Tubulin beta chain

Overview
NameTubulin beta chain
Smed IDSMED30023283
Length (bp)514
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023283

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30023283h1SMcG0007869 SmedASXL_008674SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30023283h1SMcG0004197 Contig5007GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023283h1SMcG0007869 Contig5007GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30023283h1SMcG0007869 dd_Smed_v4_13626_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30023283h1SMcG0007869 Contig5007_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30023283h1SMcG0007869 Contig5007_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30023283h1SMcG0007869 Contig5007_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
neoblastSMED30023283h1SMcG0007869 SMED_05331_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023283h1SMcG0007869 SMED_05331_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 356.681 bits (914), Expect = 1.281e-124
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQ+FDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   86 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 256          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 356.681 bits (914), Expect = 1.281e-124
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQ+FDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   86 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 256          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 356.681 bits (914), Expect = 1.281e-124
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQ+FDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   86 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 256          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 356.681 bits (914), Expect = 1.281e-124
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQ+FDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   86 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 256          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 356.681 bits (914), Expect = 1.281e-124
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQ+FDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   86 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 256          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-4 (Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot;Acc:P41937])

HSP 1 Score: 353.214 bits (905), Expect = 8.859e-123
Identity = 166/171 (97.08%), Postives = 169/171 (98.83%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDET+CIDNEALYDICFRTLKLTTPTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYR+LTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE
Sbjct:  158 EYPDRIMMTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSMTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: mec-7 (Tubulin beta-1 chain [Source:UniProtKB/Swiss-Prot;Acc:P12456])

HSP 1 Score: 344.739 bits (883), Expect = 1.859e-119
Identity = 161/171 (94.15%), Postives = 167/171 (97.66%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTD T+CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSR +QQYRA+TVPELTQQ FDAKNMMAACDPRHGRYLT AA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDSTFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSNQQYRAITVPELTQQCFDAKNMMAACDPRHGRYLTAAAIFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 343.584 bits (880), Expect = 6.435e-119
Identity = 159/171 (92.98%), Postives = 167/171 (97.66%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIMS+FSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDIC+RTLKLT PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPL+++G+Q YRALTV ELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSM+EVDE
Sbjct:  158 EYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 343.584 bits (880), Expect = 6.435e-119
Identity = 159/171 (92.98%), Postives = 167/171 (97.66%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIMS+FSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDIC+RTLKLT PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPL+++G+Q YRALTV ELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSM+EVDE
Sbjct:  158 EYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 343.584 bits (880), Expect = 6.435e-119
Identity = 159/171 (92.98%), Postives = 167/171 (97.66%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIMS+FSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDIC+RTLKLT PTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPL+++G+Q YRALTV ELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSM+EVDE
Sbjct:  158 EYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMREVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub85D (gene:FBgn0003889 transcript:FBtr0082046)

HSP 1 Score: 358.221 bits (918), Expect = 1.295e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086536)

HSP 1 Score: 355.525 bits (911), Expect = 2.000e-123
Identity = 166/171 (97.08%), Postives = 170/171 (99.42%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+T+SVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086537)

HSP 1 Score: 354.369 bits (908), Expect = 6.154e-123
Identity = 166/171 (97.08%), Postives = 170/171 (99.42%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+T+SVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVS TMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  167 EYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 337          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0343443)

HSP 1 Score: 348.977 bits (894), Expect = 7.326e-121
Identity = 161/171 (94.15%), Postives = 169/171 (98.83%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+T+SVVPSPKVSDTVVEPYNATLS+HQLVENTDETYCIDNEALYDICFRTLK++ P+YGDLNHLVS TMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  163 EYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 333          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0072270)

