Tyrosine hydroxylase

Overview
NameTyrosine hydroxylase
Smed IDSMED30023278
Length (bp)779
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine hydroxylase (SMED30023278) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine hydroxylase (SMED30023278) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine hydroxylase (SMED30023278) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine hydroxylase (SMED30023278) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023278

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023278SMESG000034472.1 Contig3174newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023278SMESG000034472.1 Contig3174uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023278SMESG000053127.1 Contig3174newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023278SMESG000053127.1 Contig3174uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30023278SMESG000034472.1 SmedASXL_014407SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30023278SMESG000034472.1 dd_Smed_v4_16581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30023278SMESG000034472.1 dd_Smed_v4_16581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023278SMESG000034472.1 dd_Smed_v4_16581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30023278SMESG000034472.1 dd_Smed_v6_16581_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30023278SMESG000034472.1 OX_Smed_1.0.11668ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30023278SMESG000034472.1 thsmed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
dopaminergic neuronSMED30023278SMESG000034472.1 thsmed_ncbi_20200123PMID:29357350
de Sousa et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine hydroxylase vs. Ensembl Human
Match: TH (tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:11782])

HSP 1 Score: 114.005 bits (284), Expect = 1.077e-51
Identity = 49/69 (71.01%), Postives = 62/69 (89.86%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGHVP+L+D  FA+FSQ+IGL SLGASDE+IE+L+TLYWFTVEFGLC ++ ++K
Sbjct:  349 SSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVK 417          

HSP 2 Score: 109.383 bits (272), Expect = 1.077e-51
Identity = 49/113 (43.36%), Postives = 81/113 (71.68%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL H +S+ PE R F+P+ A++ PY+D+ YQ VY+V +S +D K+K+R +A  I R   +++DPYT  I+VL++ ++V      ++ ELD + ++LS++
Sbjct:  415 EVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAI 527          
BLAST of Tyrosine hydroxylase vs. Ensembl Human
Match: TH (tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:11782])

HSP 1 Score: 113.62 bits (283), Expect = 1.161e-51
Identity = 49/69 (71.01%), Postives = 62/69 (89.86%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGHVP+L+D  FA+FSQ+IGL SLGASDE+IE+L+TLYWFTVEFGLC ++ ++K
Sbjct:  345 SSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVK 413          

HSP 2 Score: 109.383 bits (272), Expect = 1.161e-51
Identity = 49/113 (43.36%), Postives = 81/113 (71.68%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL H +S+ PE R F+P+ A++ PY+D+ YQ VY+V +S +D K+K+R +A  I R   +++DPYT  I+VL++ ++V      ++ ELD + ++LS++
Sbjct:  411 EVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAI 523          
BLAST of Tyrosine hydroxylase vs. Ensembl Human
Match: TH (tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:11782])

HSP 1 Score: 113.62 bits (283), Expect = 1.200e-51
Identity = 49/69 (71.01%), Postives = 62/69 (89.86%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGHVP+L+D  FA+FSQ+IGL SLGASDE+IE+L+TLYWFTVEFGLC ++ ++K
Sbjct:  318 SSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVK 386          

HSP 2 Score: 109.383 bits (272), Expect = 1.200e-51
Identity = 49/113 (43.36%), Postives = 81/113 (71.68%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL H +S+ PE R F+P+ A++ PY+D+ YQ VY+V +S +D K+K+R +A  I R   +++DPYT  I+VL++ ++V      ++ ELD + ++LS++
Sbjct:  384 EVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAI 496          
BLAST of Tyrosine hydroxylase vs. Ensembl Human
Match: TH (tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:11782])

HSP 1 Score: 109.383 bits (272), Expect = 4.778e-47
Identity = 49/113 (43.36%), Postives = 81/113 (71.68%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL H +S+ PE R F+P+ A++ PY+D+ YQ VY+V +S +D K+K+R +A  I R   +++DPYT  I+VL++ ++V      ++ ELD + ++LS++
Sbjct:  290 EVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAI 402          

HSP 2 Score: 98.2117 bits (243), Expect = 4.778e-47
Identity = 43/60 (71.67%), Postives = 54/60 (90.00%), Query Frame = 1
Query:   28 DCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            DC HELLGHVP+L+D  FA+FSQ+IGL SLGASDE+IE+L+TLYWFTVEFGLC ++ ++K
Sbjct:  233 DCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVK 292          
BLAST of Tyrosine hydroxylase vs. Ensembl Human
Match: PAH (phenylalanine hydroxylase [Source:HGNC Symbol;Acc:HGNC:8582])

HSP 1 Score: 107.842 bits (268), Expect = 5.217e-46
Identity = 49/69 (71.01%), Postives = 57/69 (82.61%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HELLGHVP+ SD  FA+FSQEIGL SLGA DE IE+LAT+YWFTVEFGLC +   +K
Sbjct:  273 SKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIK 341          

HSP 2 Score: 96.6709 bits (239), Expect = 5.217e-46
Identity = 50/112 (44.64%), Postives = 72/112 (64.29%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            IKA+GAGLLSS GELQ+ +S+ P+    E +  +I  Y   E+QP+YYV +S  D KEK+R FA +I R   +RYDPYT+ IEVL+N + +  L   I  E+  + ++L  +
Sbjct:  340 IKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKI 451          
BLAST of Tyrosine hydroxylase vs. Ensembl Celegans
Match: cat-2 (Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-Prot;Acc:P90986])

HSP 1 Score: 103.99 bits (258), Expect = 1.686e-46
Identity = 48/67 (71.64%), Postives = 55/67 (82.09%), Query Frame = 1
Query:    7 PLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            P H+PEPD IHELLGHVP+ SD   A+ SQ+IGL SLGASDE IE+L+T+YWF VEFGLC ED KLK
Sbjct:  337 PHHSPEPDLIHELLGHVPMFSDPLLAQMSQDIGLMSLGASDEHIEKLSTVYWFIVEFGLCKEDGKLK 403          

HSP 2 Score: 100.908 bits (250), Expect = 1.686e-46
Identity = 45/113 (39.82%), Postives = 72/113 (63.72%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            K+KA GAGLLS+ GEL HA SD PEH+ F+P   ++  Y D++YQP+Y+V DS+ D   K+R++A S+ R   + YDP+T++IE + +          +++    + N LS++
Sbjct:  401 KLKAIGAGLLSAYGELMHACSDAPEHKDFDPAVTAVQKYEDDDYQPLYFVADSIHDALAKLRKYASSMDRPFSVVYDPFTKSIEAIESSAD-------LEKAFSRLSNDLSAI 506          
BLAST of Tyrosine hydroxylase vs. Ensembl Celegans
Match: cat-2 (Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-Prot;Acc:P90986])

HSP 1 Score: 103.99 bits (258), Expect = 1.787e-46
Identity = 48/67 (71.64%), Postives = 55/67 (82.09%), Query Frame = 1
Query:    7 PLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            P H+PEPD IHELLGHVP+ SD   A+ SQ+IGL SLGASDE IE+L+T+YWF VEFGLC ED KLK
Sbjct:  342 PHHSPEPDLIHELLGHVPMFSDPLLAQMSQDIGLMSLGASDEHIEKLSTVYWFIVEFGLCKEDGKLK 408          

HSP 2 Score: 100.908 bits (250), Expect = 1.787e-46
Identity = 45/113 (39.82%), Postives = 72/113 (63.72%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            K+KA GAGLLS+ GEL HA SD PEH+ F+P   ++  Y D++YQP+Y+V DS+ D   K+R++A S+ R   + YDP+T++IE + +          +++    + N LS++
Sbjct:  406 KLKAIGAGLLSAYGELMHACSDAPEHKDFDPAVTAVQKYEDDDYQPLYFVADSIHDALAKLRKYASSMDRPFSVVYDPFTKSIEAIESSAD-------LEKAFSRLSNDLSAI 511          
BLAST of Tyrosine hydroxylase vs. Ensembl Celegans
Match: cat-2 (Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-Prot;Acc:P90986])

HSP 1 Score: 103.219 bits (256), Expect = 1.976e-46
Identity = 48/67 (71.64%), Postives = 55/67 (82.09%), Query Frame = 1
Query:    7 PLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            P H+PEPD IHELLGHVP+ SD   A+ SQ+IGL SLGASDE IE+L+T+YWF VEFGLC ED KLK
Sbjct:  272 PHHSPEPDLIHELLGHVPMFSDPLLAQMSQDIGLMSLGASDEHIEKLSTVYWFIVEFGLCKEDGKLK 338          

