS=Pygocentrus n... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lclat15.994e-6034.56lysocardiolipin acyltransferase 1 [Source:NCBI gen... [more]
agpat42.041e-1630.811-acylglycerol-3-phosphate O-acyltransferase 4 (ly... [more]
agpat32.781e-1529.441-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
agpat55.636e-1126.001-acylglycerol-3-phosphate O-acyltransferase 5 [So... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lclat11.393e-6635.96lysocardiolipin acyltransferase 1 [Source:NCBI gen... [more]
agpat37.965e-1326.491-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
agpat58.596e-1323.611-acylglycerol-3-phosphate O-acyltransferase 5 (ly... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YDR018C_mRNA3.083e-1425.47Probable membrane protein with three predicted tra... [more]
CST261.118e-1122.26Acyltransferase; enzyme mainly responsible for the... [more]
SLC16.352e-626.551-acyl-sn-glycerol-3-phosphate acyltransferase; ca... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356902.881e-5731.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406592.507e-5538.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406581.034e-3042.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298426.592e-1827.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361413.861e-1229.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lclat11.252e-6132.06lysocardiolipin acyltransferase 1 [Source:NCBI gen... [more]
agpat35.851e-1630.561-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
agpat43.177e-1529.051-acylglycerol-3-phosphate O-acyltransferase 4 [So... [more]
agpat45.249e-1529.051-acylglycerol-3-phosphate O-acyltransferase 4 [So... [more]
agpat46.384e-1529.051-acylglycerol-3-phosphate O-acyltransferase 4 [So... [more]
back to top
BLAST of Lysocardiolipin acyltransferase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041961.10.000e+0100.00SMESG000041961.1[more]
SMESG000046088.12.941e-2231.53SMESG000046088.1[more]
SMESG000046088.12.952e-2231.53SMESG000046088.1[more]
SMESG000046088.13.208e-2231.08SMESG000046088.1[more]
SMESG000046088.13.250e-2231.53SMESG000046088.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023289 ID=SMED30023289|Name=Lysocardiolipin acyltransferase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1663bp
CACAATATGTGAAATTATAACTTTAAAGCATTTTTAATAAAAGTTTTAGA
TAAGAAATTTAGTTTCGTGTATTTAATTTAATTAGTTTAAATATTGGCTA
TGAATCTAAAACCTCTTCTTTCTATTTTTGTTGCCATTATGATGGGAGTT
TCAGCTTACTTTGGATCTCTGACATATCAATGCCTACAATTATGGCTTGC
ATTCGCATCTCCAAAAGCATTTAGATGGTATATCGATGTTACAATGTTTA
TGTGGATATGTTCTTCAATTTCATTACTTGAATGGGTAATTGGAGTTAAA
TTCCGATTATATGGCGATAAAATAATTTCAAATGAACGTGCTTTAATTAT
AATGAACCACCGATCACGATTAGATTGGCTGTATTTTTATGGAATATTAA
TGCGCTTTGGATCTTCATTGAGAGATGAAAAAATAGTTTTAAAAAGTGAA
TTGAAACGAATTCCAGGCCCCGGGTGGGCAATGCAGTGTGGTAGTTATAT
ATTTTTGGAAAGGAATTTAGAAATCGATAAGCTCCATTTATCAAATATGA
TAGAATATTTTTCGAATGTAGAACATAACACAAAAATTCTTATTTTTCCC