HSP 1 Score: 348.977 bits (894), Expect = 7.897e-121
Identity = 161/171 (94.15%), Postives = 169/171 (98.83%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+T+SVVPSPKVSDTVVEPYNATLS+HQLVENTDETYCIDNEALYDICFRTLK++ P+YGDLNHLVS TMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  164 EYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 334          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 358.607 bits (919), Expect = 1.527e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 358.607 bits (919), Expect = 1.527e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 358.607 bits (919), Expect = 1.527e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: tubb4b (tubulin, beta 4B class IVb [Source:ZFIN;Acc:ZDB-GENE-030131-8625])

HSP 1 Score: 358.221 bits (918), Expect = 1.630e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 358.221 bits (918), Expect = 1.944e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 359.762 bits (922), Expect = 1.841e-125
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  121 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 291          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 358.221 bits (918), Expect = 2.985e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: tubb (tubulin beta class I [Source:NCBI gene;Acc:448742])

HSP 1 Score: 356.295 bits (913), Expect = 1.469e-123
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQ+FDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: ubxn11 (UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-985480])

HSP 1 Score: 356.295 bits (913), Expect = 1.621e-123
Identity = 166/171 (97.08%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYR+LTVPELTQQMFD+KNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: znf330 (zinc finger protein 330 [Source:Xenbase;Acc:XB-GENE-1010548])

HSP 1 Score: 355.91 bits (912), Expect = 2.198e-123
Identity = 166/171 (97.08%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSV+PSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFD+KNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4b (tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:MGI:1915472])

HSP 1 Score: 358.221 bits (918), Expect = 1.759e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4a (tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:MGI:107848])

HSP 1 Score: 357.066 bits (915), Expect = 6.241e-124
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            E+PDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb5 (tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI:107812])

HSP 1 Score: 356.295 bits (913), Expect = 1.125e-123
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQ+FDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2b (tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:MGI:1920960])

HSP 1 Score: 355.525 bits (911), Expect = 2.186e-123
Identity = 166/171 (97.08%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSV+PSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFD+KNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2a (tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:MGI:107861])

HSP 1 Score: 352.443 bits (903), Expect = 3.306e-122
Identity = 165/171 (96.49%), Postives = 170/171 (99.42%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSV+PSPKVSDTVVEPYNATLSVHQLVENTDETY IDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFD+KNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P18700|TBB_STRPU (Tubulin beta chain (Fragment) OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 7.724e-126
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:    3 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 173          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P41386|TBB_HALDI (Tubulin beta chain (Fragment) OS=Haliotis discus OX=36094 PE=2 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 8.408e-125
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   84 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 254          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|Q91240|TBB_PSEAM (Tubulin beta chain OS=Pseudopleuronectes americanus OX=8265 PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 7.449e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P30883|TBB4_XENLA (Tubulin beta-4 chain OS=Xenopus laevis OX=8355 GN=tubb4 PE=2 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 9.678e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P11833|TBB_PARLI (Tubulin beta chain OS=Paracentrotus lividus OX=7656 PE=2 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 1.009e-123
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. TrEMBL
Match: G3QHM7 (Tubulin beta 4B class IVb OS=Gorilla gorilla gorilla OX=9595 GN=TUBB4B PE=3 SV=2)

HSP 1 Score: 357.066 bits (915), Expect = 5.333e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   12 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 182          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A2I3H6A1 (Tubulin beta 4B class IVb OS=Nomascus leucogenys OX=61853 GN=TUBB4B PE=3 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 5.333e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   12 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 182          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A2R9AZ96 (Tubulin beta 4B class IVb OS=Pan paniscus OX=9597 GN=TUBB4B PE=3 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 5.333e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   12 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 182          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A2K5F4P9 (Tubulin_C domain-containing protein OS=Aotus nancymaae OX=37293 PE=3 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 5.333e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   12 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 182          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A2I3RLH6 (Tubulin beta 4B class IVb OS=Pan troglodytes OX=9598 GN=TUBB4B PE=3 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 5.333e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   12 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 182          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000019550.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1405913:1407004:-1 gene:ENSAMXG00000018987.2 transcript:ENSAMXT00000019550.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 357.451 bits (916), Expect = 2.181e-125
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQ+FDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:   77 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 247          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: zgc:55461 (tubulin beta-4B chain [Source:NCBI gene;Acc:103024068])