HSP 2 Score: 100.908 bits (250), Expect = 1.976e-46
Identity = 45/113 (39.82%), Postives = 72/113 (63.72%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            K+KA GAGLLS+ GEL HA SD PEH+ F+P   ++  Y D++YQP+Y+V DS+ D   K+R++A S+ R   + YDP+T++IE + +          +++    + N LS++
Sbjct:  336 KLKAIGAGLLSAYGELMHACSDAPEHKDFDPAVTAVQKYEDDDYQPLYFVADSIHDALAKLRKYASSMDRPFSVVYDPFTKSIEAIESSAD-------LEKAFSRLSNDLSAI 441          
BLAST of Tyrosine hydroxylase vs. Ensembl Celegans
Match: pah-1 (Phenylalanine-4-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:P90925])

HSP 1 Score: 105.531 bits (262), Expect = 2.107e-45
Identity = 47/69 (68.12%), Postives = 58/69 (84.06%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P +TPEPD  HELLGHVP+ +D+EFA+FSQEIGL SLGA D+ IE+LATLYWFT+EFG+C +D + K
Sbjct:  269 SAPKYTPEPDICHELLGHVPLFADVEFAQFSQEIGLASLGAPDDVIEKLATLYWFTIEFGICQQDGEKK 337          

HSP 2 Score: 95.5153 bits (236), Expect = 2.107e-45
Identity = 45/111 (40.54%), Postives = 71/111 (63.96%), Query Frame = 3
Query:  204 KAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            KA+GAGLLSS GELQ+A+SD PE   F+P    +T Y   EYQP Y++ +S    K K++ +A +I+R   IRY+ YT+ +E+L+   ++  L R I+ ++  +E +L  +
Sbjct:  337 KAYGAGLLSSFGELQYALSDKPEVVDFDPAVCCVTKYPITEYQPKYFLAESFASAKNKLKSWAATINRPFQIRYNAYTQRVEILDKVAALQRLARDIRSDISTLEEALGKV 447          
BLAST of Tyrosine hydroxylase vs. Ensembl Celegans
Match: pah-1 (Phenylalanine-4-hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:P90925])

HSP 1 Score: 105.531 bits (262), Expect = 2.269e-45
Identity = 47/69 (68.12%), Postives = 58/69 (84.06%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P +TPEPD  HELLGHVP+ +D+EFA+FSQEIGL SLGA D+ IE+LATLYWFT+EFG+C +D + K
Sbjct:  273 SAPKYTPEPDICHELLGHVPLFADVEFAQFSQEIGLASLGAPDDVIEKLATLYWFTIEFGICQQDGEKK 341          

HSP 2 Score: 95.5153 bits (236), Expect = 2.269e-45
Identity = 45/111 (40.54%), Postives = 71/111 (63.96%), Query Frame = 3
Query:  204 KAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            KA+GAGLLSS GELQ+A+SD PE   F+P    +T Y   EYQP Y++ +S    K K++ +A +I+R   IRY+ YT+ +E+L+   ++  L R I+ ++  +E +L  +
Sbjct:  341 KAYGAGLLSSFGELQYALSDKPEVVDFDPAVCCVTKYPITEYQPKYFLAESFASAKNKLKSWAATINRPFQIRYNAYTQRVEILDKVAALQRLARDIRSDISTLEEALGKV 451          
BLAST of Tyrosine hydroxylase vs. Ensembl Fly
Match: ple (gene:FBgn0005626 transcript:FBtr0076956)

HSP 1 Score: 112.464 bits (280), Expect = 2.494e-52
Identity = 49/69 (71.01%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            + P HTPEPD IHELLGH+P+L+D  FA+FSQEIGL SLGASDE+IE+L+T+YWFTVEFGLC E  ++K
Sbjct:  326 NSPYHTPEPDSIHELLGHMPLLADPSFAQFSQEIGLASLGASDEEIEKLSTVYWFTVEFGLCKEHGQIK 394          

HSP 2 Score: 112.079 bits (279), Expect = 2.494e-52
Identity = 51/113 (45.13%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +IKA+GAGLLSS GEL HAISD  EHR FEP + ++ PY+D+EYQP+YYV +S  D K+K R++  ++ R   +R++P+TE +EVL++   +  L   +  E+ ++ N++S +
Sbjct:  392 QIKAYGAGLLSSYGELLHAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVAESFEDAKDKFRRWVSTMSRPFEVRFNPHTERVEVLDSVDKLETLVHQMNTEILHLTNAISKL 504          
BLAST of Tyrosine hydroxylase vs. Ensembl Fly
Match: ple (gene:FBgn0005626 transcript:FBtr0076957)

HSP 1 Score: 112.079 bits (279), Expect = 3.141e-52
Identity = 49/69 (71.01%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            + P HTPEPD IHELLGH+P+L+D  FA+FSQEIGL SLGASDE+IE+L+T+YWFTVEFGLC E  ++K
Sbjct:  397 NSPYHTPEPDSIHELLGHMPLLADPSFAQFSQEIGLASLGASDEEIEKLSTVYWFTVEFGLCKEHGQIK 465          

HSP 2 Score: 112.079 bits (279), Expect = 3.141e-52
Identity = 51/113 (45.13%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +IKA+GAGLLSS GEL HAISD  EHR FEP + ++ PY+D+EYQP+YYV +S  D K+K R++  ++ R   +R++P+TE +EVL++   +  L   +  E+ ++ N++S +
Sbjct:  463 QIKAYGAGLLSSYGELLHAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVAESFEDAKDKFRRWVSTMSRPFEVRFNPHTERVEVLDSVDKLETLVHQMNTEILHLTNAISKL 575          
BLAST of Tyrosine hydroxylase vs. Ensembl Fly
Match: ple (gene:FBgn0005626 transcript:FBtr0345585)

HSP 1 Score: 112.079 bits (279), Expect = 3.141e-52
Identity = 49/69 (71.01%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            + P HTPEPD IHELLGH+P+L+D  FA+FSQEIGL SLGASDE+IE+L+T+YWFTVEFGLC E  ++K
Sbjct:  397 NSPYHTPEPDSIHELLGHMPLLADPSFAQFSQEIGLASLGASDEEIEKLSTVYWFTVEFGLCKEHGQIK 465          

HSP 2 Score: 112.079 bits (279), Expect = 3.141e-52
Identity = 51/113 (45.13%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +IKA+GAGLLSS GEL HAISD  EHR FEP + ++ PY+D+EYQP+YYV +S  D K+K R++  ++ R   +R++P+TE +EVL++   +  L   +  E+ ++ N++S +
Sbjct:  463 QIKAYGAGLLSSYGELLHAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVAESFEDAKDKFRRWVSTMSRPFEVRFNPHTERVEVLDSVDKLETLVHQMNTEILHLTNAISKL 575          
BLAST of Tyrosine hydroxylase vs. Ensembl Fly
Match: Hn (gene:FBgn0001208 transcript:FBtr0334645)

HSP 1 Score: 101.293 bits (251), Expect = 4.721e-45
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HEL+GHVP+ +D  FA+FSQEIGL SLGA D+ IE+L+T++WFTVE+G+C ++ +LK
Sbjct:  272 SKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELK 340          

HSP 2 Score: 98.9821 bits (245), Expect = 4.721e-45
Identity = 46/113 (40.71%), Postives = 76/113 (67.26%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL++ ++D P+ + FEP+   +T Y   ++QP+YYV DS    KEK  +FA SI R   +RY+ YT+++EVL++K  + +L   I  E   ++N+++ +
Sbjct:  338 ELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAVAKL 450          
BLAST of Tyrosine hydroxylase vs. Ensembl Fly
Match: Hn (gene:FBgn0001208 transcript:FBtr0076811)

HSP 1 Score: 101.293 bits (251), Expect = 4.721e-45
Identity = 43/69 (62.32%), Postives = 59/69 (85.51%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HEL+GHVP+ +D  FA+FSQEIGL SLGA D+ IE+L+T++WFTVE+G+C ++ +LK
Sbjct:  272 SKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELK 340          