GAAGGTACAGATCTTTCTGATTATGCAAAAGAAAGAAGTAATAAATATGC
CGACAAAATGGGATTACCACGATATGAAAATGTTTTACATCCGAGAACTG
CTGGATTTCTCCATCTTACCGAAGAAATGATTCGGTGCTTCAAAGATTTT
GATGCCATCTATGATGTTACATCTGCATATCCAGACAAAGATTTCGCATG
TAATGAGTTGCAATTTATAATGGGTAGAGCATCGACTGAGGTGCATTTTC
TTTGTCGTAGATACTCACTGAAGGAAATTCTCGGAAGTGGTGATAAGATA
GTGAAATCTGTAAGCACGATAGATCTATTCAAAGAAGAAGAAACTGAAGA
AAAATTGAAAACATTTATAAACGTATTATGGAATAATAAAGAGAAAATGT
TGACGGAATATTACCAGAAAAACGAAGACAAACCATCGAGTTTTCGGAGC
TCAGAAGTCGAACTGAATTCTGTGCTCATCAAACAACTGATCAGTGTCTT
GTTGATTTGTGGAAACATTTTCACATGCATTTATGCGCTATTTATTATTC
CGAATGTCTCTCTGCCGATTTTCTTTATACTGAACGCTATTTTCATATAT
GTCGACATTTTTCAGGACGGTGTCGACGAGTTGGTTCTCAAACTCAGCTT
GAAAGATAAATATCGCACTTTTTCCAGAAGCGGCATTTCACAGCAACATA
GAAAACATTCGAATGATGGAAAGATAATTAAAGAAGAATAATTTATTAAT
TGCAATATATCTTATTTTCTAGATAGAATTTTTTAATGTGACACACGCGC
GATATCTTGTAAATTTTTTAAAAATTTTTCCGATTAGCATTATTGATATT
ATATAAATATATAATTGTAATATTGATTGTTATTGCCTATAATGATTTGT
TGATTTAAATTTCTATTCTATTGGTTACTATGGCAACAAATCTGATTGGT
CGGTTTTTTCACATATTTGAATAATTTCCGAGTTTCACTAAATTTTTCAT
ATCGAAAACATTAAAGCATTCCAACTGTTATTATTATCATTAATATTATC
ATTAATATTATCA
back to top

protein sequence of SMED30023289-orf-1

>SMED30023289-orf-1 ID=SMED30023289-orf-1|Name=SMED30023289-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=414bp
MNLKPLLSIFVAIMMGVSAYFGSLTYQCLQLWLAFASPKAFRWYIDVTMF
MWICSSISLLEWVIGVKFRLYGDKIISNERALIIMNHRSRLDWLYFYGIL
MRFGSSLRDEKIVLKSELKRIPGPGWAMQCGSYIFLERNLEIDKLHLSNM
IEYFSNVEHNTKILIFPEGTDLSDYAKERSNKYADKMGLPRYENVLHPRT
AGFLHLTEEMIRCFKDFDAIYDVTSAYPDKDFACNELQFIMGRASTEVHF
LCRRYSLKEILGSGDKIVKSVSTIDLFKEEETEEKLKTFINVLWNNKEKM
LTEYYQKNEDKPSSFRSSEVELNSVLIKQLISVLLICGNIFTCIYALFII
PNVSLPIFFILNAIFIYVDIFQDGVDELVLKLSLKDKYRTFSRSGISQQH
RKHSNDGKIIKEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002123Plipid/glycerol_acylTrfase
Vocabulary: molecular function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
GO:00038411-acylglycerol-3-phosphate O-acyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0006629lipid metabolic process
GO:0007275multicellular organism development
GO:0008654phospholipid biosynthetic process
GO:0016024CDP-diacylglycerol biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005829cytosol
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002123Phospholipid/glycerol acyltransferaseSMARTSM00563plsc_2coord: 81..196
e-value: 2.4E-15
score: 67.0
IPR002123Phospholipid/glycerol acyltransferasePFAMPF01553Acyltransferasecoord: 69..227
e-value: 6.9E-22
score: 77.5
NoneNo IPR availablePANTHERPTHR109831-ACYLGLYCEROL-3-PHOSPHATE ACYLTRANSFERASE-RELATEDcoord: 9..381
NoneNo IPR availablePANTHERPTHR10983:SF59LYSOCARDIOLIPIN ACYLTRANSFERASE 1coord: 9..381
NoneNo IPR availableCDDcd07990LPLAT_LCLAT1-likecoord: 59..250
e-value: 1.17885E-66
score: 208.632
NoneNo IPR availableSUPERFAMILYSSF69593Glycerol-3-phosphate (1)-acyltransferasecoord: 29..170
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 344..366