HSP 1 Score: 358.607 bits (919), Expect = 1.238e-124
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB2A (tubulin beta-2A chain [Source:NCBI gene;Acc:103041736])

HSP 1 Score: 351.673 bits (901), Expect = 7.911e-121
Identity = 164/171 (95.91%), Postives = 170/171 (99.42%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSV+PSPKVSDTVVEPYNATLSVHQLVENTDET+ IDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRAL+VPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  235 EYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 405          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB1 (tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257])

HSP 1 Score: 337.035 bits (863), Expect = 2.933e-116
Identity = 155/171 (90.64%), Postives = 165/171 (96.49%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM++FS++PSPKVSDTVVEPYNATLS+HQL+ENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVS TMSGVTT LRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLT+RGSQQYRALTVPELTQQMFDA+NMM ACDPR GRYLTVA +FRGRMS KEVDE
Sbjct:  132 EYPDRIMNSFSIMPSPKVSDTVVEPYNATLSIHQLIENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDARNMMTACDPRRGRYLTVAGIFRGRMSTKEVDE 302          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000005818.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:14648029:14650102:-1 gene:ENSAMXG00000008652.2 transcript:ENSAMXT00000005818.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 4.486e-49
Identity = 74/170 (43.53%), Postives = 108/170 (63.53%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVD 511
            +Y  +    FS+ P+P+VS  VVEPYNA L+ H  +E++D  + +DNEA+YDIC R L +  PTY +LN L+S  +S +T  LRF G LN DL +   N+VP+PR+HF +  +AP+ S     +  LTV E+T   F+  N M  CDPRHG+Y+    ++RG +  K+V+
Sbjct:  145 DYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVN 314          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 331.257 bits (848), Expect = 1.513e-115
Identity = 155/158 (98.10%), Postives = 158/158 (100.00%), Query Frame = 2
Query:   41 PSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            PSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFD+KNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  154 PSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDE 311          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 159.073 bits (401), Expect = 1.648e-48
Identity = 70/170 (41.18%), Postives = 107/170 (62.94%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVD 511
            +Y  +    F++ P+P+VS  VVEPYN+ L+ H  +E++D  + +DNEA+YDIC R L +  PTY +LN L+   +S +T  LRF G LN DL +   N+VP+PR+HF +  +AP+ S     +  L+V E+T   F+  N M  CDPRHG+Y+    ++RG +  K+V+
Sbjct:  160 DYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVN 329          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.066 bits (388), Expect = 1.806e-46
Identity = 68/170 (40.00%), Postives = 108/170 (63.53%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVD 511
            +Y  +    F + P+P+VS  VVEPYNA L+ H  +E++D ++ +DNEA+YDIC + L +  P+Y +LN L++  +S +T  LRF G LN DL +   N+VP+PR+HF +  +AP+ S     +  L+V E+T   F+  N M  CDPR+G+Y+    ++RG +  K+V+
Sbjct:  165 DYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVN 334          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 110.923 bits (276), Expect = 1.408e-29
Identity = 56/146 (38.36%), Postives = 90/146 (61.64%), Query Frame = 2
Query:    5 YPDRIMSTFSVVPSP-KVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGS-QQYRALTVPELTQQMFDAKNMMAA 436
            +P +++ T+SV P+  ++SD VV+PYN+ L++ +L +N D    +DN AL  I    L +  P++  +N LVS  MS  TT LR+PG +N DL  L  +++P PRLHF + G+ PLT+  S    R  TV ++ +++   KN+M +
Sbjct:  156 FPKKLIQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVS 301          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 6.784e-23
Identity = 55/191 (28.80%), Postives = 89/191 (46.60%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRT----------------------LKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEV 508
            E+PD      ++ PS +  D V  PYN+ L++ +L E+ D    I+N+AL DI  +                       LK     +  +N++V+  M  +T+  RF G LN DL ++ +N+VPFPRLH+ +    PL +          + ++    F  +N +   DPR   YL  A M RG + + +V
Sbjct:  170 EFPDVHRFVMALYPSAE-DDVVTSPYNSVLAMRELTEHADCVLPIENQALVDIVNKINHAAALGKSVRSQTTLSSSHGCLKGQEKPFDTMNNIVANLMLNMTSSSRFEGSLNVDLNEITMNLVPFPRLHYLVSSLTPLYALADVALPPRRLDQMFSDAFSKENQLLRVDPRRSLYLACALMVRGNVQLSDV 359          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 298.901 bits (764), Expect = 6.761e-102
Identity = 136/171 (79.53%), Postives = 160/171 (93.57%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            E+PDR+M+TFSV+PSPK SDTVVEPYNATLSVHQLVE++DET+CIDNEALYDIC RTLKL  P+YGDLN+LVS+ MSGVTT LR+PGQLN+DLRKLAVN+VPFPRLHFF+ G+APLT+ GSQ +R+LTVPELTQQMFDAKNMMAA DPR+GRYLTVAA FRG++S+KEV++
Sbjct:  158 EFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVED 328          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 154.451 bits (389), Expect = 4.542e-46
Identity = 67/169 (39.64%), Postives = 108/169 (63.91%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEV 508
            EY  +    F+V P+P+VS +VVEPYN  L+ H  +E+ D T+ +DNEA+YD+C R L +  P++ +LN+L++  +S VT  LRF G LN DL +   N+VP+PR+HF +  ++P+ S+    + + +V E+T   F+  N M  CDPR G+Y+    ++RG +  ++V
Sbjct:  161 EYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDV 329          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 153.68 bits (387), Expect = 9.463e-46
Identity = 67/169 (39.64%), Postives = 107/169 (63.31%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEV 508
            EY  +    F+V P+P++S +VVEPYN  L+ H  +E+ D T+ +DNEA+YDIC R L ++ P++ +LN L++  +S VT  LRF G LN DL +   N+VP+PR+HF +  +AP+ S+    + + +V E+T   F+  N M  CDP  G+Y+    ++RG +  ++V
Sbjct:  161 EYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDV 329          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 81.2629 bits (199), Expect = 5.762e-19
Identity = 40/117 (34.19%), Postives = 67/117 (57.26%), Query Frame = 2
Query:    5 YPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTS 355
            YP +I++T+SV P+ + S+ VV+ YN  L++ +L+E++D T   DN +L +I  +  +         N L+S  +S VT  +RFP  + + +  +   ++P P LHF  P F P TS
Sbjct:  162 YPKKILTTYSVFPA-RSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTS 277          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO36734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHY4])