HSP 2 Score: 98.9821 bits (245), Expect = 4.721e-45
Identity = 46/113 (40.71%), Postives = 76/113 (67.26%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL++ ++D P+ + FEP+   +T Y   ++QP+YYV DS    KEK  +FA SI R   +RY+ YT+++EVL++K  + +L   I  E   ++N+++ +
Sbjct:  338 ELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAVAKL 450          
BLAST of Tyrosine hydroxylase vs. Ensembl Zebrafish
Match: th (tyrosine hydroxylase [Source:ZFIN;Acc:ZDB-GENE-990621-5])

HSP 1 Score: 115.546 bits (288), Expect = 2.292e-52
Identity = 50/69 (72.46%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC+HELLGHVP+LSD  FA+FSQ IGL SLGASDEDIE+L+T+YWFTVEFGLC +   +K
Sbjct:  326 SSPMHSPEPDCVHELLGHVPILSDRTFAQFSQSIGLASLGASDEDIEKLSTMYWFTVEFGLCKQGGVIK 394          

HSP 2 Score: 109.383 bits (272), Expect = 2.292e-52
Identity = 52/112 (46.43%), Postives = 75/112 (66.96%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            IKA+GAGLLSS GEL H++SD PE R F+P   ++ PY+D+ YQPVY+V +S  D  EK+R +   I R   +R+DPYT++IEVL+N   +      IK EL  + ++L+ +
Sbjct:  393 IKAYGAGLLSSYGELVHSLSDEPERREFDPDIVAVQPYQDQTYQPVYFVSESFVDATEKLRTYVTRIKRPFSVRFDPYTDSIEVLDNPLKIQKGLETIKDELKILTDALNVL 504          
BLAST of Tyrosine hydroxylase vs. Ensembl Zebrafish
Match: th (tyrosine hydroxylase [Source:ZFIN;Acc:ZDB-GENE-990621-5])

HSP 1 Score: 115.546 bits (288), Expect = 2.553e-52
Identity = 50/69 (72.46%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC+HELLGHVP+LSD  FA+FSQ IGL SLGASDEDIE+L+T+YWFTVEFGLC +   +K
Sbjct:  310 SSPMHSPEPDCVHELLGHVPILSDRTFAQFSQSIGLASLGASDEDIEKLSTMYWFTVEFGLCKQGGVIK 378          

HSP 2 Score: 109.383 bits (272), Expect = 2.553e-52
Identity = 52/112 (46.43%), Postives = 75/112 (66.96%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            IKA+GAGLLSS GEL H++SD PE R F+P   ++ PY+D+ YQPVY+V +S  D  EK+R +   I R   +R+DPYT++IEVL+N   +      IK EL  + ++L+ +
Sbjct:  377 IKAYGAGLLSSYGELVHSLSDEPERREFDPDIVAVQPYQDQTYQPVYFVSESFVDATEKLRTYVTRIKRPFSVRFDPYTDSIEVLDNPLKIQKGLETIKDELKILTDALNVL 488          
BLAST of Tyrosine hydroxylase vs. Ensembl Zebrafish
Match: th2 (tyrosine hydroxylase 2 [Source:ZFIN;Acc:ZDB-GENE-050201-1])

HSP 1 Score: 111.309 bits (277), Expect = 2.401e-47
Identity = 50/69 (72.46%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGH+P+L+D EFA+FSQ IGL SLGASDEDIE+L+TLYWFTVEFGLC ++  +K
Sbjct:  291 SAPMHSPEPDCCHELLGHIPMLADQEFAQFSQ-IGLVSLGASDEDIEKLSTLYWFTVEFGLCKQNGAVK 358          

HSP 2 Score: 97.0561 bits (240), Expect = 2.401e-47
Identity = 44/112 (39.29%), Postives = 76/112 (67.86%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +KA+GAGLLSS GEL +A+S+ P+++ F+P   ++ PY+D+ YQPVY+V +S  D K+K+R+++ +I     IRYDPYT ++EVL+    + +    ++ +L  +  +L  +
Sbjct:  357 VKAYGAGLLSSYGELLYALSNEPQYKPFDPAETAVQPYQDQSYQPVYFVSESFEDAKQKLRRYSSTIQTPFSIRYDPYTCSMEVLDEPSKIQNALGQMRDDLKILHKALGRL 468          
BLAST of Tyrosine hydroxylase vs. Ensembl Zebrafish
Match: pah (phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GENE-031006-2])

HSP 1 Score: 106.686 bits (265), Expect = 4.845e-46
Identity = 48/69 (69.57%), Postives = 58/69 (84.06%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HELLGHVP+ +D  FA+FSQEIGL SLGA DE IE+LAT+YWFTVEFGLC +  ++K
Sbjct:  271 SKPMYTPEPDICHELLGHVPLFADPNFAQFSQEIGLASLGAPDEFIEKLATVYWFTVEFGLCKQGNEVK 339          

HSP 2 Score: 97.4413 bits (241), Expect = 4.845e-46
Identity = 48/113 (42.48%), Postives = 75/113 (66.37%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GELQ+ +++ P+ + FEP+      Y   E+QPVY+V +S  D KEK+R+FA +I R   +RY+ YT+ IE+L+N + + +L   I  E+  + N+L  M
Sbjct:  337 EVKAYGAGLLSSFGELQYCLTNEPKLQPFEPEKTCQQKYPITEFQPVYFVAESFEDAKEKVRRFATTIPRPFSVRYNAYTQRIEMLDNAQQLKNLADSINGEISILCNALRKM 449          
BLAST of Tyrosine hydroxylase vs. Ensembl Zebrafish
Match: tph2 (tryptophan hydroxylase 2 (tryptophan 5-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-040624-4])

HSP 1 Score: 106.301 bits (264), Expect = 4.081e-44
Identity = 47/69 (68.12%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            + PL+TPEPD  HELLGHVP+L+D +FA+FSQEIGL SLGASDED+++LAT Y+FT+EFGLC +D +L+
Sbjct:  316 TDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGQLR 384          

HSP 2 Score: 90.8929 bits (224), Expect = 4.081e-44
Identity = 43/113 (38.05%), Postives = 76/113 (67.26%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +++ +GAGLLSS GEL+HA+SD    ++F+P+T          +Q VY+V +S  + KEKMR+FAKSI R   + Y+PYT++I++L + +S+ ++ + ++ +L  + ++L  M
Sbjct:  382 QLRVYGAGLLSSIGELRHALSDKATVKVFDPKTTCYQECLITTFQDVYFVSESFEEAKEKMREFAKSIKRPFSVYYNPYTQSIDLLKDTRSIENVVQDLRSDLTTVCDALGKM 494          
BLAST of Tyrosine hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 105.916 bits (263), Expect = 3.936e-48
Identity = 48/69 (69.57%), Postives = 57/69 (82.61%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HELLGH P+ +D  FA+FSQEIGL SLGA DE IE LAT+YWFT+EFG+C +D KLK
Sbjct:  266 SKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLK 334          

HSP 2 Score: 105.531 bits (262), Expect = 3.936e-48
Identity = 48/113 (42.48%), Postives = 79/113 (69.91%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            K+KA+GAGLLSS GELQ+ ++D PE + FEP+  ++  Y   E+QP+Y++ +S  + KEK+R+FA +I R   +RY+PYT++IEVL+N + + +L   I  E+  + ++L  +
Sbjct:  332 KLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSALKKL 444          
BLAST of Tyrosine hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 105.916 bits (263), Expect = 4.002e-48
Identity = 48/69 (69.57%), Postives = 57/69 (82.61%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HELLGH P+ +D  FA+FSQEIGL SLGA DE IE LAT+YWFT+EFG+C +D KLK
Sbjct:  262 SKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLK 330          

HSP 2 Score: 105.531 bits (262), Expect = 4.002e-48
Identity = 48/113 (42.48%), Postives = 79/113 (69.91%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            K+KA+GAGLLSS GELQ+ ++D PE + FEP+  ++  Y   E+QP+Y++ +S  + KEK+R+FA +I R   +RY+PYT++IEVL+N + + +L   I  E+  + ++L  +
Sbjct:  328 KLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSALKKL 440          
BLAST of Tyrosine hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 105.916 bits (263), Expect = 4.240e-48
Identity = 48/69 (69.57%), Postives = 57/69 (82.61%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HELLGH P+ +D  FA+FSQEIGL SLGA DE IE LAT+YWFT+EFG+C +D KLK
Sbjct:  271 SKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLK 339          