HSP 1 Score: 361.303 bits (926), Expect = 2.145e-127
Identity = 169/171 (98.83%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE
Sbjct:   68 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 238          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35959 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJY0])

HSP 1 Score: 357.066 bits (915), Expect = 1.520e-126
Identity = 168/171 (98.25%), Postives = 170/171 (99.42%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEV E
Sbjct:   12 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVFE 182          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX9])

HSP 1 Score: 360.147 bits (923), Expect = 1.036e-125
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFS+VPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSIVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO39945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I3])

HSP 1 Score: 359.762 bits (922), Expect = 1.317e-125
Identity = 169/171 (98.83%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO42890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S027])

HSP 1 Score: 351.288 bits (900), Expect = 3.297e-122
Identity = 166/171 (97.08%), Postives = 169/171 (98.83%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRL FF+PGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDP HGRYLTVAAMFRGRMSMKE+DE
Sbjct:  154 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLPFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPLHGRYLTVAAMFRGRMSMKELDE 324          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb5 (tubulin beta chain [Source:NCBI gene;Acc:101157969])

HSP 1 Score: 356.295 bits (913), Expect = 8.973e-124
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRALTVPELTQQ+FDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb2 (tubulin beta-2B chain [Source:NCBI gene;Acc:101162245])

HSP 1 Score: 351.673 bits (901), Expect = 8.210e-122
Identity = 164/171 (95.91%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSV+PSPKVSDTVVEPYNATLSVHQLVENTDET+CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLTSRGSQQYRAL+VPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSM+EVDE
Sbjct:  158 EYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMREVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000045809.1 (tubulin beta-6 chain [Source:NCBI gene;Acc:101166121])

HSP 1 Score: 328.176 bits (840), Expect = 2.316e-112
Identity = 151/171 (88.30%), Postives = 162/171 (94.74%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            E+PDRIM+TFS++PSPKVSDTVVEPYNATLSVHQL+EN D T+CIDNEALYDICFRTLKLTTPTYGDLNHLV  TMSGVTT LRFPGQLNADLRKLAVNMVPFPRLHFF+PGFAPLT+RGSQQYRALTVPELTQQMFDA+NMM ACDPR GRYLTVA +FRG+MS KEVDE
Sbjct:  158 EFPDRIMNTFSIMPSPKVSDTVVEPYNATLSVHQLLENADATFCIDNEALYDICFRTLKLTTPTYGDLNHLVCMTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDARNMMTACDPRRGRYLTVAGIFRGKMSTKEVDE 328          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tuba1c (tubulin alpha-1B chain-like [Source:NCBI gene;Acc:101167538])

HSP 1 Score: 163.31 bits (412), Expect = 1.714e-48
Identity = 73/170 (42.94%), Postives = 108/170 (63.53%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVD 511
            +Y  +    FS+ P+P+VS  VVEPYN+ L+ H  +E++D  + +DNEA+YDIC R L +  PTY +LN L+S  +S +T  LRF G LN DL +   N+VP+PR+HF +  +AP+ S     +  L+V E+T   F+  N M  CDPRHG+Y+    +FRG +  K+V+
Sbjct:  160 DYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVN 329          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tuba1c (tubulin alpha-1B chain-like [Source:NCBI gene;Acc:101167538])

HSP 1 Score: 163.31 bits (412), Expect = 1.958e-48
Identity = 73/170 (42.94%), Postives = 108/170 (63.53%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVD 511
            +Y  +    FS+ P+P+VS  VVEPYN+ L+ H  +E++D  + +DNEA+YDIC R L +  PTY +LN L+S  +S +T  LRF G LN DL +   N+VP+PR+HF +  +AP+ S     +  L+V E+T   F+  N M  CDPRHG+Y+    +FRG +  K+V+
Sbjct:  166 DYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVN 335          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000074579.1 (SMESG000074579.1)

HSP 1 Score: 362.844 bits (930), Expect = 1.658e-126
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE
Sbjct:  158 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000074423.1 (SMESG000074423.1)

HSP 1 Score: 362.844 bits (930), Expect = 1.658e-126
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE
Sbjct:  158 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000047291.1 (SMESG000047291.1)

HSP 1 Score: 358.607 bits (919), Expect = 8.348e-125
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDET+CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAALFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000044888.1 (SMESG000044888.1)

HSP 1 Score: 358.607 bits (919), Expect = 8.348e-125
Identity = 168/171 (98.25%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDET+CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVDE
Sbjct:  158 EYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAALFRGRMSMKEVDE 328          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000035804.1 (SMESG000035804.1)