HSP 2 Score: 105.531 bits (262), Expect = 4.240e-48
Identity = 48/113 (42.48%), Postives = 79/113 (69.91%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            K+KA+GAGLLSS GELQ+ ++D PE + FEP+  ++  Y   E+QP+Y++ +S  + KEK+R+FA +I R   +RY+PYT++IEVL+N + + +L   I  E+  + ++L  +
Sbjct:  337 KLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSALKKL 449          
BLAST of Tyrosine hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 105.531 bits (262), Expect = 4.925e-48
Identity = 48/69 (69.57%), Postives = 57/69 (82.61%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HELLGH P+ +D  FA+FSQEIGL SLGA DE IE LAT+YWFT+EFG+C +D KLK
Sbjct:  238 SKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLK 306          

HSP 2 Score: 105.531 bits (262), Expect = 4.925e-48
Identity = 48/113 (42.48%), Postives = 79/113 (69.91%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            K+KA+GAGLLSS GELQ+ ++D PE + FEP+  ++  Y   E+QP+Y++ +S  + KEK+R+FA +I R   +RY+PYT++IEVL+N + + +L   I  E+  + ++L  +
Sbjct:  304 KLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSALKKL 416          
BLAST of Tyrosine hydroxylase vs. Ensembl Xenopus
Match: hmgcr (3-hydroxy-3-methylglutaryl-CoA reductase [Source:Xenbase;Acc:XB-GENE-5840593])

HSP 1 Score: 105.531 bits (262), Expect = 5.051e-48
Identity = 48/69 (69.57%), Postives = 57/69 (82.61%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HELLGH P+ +D  FA+FSQEIGL SLGA DE IE LAT+YWFT+EFG+C +D KLK
Sbjct:  225 SKPMYTPEPDVCHELLGHAPLFADPGFAQFSQEIGLASLGAPDEYIEMLATVYWFTIEFGICKQDGKLK 293          

HSP 2 Score: 105.531 bits (262), Expect = 5.051e-48
Identity = 48/113 (42.48%), Postives = 79/113 (69.91%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            K+KA+GAGLLSS GELQ+ ++D PE + FEP+  ++  Y   E+QP+Y++ +S  + KEK+R+FA +I R   +RY+PYT++IEVL+N + + +L   I  E+  + ++L  +
Sbjct:  291 KLKAYGAGLLSSFGELQYCLTDKPEFKPFEPEKTALQKYPITEFQPIYFIAESFEEAKEKIRKFATTIPRPFSVRYNPYTQSIEVLDNIQQLKNLAESINSEIGILCSALKKL 403          
BLAST of Tyrosine hydroxylase vs. Ensembl Mouse
Match: Th (tyrosine hydroxylase [Source:MGI Symbol;Acc:MGI:98735])

HSP 1 Score: 113.62 bits (283), Expect = 1.157e-51
Identity = 49/69 (71.01%), Postives = 62/69 (89.86%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGHVP+L+D  FA+FSQ+IGL SLGASDE+IE+L+T+YWFTVEFGLC ++ +LK
Sbjct:  319 SSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTVYWFTVEFGLCKQNGELK 387          

HSP 2 Score: 108.997 bits (271), Expect = 1.157e-51
Identity = 49/113 (43.36%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL H++S+ PE R F+P TA++ PY+D+ YQPVY+V +S +D K+K+R +A  I R   +++DPYT  I+VL++  ++      ++ EL  +  +LS++
Sbjct:  385 ELKAYGAGLLSSYGELLHSLSEEPEVRAFDPDTAAVQPYQDQTYQPVYFVSESFSDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHTIRRSLEGVQDELHTLTQALSAI 497          
BLAST of Tyrosine hydroxylase vs. Ensembl Mouse
Match: Th (tyrosine hydroxylase [Source:MGI Symbol;Acc:MGI:98735])

HSP 1 Score: 113.235 bits (282), Expect = 1.697e-51
Identity = 49/69 (71.01%), Postives = 62/69 (89.86%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGHVP+L+D  FA+FSQ+IGL SLGASDE+IE+L+T+YWFTVEFGLC ++ +LK
Sbjct:  224 SSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTVYWFTVEFGLCKQNGELK 292          

HSP 2 Score: 108.997 bits (271), Expect = 1.697e-51
Identity = 49/113 (43.36%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL H++S+ PE R F+P TA++ PY+D+ YQPVY+V +S +D K+K+R +A  I R   +++DPYT  I+VL++  ++      ++ EL  +  +LS++
Sbjct:  290 ELKAYGAGLLSSYGELLHSLSEEPEVRAFDPDTAAVQPYQDQTYQPVYFVSESFSDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHTIRRSLEGVQDELHTLTQALSAI 402          
BLAST of Tyrosine hydroxylase vs. Ensembl Mouse
Match: Pah (phenylalanine hydroxylase [Source:MGI Symbol;Acc:MGI:97473])

HSP 1 Score: 108.997 bits (271), Expect = 2.593e-46
Identity = 50/69 (72.46%), Postives = 57/69 (82.61%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP++TPEPD  HELLGHVP+ SD  FA+FSQEIGL SLGA DE IE+LAT+YWFTVEFGLC E   +K
Sbjct:  273 SKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIK 341          

HSP 2 Score: 95.9005 bits (237), Expect = 2.593e-46
Identity = 49/112 (43.75%), Postives = 71/112 (63.39%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            IKA+GAGLLSS GELQ+ +SD P+    E +  +   Y   E+QP+YYV +S  D KEK+R FA +I R   +RYDPYT+ +EVL+N + +  L   I  E+  + ++L  +
Sbjct:  340 IKAYGAGLLSSFGELQYCLSDKPKLLPLELEKTACQEYTVTEFQPLYYVAESFNDAKEKVRTFAATIPRPFSVRYDPYTQRVEVLDNTQQLKILADSINSEVGILCHALQKI 451          
BLAST of Tyrosine hydroxylase vs. Ensembl Mouse
Match: Tph2 (tryptophan hydroxylase 2 [Source:MGI Symbol;Acc:MGI:2651811])

HSP 1 Score: 105.145 bits (261), Expect = 3.389e-44
Identity = 47/69 (68.12%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S PL+TPEPD  HELLGHVP+L+D +FA+FSQEIGL SLGASDED+++LAT Y+FT+EFGLC ++ +L+
Sbjct:  304 SDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQEGQLR 372          

HSP 2 Score: 92.4337 bits (228), Expect = 3.389e-44
Identity = 44/113 (38.94%), Postives = 77/113 (68.14%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +++A+GAGLLSS GEL+HA+SD    + F+P+T  +       +Q  Y+V DS  + KEKMR FAKSI R   + ++PYT++IE+L + +S+ ++ + ++ +L+ + ++L+ M
Sbjct:  370 QLRAYGAGLLSSIGELKHALSDKACVKSFDPKTTCLQECLITTFQDAYFVSDSFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKM 482          
BLAST of Tyrosine hydroxylase vs. Ensembl Mouse
Match: Tph1 (tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MGI:98796])

HSP 1 Score: 101.293 bits (251), Expect = 1.914e-41
Identity = 46/69 (66.67%), Postives = 59/69 (85.51%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S PL+TPEPD  HELLGHVP+L++  FA+FSQEIGL SLGAS+E +++LAT Y+FTVEFGLC +D +L+
Sbjct:  263 SDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEETVQKLATCYFFTVEFGLCKQDGQLR 331          

HSP 2 Score: 87.0409 bits (214), Expect = 1.914e-41
Identity = 42/111 (37.84%), Postives = 73/111 (65.77%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLS 530
            +++ FGAGLLSS  EL+HA+S   + + F+P+ A         +Q VY+V +S  D KEKMR+FAK++ R   ++Y+PYT++++VL + KS+      ++ +LD + ++L+
Sbjct:  329 QLRVFGAGLLSSISELKHALSGHAKVKPFDPKIACKQECLITSFQDVYFVSESFEDAKEKMREFAKTVKRPFGLKYNPYTQSVQVLRDTKSITSAMNELRYDLDVISDALA 439          
BLAST of Tyrosine hydroxylase vs. UniProt/SwissProt
Match: sp|P11982|TY3H_PHASP (Tyrosine 3-monooxygenase OS=Phasianidae sp. OX=9006 GN=TH PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.316e-51
Identity = 50/110 (45.45%), Postives = 79/110 (71.82%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLS 530
            +KA+GAGLLSS GEL H++SD PE R F+P  A++ P +D+ YQPVY+V +S +D K K+R +A  I R   ++Y+PYT +IE+L++ +++CH    ++ EL  + N+L+
Sbjct:  379 VKAYGAGLLSSYGELIHSLSDEPEVRDFDPDAAAVQPCQDQPYQPVYFVSESFSDAKNKLRNYAAHIKRPFSVKYEPYTHSIELLDSPQTICHSLESVRDELHTLINALN 488          