HSP 1 Score: 356.295 bits (913), Expect = 1.071e-124
Identity = 167/171 (97.66%), Postives = 171/171 (100.00%), Query Frame = 2
Query:    2 EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAMFRGRMSMKEVDE 514
            EYPDRIM+TFSVVPSPKVSDTVVEPYNATLSVHQLVENTDET+CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA+FRGRMSMKEVD+
Sbjct:  107 EYPDRIMTTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDD 277          
The following BLAST results are available for this feature:
BLAST of Tubulin beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBB1.281e-12497.66tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB1.281e-12497.66tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB1.281e-12497.66tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB1.281e-12497.66tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB1.281e-12497.66tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbb-48.859e-12397.08Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot... [more]
mec-71.859e-11994.15Tubulin beta-1 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-26.435e-11992.98Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-26.435e-11992.98Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-26.435e-11992.98Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
betaTub85D1.295e-12498.25gene:FBgn0003889 transcript:FBtr0082046[more]
betaTub56D2.000e-12397.08gene:FBgn0284243 transcript:FBtr0086536[more]
betaTub56D6.154e-12397.08gene:FBgn0284243 transcript:FBtr0086537[more]
betaTub60D7.326e-12194.15gene:FBgn0003888 transcript:FBtr0343443[more]
betaTub60D7.897e-12194.15gene:FBgn0003888 transcript:FBtr0072270[more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:554611.527e-12498.25zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
zgc:554611.527e-12498.25zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
zgc:554611.527e-12498.25zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
tubb4b1.630e-12498.25tubulin, beta 4B class IVb [Source:ZFIN;Acc:ZDB-GE... [more]
zgc:554611.944e-12498.25zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
reps21.841e-12598.25RALBP1 associated Eps domain containing 2 [Source:... [more]
reps22.985e-12498.25RALBP1 associated Eps domain containing 2 [Source:... [more]
tubb1.469e-12397.66tubulin beta class I [Source:NCBI gene;Acc:448742][more]
ubxn111.621e-12397.08UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-... [more]
znf3302.198e-12397.08zinc finger protein 330 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tubb4b1.759e-12498.25tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:... [more]
Tubb4a6.241e-12497.66tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:... [more]
Tubb51.125e-12397.66tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI... [more]
Tubb2b2.186e-12397.08tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:... [more]
Tubb2a3.306e-12296.49tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18700|TBB_STRPU7.724e-12698.25Tubulin beta chain (Fragment) OS=Strongylocentrotu... [more]
sp|P41386|TBB_HALDI8.408e-12598.25Tubulin beta chain (Fragment) OS=Haliotis discus O... [more]
sp|Q91240|TBB_PSEAM7.449e-12498.25Tubulin beta chain OS=Pseudopleuronectes americanu... [more]
sp|P30883|TBB4_XENLA9.678e-12498.25Tubulin beta-4 chain OS=Xenopus laevis OX=8355 GN=... [more]
sp|P11833|TBB_PARLI1.009e-12398.25Tubulin beta chain OS=Paracentrotus lividus OX=765... [more]
back to top