HSP 2 Score: 112.464 bits (280), Expect = 1.316e-51
Identity = 49/69 (71.01%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGHVP+L+D  FA+FSQ+IGL SLGA+DE+IE+LATLYWFTVEFGLC ++  +K
Sbjct:  312 SSPMHSPEPDCCHELLGHVPMLADKTFAQFSQDIGLASLGATDEEIEKLATLYWFTVEFGLCRQNGIVK 380          
BLAST of Tyrosine hydroxylase vs. UniProt/SwissProt
Match: sp|A0A060X6Z0|TY3H_ONCMY (Tyrosine 3-monooxygenase OS=Oncorhynchus mykiss OX=8022 GN=th PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.974e-51
Identity = 48/64 (75.00%), Postives = 58/64 (90.62%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYE 192
            S P+H+PEPDC+HELLGHVP+L+D  FA+FSQ IGL SLGAS+EDIE+L+TLYWFTVEFGLC +
Sbjct:  310 SSPMHSPEPDCVHELLGHVPILADRVFAQFSQNIGLASLGASEEDIEKLSTLYWFTVEFGLCKQ 373          

HSP 2 Score: 112.079 bits (279), Expect = 1.974e-51
Identity = 54/112 (48.21%), Postives = 77/112 (68.75%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +KA+GAGLLSS GEL HA+SD PE R F+P+ A+I PY+D+ YQ VY+V +S TD KEK+R +   I R   +R+DPYT +IEVL+N   +      +K EL  + ++L+ +
Sbjct:  377 VKAYGAGLLSSYGELVHALSDEPERREFDPEAAAIQPYQDQNYQSVYFVSESFTDAKEKLRSYVAGIKRPFSVRFDPYTYSIEVLDNPLKIRGGLESVKDELKMLTDALNVL 488          
BLAST of Tyrosine hydroxylase vs. UniProt/SwissProt
Match: sp|P18459|TY3H_DROME (Tyrosine 3-monooxygenase OS=Drosophila melanogaster OX=7227 GN=ple PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 2.307e-51
Identity = 49/69 (71.01%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            + P HTPEPD IHELLGH+P+L+D  FA+FSQEIGL SLGASDE+IE+L+T+YWFTVEFGLC E  ++K
Sbjct:  397 NSPYHTPEPDSIHELLGHMPLLADPSFAQFSQEIGLASLGASDEEIEKLSTVYWFTVEFGLCKEHGQIK 465          

HSP 2 Score: 112.079 bits (279), Expect = 2.307e-51
Identity = 51/113 (45.13%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +IKA+GAGLLSS GEL HAISD  EHR FEP + ++ PY+D+EYQP+YYV +S  D K+K R++  ++ R   +R++P+TE +EVL++   +  L   +  E+ ++ N++S +
Sbjct:  463 QIKAYGAGLLSSYGELLHAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVAESFEDAKDKFRRWVSTMSRPFEVRFNPHTERVEVLDSVDKLETLVHQMNTEILHLTNAISKL 575          
BLAST of Tyrosine hydroxylase vs. UniProt/SwissProt
Match: sp|P07101|TY3H_HUMAN (Tyrosine 3-monooxygenase OS=Homo sapiens OX=9606 GN=TH PE=1 SV=5)

HSP 1 Score: 114.005 bits (284), Expect = 4.554e-51
Identity = 49/69 (71.01%), Postives = 62/69 (89.86%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGHVP+L+D  FA+FSQ+IGL SLGASDE+IE+L+TLYWFTVEFGLC ++ ++K
Sbjct:  349 SSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVK 417          

HSP 2 Score: 109.383 bits (272), Expect = 4.554e-51
Identity = 49/113 (43.36%), Postives = 81/113 (71.68%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL H +S+ PE R F+P+ A++ PY+D+ YQ VY+V +S +D K+K+R +A  I R   +++DPYT  I+VL++ ++V      ++ ELD + ++LS++
Sbjct:  415 EVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAI 527          
BLAST of Tyrosine hydroxylase vs. UniProt/SwissProt
Match: sp|O42091|TY3H_ANGAN (Tyrosine 3-monooxygenase OS=Anguilla anguilla OX=7936 GN=th PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.290e-51
Identity = 49/69 (71.01%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC+HELLGHVP+L+D  FA+FSQ IGL SLGAS+EDIE+L+TLYWFTVEFGLC +   +K
Sbjct:  309 SSPMHSPEPDCVHELLGHVPMLADRTFAQFSQNIGLASLGASEEDIEKLSTLYWFTVEFGLCKQGDGVK 377          

HSP 2 Score: 109.768 bits (273), Expect = 5.290e-51
Identity = 53/112 (47.32%), Postives = 78/112 (69.64%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +KA+GAGLLSS GEL H++SD PE R F+P+ A+  PY+D+ YQ VY+V +S TD KEK+R +A  I+R   +R+DPYT +IEVL+N   +      +K EL  + ++L+ +
Sbjct:  376 VKAYGAGLLSSYGELVHSLSDEPERREFDPEAAAAEPYQDQNYQSVYFVSESFTDAKEKLRVYAAGINRPFSVRFDPYTYSIEVLDNPLKIRGGLESVKDELKVLTDALNVL 487          
BLAST of Tyrosine hydroxylase vs. TrEMBL
Match: A6P4D3 (Tyrosine hydroxylase OS=Dugesia japonica OX=6161 GN=DjTH PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.232e-89
Identity = 101/117 (86.32%), Postives = 111/117 (94.87%), Query Frame = 3
Query:  195 QKIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSMLTF 545
            +KIKAFGAGLLSS GEL+HAIS++PEHR F+PQ AS+TPY+DE+YQPVYYVIDSVTDMKEK+RQFAKSI RQNPIRYDPYTETIE+LNNKKSVCHLGRVIK ELD MENSLSSMLTF
Sbjct:  372 KKIKAFGAGLLSSFGELKHAISNIPEHRNFDPQVASVTPYKDEDYQPVYYVIDSVTDMKEKVRQFAKSIKRQNPIRYDPYTETIEILNNKKSVCHLGRVIKHELDTMENSLSSMLTF 488          

HSP 2 Score: 140.198 bits (352), Expect = 3.232e-89
Identity = 63/69 (91.30%), Postives = 67/69 (97.10%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKPLHTPEPDCIHELLGHVP+LSD EFAEFSQEIGLCSLGASD DIERLATLYWFT+EFGLCYE+KK+K
Sbjct:  307 SKPLHTPEPDCIHELLGHVPMLSDAEFAEFSQEIGLCSLGASDSDIERLATLYWFTIEFGLCYENKKIK 375          
BLAST of Tyrosine hydroxylase vs. TrEMBL
Match: F6KBQ1 (Tyrosine hydroxylase (Fragment) OS=Schmidtea mediterranea OX=79327 GN=th PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 5.479e-73
Identity = 74/75 (98.67%), Postives = 75/75 (100.00%), Query Frame = 3
Query:  195 QKIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPI 419
            +KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPI
Sbjct:  343 KKIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPI 417          

HSP 2 Score: 147.517 bits (371), Expect = 5.479e-73
Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKK+K
Sbjct:  278 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKIK 346          
BLAST of Tyrosine hydroxylase vs. TrEMBL
Match: A0A1S3HUS1 (phenylalanine-4-hydroxylase OS=Lingula unguis OX=7574 GN=LOC106158393 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.394e-58
Identity = 62/113 (54.87%), Postives = 85/113 (75.22%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +IKA+GAGLLSS GEL HA+SD PE R F+PQTA++  Y+D EYQP+YYV +S  DMKEK+R++A  I R+  +RYDPYT+ I+ L++K +V  L   IK EL+++ N+L  M
Sbjct:  388 QIKAYGAGLLSSFGELMHALSDKPEQRAFDPQTAAVQEYQDVEYQPIYYVAESFDDMKEKVRRYASKIRRRCELRYDPYTQGIQCLDSKGAVTDLTMFIKAELNHLNNALEKM 500          