BLAST of Tubulin beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3QHM75.333e-12498.25Tubulin beta 4B class IVb OS=Gorilla gorilla goril... [more]
A0A2I3H6A15.333e-12498.25Tubulin beta 4B class IVb OS=Nomascus leucogenys O... [more]
A0A2R9AZ965.333e-12498.25Tubulin beta 4B class IVb OS=Pan paniscus OX=9597 ... [more]
A0A2K5F4P95.333e-12498.25Tubulin_C domain-containing protein OS=Aotus nancy... [more]
A0A2I3RLH65.333e-12498.25Tubulin beta 4B class IVb OS=Pan troglodytes OX=95... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019550.22.181e-12597.66pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
zgc:554611.238e-12498.25tubulin beta-4B chain [Source:NCBI gene;Acc:103024... [more]
TUBB2A7.911e-12195.91tubulin beta-2A chain [Source:NCBI gene;Acc:103041... [more]
TUBB12.933e-11690.64tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HG... [more]
ENSAMXT00000005818.24.486e-4943.53pep primary_assembly:Astyanax_mexicanus-2.0:22:146... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb21.513e-11598.10tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
TUBA3C1.648e-4841.18tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.11.806e-4640.00pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
tubg11.408e-2938.36tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
ENSPMAT00000001368.16.784e-2328.80pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB26.761e-10279.53Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB14.542e-4639.64Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB39.463e-4639.64Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB45.762e-1934.19Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367342.145e-12798.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359591.520e-12698.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359581.036e-12598.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399451.317e-12598.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428903.297e-12297.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb58.973e-12497.66tubulin beta chain [Source:NCBI gene;Acc:101157969... [more]
tubb28.210e-12295.91tubulin beta-2B chain [Source:NCBI gene;Acc:101162... [more]
ENSORLT00000045809.12.316e-11288.30tubulin beta-6 chain [Source:NCBI gene;Acc:1011661... [more]
tuba1c1.714e-4842.94tubulin alpha-1B chain-like [Source:NCBI gene;Acc:... [more]
tuba1c1.958e-4842.94tubulin alpha-1B chain-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tubulin beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074579.11.658e-126100.00SMESG000074579.1[more]
SMESG000074423.11.658e-126100.00SMESG000074423.1[more]
SMESG000047291.18.348e-12598.25SMESG000047291.1[more]
SMESG000044888.18.348e-12598.25SMESG000044888.1[more]
SMESG000035804.11.071e-12497.66SMESG000035804.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023283 ID=SMED30023283|Name=Tubulin beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=514bp
AGAATATCCAGACAGAATTATGAGTACTTTTTCAGTTGTTCCTTCACCAA
AGGTGTCAGATACCGTAGTCGAACCTTACAATGCTACTTTGTCCGTGCAT
CAGTTGGTAGAAAATACCGATGAAACATATTGCATAGACAATGAAGCTCT
ATATGATATTTGTTTTAGAACATTAAAATTAACTACTCCGACATATGGTG
ACTTAAACCACTTGGTTAGTGCAACAATGTCTGGGGTTACTACTTGCTTA
CGATTCCCTGGTCAACTCAACGCAGATCTTCGAAAATTGGCTGTAAATAT
GGTTCCTTTTCCACGATTGCATTTCTTTATTCCCGGATTTGCACCCTTAA
CTAGCAGAGGCAGCCAACAGTATCGAGCTTTAACGGTTCCCGAGTTGACC
CAGCAAATGTTCGATGCGAAAAATATGATGGCCGCTTGTGACCCGAGACA
TGGGCGCTATCTGACTGTGGCGGCTATGTTTCGCGGAAGAATGTCAATGA
AAGAAGTAGATGAA
back to top