HSP 2 Score: 119.013 bits (297), Expect = 4.394e-58
Identity = 52/69 (75.36%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDCIHELLGHVP+L++  FA+FSQEIGL SLG SDEDIE+ ATLYWFTVEFGLC ED ++K
Sbjct:  322 SAPMHSPEPDCIHELLGHVPLLANPSFAQFSQEIGLASLGTSDEDIEKFATLYWFTVEFGLCREDGQIK 390          
BLAST of Tyrosine hydroxylase vs. TrEMBL
Match: A0A091J4P8 (Tyrosine 3-monooxygenase OS=Egretta garzetta OX=188379 GN=Z169_10590 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 4.473e-52
Identity = 52/111 (46.85%), Postives = 82/111 (73.87%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLS 530
            K+KA+GAGLLSS GEL H++SD PE R F+P  A++ PY+D+ YQPVY+V +S +D K K+R +A  I R   ++Y+PYT +IE+L++ +++CH    ++ EL ++ N+L+
Sbjct:  378 KVKAYGAGLLSSYGELIHSLSDEPEVRDFDPDAAAVQPYQDQNYQPVYFVSESFSDAKSKLRSYAAHIKRPFSVKYEPYTHSIELLDSPQTICHSLESVRDELHSLINALN 488          

HSP 2 Score: 115.546 bits (288), Expect = 4.473e-52
Identity = 50/69 (72.46%), Postives = 62/69 (89.86%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGHVP+L+D  FA+FSQ+IGL SLGA+DE+IE+LATLYWFTVEFGLC ++ K+K
Sbjct:  312 SSPMHSPEPDCCHELLGHVPMLADKTFAQFSQDIGLASLGATDEEIEKLATLYWFTVEFGLCRQNGKVK 380          
BLAST of Tyrosine hydroxylase vs. TrEMBL
Match: A0A2R7WDF9 (Tyrosine 3-monooxygenase OS=Oncopeltus fasciatus OX=7536 GN=OFAS_OFAS007495 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 5.271e-52
Identity = 51/69 (73.91%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            + P HTPEPDCIHELLGH+P+L+D  FA+FSQEIGL SLGASDE+IE+L+T+YWFTVEFGLC E  K+K
Sbjct:  386 TTPFHTPEPDCIHELLGHMPLLADASFAQFSQEIGLASLGASDEEIEKLSTVYWFTVEFGLCKEHGKVK 454          

HSP 2 Score: 115.546 bits (288), Expect = 5.271e-52
Identity = 50/113 (44.25%), Postives = 81/113 (71.68%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            K+KA+GAGLLSS GEL HAISD PEHR FEP T ++ PY+D+EYQP+Y+V +S  D KEK R++  ++ R   +R++P+T+++E+L++   +  L   +  E+ ++  +L+ +
Sbjct:  452 KVKAYGAGLLSSYGELLHAISDKPEHRPFEPSTTAVQPYQDQEYQPIYFVAESFEDAKEKFRRWVSTMSRPFEVRFNPHTQSVEILDSVDRLDGLVSQMNLEMQHLTTALTKL 564          
BLAST of Tyrosine hydroxylase vs. Ensembl Cavefish
Match: th (tyrosine hydroxylase [Source:NCBI gene;Acc:103023599])

HSP 1 Score: 114.39 bits (285), Expect = 2.759e-52
Identity = 50/69 (72.46%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC+HELLGHVP+L+D  FA+FSQ IGL SLGAS+EDIE+L+TLYWFTVEFGLC +   LK
Sbjct:  314 SAPMHSPEPDCVHELLGHVPMLADKTFAQFSQSIGLASLGASEEDIEKLSTLYWFTVEFGLCKQGDTLK 382          

HSP 2 Score: 110.153 bits (274), Expect = 2.759e-52
Identity = 51/112 (45.54%), Postives = 79/112 (70.54%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +KA+GAGLLSS GEL HA+SD PE R F+P+T ++ PY+D+EYQ VY+V +S  D KEK+R ++  I R   +R+DP+T +IEVL+N   +     ++K +L  + ++L+ +
Sbjct:  381 LKAYGAGLLSSYGELVHALSDEPEIREFDPETVAVQPYQDQEYQSVYFVSESFADAKEKLRGYSTGIKRPFSVRFDPFTSSIEVLDNPLKIRGGLELVKEDLKVLTDALNVL 492          
BLAST of Tyrosine hydroxylase vs. Ensembl Cavefish
Match: th (tyrosine hydroxylase [Source:NCBI gene;Acc:103023599])

HSP 1 Score: 114.005 bits (284), Expect = 3.906e-52
Identity = 50/69 (72.46%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC+HELLGHVP+L+D  FA+FSQ IGL SLGAS+EDIE+L+TLYWFTVEFGLC +   LK
Sbjct:  338 SAPMHSPEPDCVHELLGHVPMLADKTFAQFSQSIGLASLGASEEDIEKLSTLYWFTVEFGLCKQGDTLK 406          

HSP 2 Score: 110.153 bits (274), Expect = 3.906e-52
Identity = 51/112 (45.54%), Postives = 79/112 (70.54%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +KA+GAGLLSS GEL HA+SD PE R F+P+T ++ PY+D+EYQ VY+V +S  D KEK+R ++  I R   +R+DP+T +IEVL+N   +     ++K +L  + ++L+ +
Sbjct:  405 LKAYGAGLLSSYGELVHALSDEPEIREFDPETVAVQPYQDQEYQSVYFVSESFADAKEKLRGYSTGIKRPFSVRFDPFTSSIEVLDNPLKIRGGLELVKEDLKVLTDALNVL 516          
BLAST of Tyrosine hydroxylase vs. Ensembl Cavefish
Match: th (tyrosine hydroxylase [Source:NCBI gene;Acc:103023599])

HSP 1 Score: 113.62 bits (283), Expect = 4.573e-52
Identity = 50/69 (72.46%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC+HELLGHVP+L+D  FA+FSQ IGL SLGAS+EDIE+L+TLYWFTVEFGLC +   LK
Sbjct:  313 SAPMHSPEPDCVHELLGHVPMLADKTFAQFSQSIGLASLGASEEDIEKLSTLYWFTVEFGLCKQGDTLK 381          

HSP 2 Score: 110.153 bits (274), Expect = 4.573e-52
Identity = 51/112 (45.54%), Postives = 79/112 (70.54%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +KA+GAGLLSS GEL HA+SD PE R F+P+T ++ PY+D+EYQ VY+V +S  D KEK+R ++  I R   +R+DP+T +IEVL+N   +     ++K +L  + ++L+ +
Sbjct:  380 LKAYGAGLLSSYGELVHALSDEPEIREFDPETVAVQPYQDQEYQSVYFVSESFADAKEKLRGYSTGIKRPFSVRFDPFTSSIEVLDNPLKIRGGLELVKEDLKVLTDALNVL 491          
BLAST of Tyrosine hydroxylase vs. Ensembl Cavefish
Match: pah (phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GENE-031006-2])

HSP 1 Score: 101.679 bits (252), Expect = 2.224e-44
Identity = 45/69 (65.22%), Postives = 55/69 (79.71%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P++TPEPD  HELLGHVP+ +D  FA+FSQEIGL SL A DE IE+LAT+YWFTVEFGLC +   ++
Sbjct:  235 SNPMYTPEPDICHELLGHVPLFADPSFAQFSQEIGLASLAAPDEYIEKLATVYWFTVEFGLCKQGNDIR 303          

HSP 2 Score: 96.2857 bits (238), Expect = 2.224e-44
Identity = 49/112 (43.75%), Postives = 76/112 (67.86%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            I+A+GAGLLSS GELQ+A++D P+   FEP+   +  Y   E+QP+Y+V +S  D KEK+R++A +I R   +RY+ YT++IEVL+N + + +L   I  E+  + N+L  M
Sbjct:  302 IRAYGAGLLSSFGELQYALTDKPKLLPFEPEKTILQKYPITEFQPIYFVAESFEDSKEKVRKYAATIPRPFSVRYNAYTQSIEVLDNTQQLRNLANSIS-EVGILCNALQKM 412          
BLAST of Tyrosine hydroxylase vs. Ensembl Cavefish
Match: tph2 (tryptophan hydroxylase 2 (tryptophan 5-monooxygenase) [Source:ZFIN;Acc:ZDB-GENE-040624-4])

HSP 1 Score: 105.916 bits (263), Expect = 3.172e-44
Identity = 47/69 (68.12%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            + PL+TPEPD  HELLGHVP+L+D +FA+FSQEIGL SLGASDED+++LAT Y+FT+EFGLC +D +L+
Sbjct:  262 TDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGQLR 330          

HSP 2 Score: 91.6633 bits (226), Expect = 3.172e-44
Identity = 45/113 (39.82%), Postives = 76/113 (67.26%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +++A+GAGLLSS GEL+HA+SD    + F+P+T          +Q VY+V DS  + KEKMR+FAKSI R   + Y+PYT++I++L + +S+ ++ + ++ +L  + ++L  M
Sbjct:  328 QLRAYGAGLLSSIGELRHALSDKAVVKPFDPRTTCYQECLITTFQDVYFVSDSFEEAKEKMREFAKSIKRPFSVYYNPYTQSIDLLKDTRSIENVVQDLRSDLTTVCDALGKM 440          
BLAST of Tyrosine hydroxylase vs. Ensembl Sea Lamprey
Match: tph1a (tryptophan hydroxylase 1 (tryptophan 5-monooxygenase) a [Source:ZFIN;Acc:ZDB-GENE-030317-1])

HSP 1 Score: 103.219 bits (256), Expect = 8.113e-44
Identity = 47/69 (68.12%), Postives = 59/69 (85.51%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S PL+TPEPD  HELLGHVP+L++  FA+FSQEIGL SLGASDE +++LAT Y+FTVEFGLC +D +L+
Sbjct:  301 SDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDEAVQKLATCYFFTVEFGLCKQDGQLR 369          

HSP 2 Score: 90.8929 bits (224), Expect = 8.113e-44
Identity = 42/113 (37.17%), Postives = 75/113 (66.37%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +++A+GAGLLSS  EL+HA+S+  + + F+P+           +Q +Y+V +S  + KEKMR+FAK+I R   +RY+PYT++IEVL + + +  + + ++ ELD + ++L  +
Sbjct:  367 QLRAYGAGLLSSISELKHALSENAKVKGFDPKVTCKQECLITTFQDIYFVSESFEEAKEKMREFAKTIKRNFTVRYNPYTQSIEVLKDTRMIAEMVKELRAELDTVSDALHRL 479          
BLAST of Tyrosine hydroxylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000676.1 (pep scaffold:Pmarinus_7.0:GL477040:200355:204568:-1 gene:ENSPMAG00000000617.1 transcript:ENSPMAT00000000676.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 1.476e-42
Identity = 47/112 (41.96%), Postives = 77/112 (68.75%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +KA+GAGLLSS GEL  A+S  PE+R FE + A++ PY+D+ YQPVY+V DS+ D K+K+RQ+A+ + R   +R+DP T ++  L++ +S+      ++ ++  +  +LS M
Sbjct:  170 VKAYGAGLLSSFGELMFALSGEPEYRAFEAEAAALQPYQDQTYQPVYFVSDSLEDAKDKLRQYAQGLRRPVALRFDPITRSVHALDSTRSLRTAVDALQEQVSVLSCALSRM 281          

HSP 2 Score: 83.5741 bits (205), Expect = 1.476e-42
Identity = 37/69 (53.62%), Postives = 47/69 (68.12%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGHVP+L+D  FA+FSQ  G+  +         L  LYWFTVEFGLC ++  +K
Sbjct:  103 SSPMHSPEPDCCHELLGHVPMLADSTFAQFSQVSGVSEVSVRTHPCAPLPQLYWFTVEFGLCKQEGHVK 171          
BLAST of Tyrosine hydroxylase vs. Ensembl Nematostella
Match: EDO31745 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX22])

HSP 1 Score: 107.071 bits (266), Expect = 1.642e-36
Identity = 46/69 (66.67%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            +KP++TPEPD +HEL+GHVP+ +D +FA+FSQEIGL SLGA DE +E+LATLYWFTVEFGLC ++ ++K
Sbjct:  266 TKPMYTPEPDVVHELIGHVPLFADPDFAQFSQEIGLASLGAPDEWVEKLATLYWFTVEFGLCRQEGEVK 334          

HSP 2 Score: 63.1586 bits (152), Expect = 1.642e-36
Identity = 28/63 (44.44%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQ 386
            ++KA+GAGLLSS GELQ+ ++D P+    EP+  S+  Y   +YQPVY++ DS    + K+R+
Sbjct:  332 EVKAYGAGLLSSFGELQYCLTDEPKKYPLEPEKTSVQKYPITQYQPVYFIADSFLSARNKVRK 394          
BLAST of Tyrosine hydroxylase vs. Ensembl Medaka
Match: th (tyrosine hydroxylase [Source:NCBI gene;Acc:101171548])

HSP 1 Score: 114.775 bits (286), Expect = 5.231e-53
Identity = 48/69 (69.57%), Postives = 62/69 (89.86%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC+HELLGHVP+L+D  FA+FSQ +GL SLGASDEDIE+L+TLYWFTVE+GLC ++ ++K
Sbjct:  310 SSPMHSPEPDCVHELLGHVPMLADRTFAQFSQNLGLASLGASDEDIEKLSTLYWFTVEYGLCKQNGEVK 378          

HSP 2 Score: 112.079 bits (279), Expect = 5.231e-53
Identity = 53/113 (46.90%), Postives = 78/113 (69.03%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            ++KA+GAGLLSS GEL H++SD PE R F+P+ A++ PY+D+ YQPVY+V +S +D KEK R++   I R   +R+DP+T  IEVL+N   V      +K EL  + ++LS +
Sbjct:  376 EVKAYGAGLLSSYGELVHSLSDEPETREFDPEAAALQPYQDQNYQPVYFVSESFSDAKEKFRKYVAGIKRPFSVRFDPFTHNIEVLDNPLKVQGGLESVKDELKVLADALSVL 488          
BLAST of Tyrosine hydroxylase vs. Ensembl Medaka
Match: th2 (tyrosine 3-monooxygenase-like [Source:NCBI gene;Acc:101168664])

HSP 1 Score: 116.316 bits (290), Expect = 7.166e-51
Identity = 50/69 (72.46%), Postives = 62/69 (89.86%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P+H+PEPDC HELLGH+P+L++ EFA+FSQEIGL SLGASDEDIE+L+TLYWFTVEFGLC ++  +K
Sbjct:  289 SSPMHSPEPDCCHELLGHIPMLANKEFAQFSQEIGLASLGASDEDIEKLSTLYWFTVEFGLCKQNGAVK 357          

HSP 2 Score: 103.605 bits (257), Expect = 7.166e-51
Identity = 46/112 (41.07%), Postives = 77/112 (68.75%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +KA+GAGLLSS GEL +A+S+ PE++ F+P+ A++ PY+D+ YQPVY+V +S  D K K+R+++ +I R   +RYDP+T +IEVL+    +      ++ +L  +  +L  +
Sbjct:  356 VKAYGAGLLSSYGELVYALSNEPEYKPFDPEEAAVQPYQDQTYQPVYFVSESFEDAKMKLRRYSANIQRPFAVRYDPFTCSIEVLDQPARIQSALSQMREDLKTLHGALEKL 467          
BLAST of Tyrosine hydroxylase vs. Ensembl Medaka
Match: pah (phenylalanine hydroxylase [Source:NCBI gene;Acc:101163702])

HSP 1 Score: 107.071 bits (266), Expect = 1.433e-48
Identity = 52/113 (46.02%), Postives = 77/113 (68.14%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSM 536
            +IKA+GAGLLSS GELQ++++D P    F+P+  S+  Y   EYQPVY+V +S  D KEK+R+FA +I R   +RY+PYT++IEVLNN + + +L   I  E+  +  +L  +
Sbjct:  393 EIKAYGAGLLSSFGELQYSLTDEPNMLPFDPEKTSLQKYPITEYQPVYFVAESFEDAKEKVRKFAGTIPRPFSVRYNPYTQSIEVLNNTQQLRNLADCINCEVGKLCEALQKL 505          