protein sequence of SMED30023283-orf-1

>SMED30023283-orf-1 ID=SMED30023283-orf-1|Name=SMED30023283-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
EYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEAL
YDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNM
VPFPRLHFFIPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRH
GRYLTVAAMFRGRMSMKEVDE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037103Tubulin/FtsZ_C_sf
IPR036525Tubulin/FtsZ_GTPase_sf
IPR002453Beta_tubulin
IPR000217Tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR003008Tubulin_FtsZ_GTPase
IPR008280Tub_FtsZ_C
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0005200structural constituent of cytoskeleton
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002453Beta tubulinPRINTSPR01163BETATUBULINcoord: 73..82
score: 83.43
coord: 154..171
score: 75.13
coord: 108..124
score: 80.57
coord: 88..101
score: 89.06
coord: 55..67
score: 85.45
IPR000217TubulinPRINTSPR01161TUBULINcoord: 33..53
score: 68.3
coord: 19..32
score: 79.11
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..171
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 89..171
e-value: 4.8E-4
score: 29.1
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 104..170
e-value: 7.6E-22
score: 77.8
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 1..54
e-value: 2.4E-11
score: 44.2
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 107..171
e-value: 5.6E-32
score: 112.2
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..106
e-value: 1.1E-41
score: 145.0
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 1..86
NoneNo IPR availablePANTHERPTHR11588:SF89coord: 1..171
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 87..171