HSP 2 Score: 105.145 bits (261), Expect = 1.433e-48
Identity = 48/69 (69.57%), Postives = 58/69 (84.06%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKP +TPEPD  HELLGHVP+L+D  FA+FSQEIGL SLGA DE IE+LAT+YWFTVE+GLC +  ++K
Sbjct:  327 SKPTYTPEPDVCHELLGHVPLLADPSFAQFSQEIGLASLGAPDEFIEKLATVYWFTVEYGLCKQGSEIK 395          
BLAST of Tyrosine hydroxylase vs. Ensembl Medaka
Match: tph2 (tryptophan hydroxylase 2 [Source:NCBI gene;Acc:101166957])

HSP 1 Score: 105.531 bits (262), Expect = 6.252e-44
Identity = 47/69 (68.12%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            + PL+TPEPD  HELLGHVP+L+D +FA+FSQEIGL SLGASDED+++LAT Y+FT+EFGLC +D  L+
Sbjct:  326 TDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQDGHLR 394          

HSP 2 Score: 91.2781 bits (225), Expect = 6.252e-44
Identity = 44/115 (38.26%), Postives = 78/115 (67.83%), Query Frame = 3
Query:  201 IKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSMLTF 545
            ++A+GAGLLSS GEL+HA+SD    R+F+P+T          +Q VY+V +S  + KEKMR+FAK+I R   + Y+PYT+++++L + +S+ ++ + ++ +L  + ++L  M T+
Sbjct:  393 LRAYGAGLLSSIGELRHALSDKACVRMFDPKTTCNQECLITTFQEVYFVSESFEEAKEKMREFAKTIKRPFSVYYNPYTQSVDLLKDTRSIENVVQDLRSDLTTVCDALGKMNTY 507          
BLAST of Tyrosine hydroxylase vs. Ensembl Medaka
Match: tph1b (tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:101170994])

HSP 1 Score: 102.834 bits (255), Expect = 1.963e-41
Identity = 47/69 (68.12%), Postives = 60/69 (86.96%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S+PL+TPEPD  HELLGHVP+L++  FA+FSQEIGL SLGASD+ +++LAT Y+FTVEFGLC +D KL+
Sbjct:  262 SEPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASDDAVKKLATCYFFTVEFGLCKQDGKLR 330          

HSP 2 Score: 85.5001 bits (210), Expect = 1.963e-41
Identity = 41/114 (35.96%), Postives = 72/114 (63.16%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSML 539
            K++A+GAGLLSS+ EL+H++S       F+P            +Q  Y+V +S  + K KMR+FAK++HR   + Y+PYT++++VL N  ++  + + I+ ELD +E +L+ ++
Sbjct:  328 KLRAYGAGLLSSASELKHSLSGKANILPFDPILTCNQECMITTFQEAYFVAESFEEAKNKMREFAKTLHRPFTVHYNPYTQSVDVLTNTHNINSMVKDIRHELDIVEEALNQLV 441          
BLAST of Tyrosine hydroxylase vs. Planmine SMEST
Match: SMESG000034472.1 (SMESG000034472.1)

HSP 1 Score: 243.047 bits (619), Expect = 1.992e-102
Identity = 115/117 (98.29%), Postives = 117/117 (100.00%), Query Frame = 3
Query:  195 QKIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSMLTF 545
            +K+KAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSMLTF
Sbjct:  376 KKMKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSMLTF 492          

HSP 2 Score: 148.288 bits (373), Expect = 1.992e-102
Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKK+K
Sbjct:  311 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKMK 379          
BLAST of Tyrosine hydroxylase vs. Planmine SMEST
Match: SMESG000077798.1 (SMESG000077798.1)

HSP 1 Score: 105.531 bits (262), Expect = 8.327e-48
Identity = 50/67 (74.63%), Postives = 56/67 (83.58%), Query Frame = 1
Query:    7 PLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            PL+TPEPD  HELLGHVP+  + EFA+FSQEIGL SLGASDE IE+LAT YWFTVEFGLC E  K+K
Sbjct:  264 PLYTPEPDVCHELLGHVPLFCNPEFAQFSQEIGLASLGASDEYIEKLATCYWFTVEFGLCKEHDKIK 330          

HSP 2 Score: 103.605 bits (257), Expect = 8.327e-48
Identity = 47/114 (41.23%), Postives = 75/114 (65.79%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSML 539
            KIKA+GAGLLSS GELQ+ ++D P+   F+PQ   +  Y   EYQP+Y+V +S  D K ++R F+K + R   ++YDPYT+T+EVL+    +  L   +K + + +E +L+ ++
Sbjct:  328 KIKAYGAGLLSSFGELQYCLTDEPKKLSFDPQVTGLQKYPIVEYQPIYFVAESFADAKIRLRNFSKMVDRPFAVKYDPYTQTVEVLDKNSQIKQLMISLKDDFNVLEEALNKLI 441          
BLAST of Tyrosine hydroxylase vs. Planmine SMEST
Match: SMESG000000522.1 (SMESG000000522.1)

HSP 1 Score: 107.457 bits (267), Expect = 2.056e-42
Identity = 45/69 (65.22%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P +TPEPDC HEL+GHVP+L+D  FA+FSQEIGL SLGAS+++++RLAT Y+FT+EFGLC++D +L+
Sbjct:  351 SDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELR 419          

HSP 2 Score: 83.5741 bits (205), Expect = 2.056e-42
Identity = 44/116 (37.93%), Postives = 70/116 (60.34%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSMLTF 545
            +++A+GAGLLSS GEL+HA+S+    + F+P+T          +Q  Y+   S  D K+KMR+FAK+I +   + Y+PYT+ IE L++  S+ ++   IK EL  + N+L     F
Sbjct:  417 ELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 532          
BLAST of Tyrosine hydroxylase vs. Planmine SMEST
Match: SMESG000000522.1 (SMESG000000522.1)

HSP 1 Score: 107.071 bits (266), Expect = 3.271e-42
Identity = 45/69 (65.22%), Postives = 61/69 (88.41%), Query Frame = 1
Query:    1 SKPLHTPEPDCIHELLGHVPVLSDMEFAEFSQEIGLCSLGASDEDIERLATLYWFTVEFGLCYEDKKLK 207
            S P +TPEPDC HEL+GHVP+L+D  FA+FSQEIGL SLGAS+++++RLAT Y+FT+EFGLC++D +L+
Sbjct:  284 SDPFYTPEPDCCHELMGHVPLLADSSFAQFSQEIGLASLGASEDEVQRLATCYFFTIEFGLCHQDGELR 352          

HSP 2 Score: 83.1889 bits (204), Expect = 3.271e-42
Identity = 44/116 (37.93%), Postives = 70/116 (60.34%), Query Frame = 3
Query:  198 KIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQPVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHLGRVIKRELDNMENSLSSMLTF 545
            +++A+GAGLLSS GEL+HA+S+    + F+P+T          +Q  Y+   S  D K+KMR+FAK+I +   + Y+PYT+ IE L++  S+ ++   IK EL  + N+L     F
Sbjct:  350 ELRAYGAGLLSSIGELKHALSNESNIQKFDPKTVMEQECLVTTFQNAYFFTTSFEDAKDKMREFAKTIKKPFDVHYNPYTQMIETLDSTDSLTNVIDNIKGELATITNALRKFNIF 465          
The following BLAST results are available for this feature:
BLAST of Tyrosine hydroxylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TH1.077e-5171.01tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
TH1.161e-5171.01tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
TH1.200e-5171.01tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
TH4.778e-4743.36tyrosine hydroxylase [Source:HGNC Symbol;Acc:HGNC:... [more]
PAH5.217e-4671.01phenylalanine hydroxylase [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cat-21.686e-4671.64Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-... [more]
cat-21.787e-4671.64Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-... [more]
cat-21.976e-4671.64Tyrosine 3-monooxygenase [Source:UniProtKB/Swiss-... [more]
pah-12.107e-4568.12Phenylalanine-4-hydroxylase [Source:UniProtKB/Swi... [more]
pah-12.269e-4568.12Phenylalanine-4-hydroxylase [Source:UniProtKB/Swi... [more]
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ple2.494e-5271.01gene:FBgn0005626 transcript:FBtr0076956[more]
ple3.141e-5271.01gene:FBgn0005626 transcript:FBtr0076957[more]
ple3.141e-5271.01gene:FBgn0005626 transcript:FBtr0345585[more]
Hn4.721e-4562.32gene:FBgn0001208 transcript:FBtr0334645[more]
Hn4.721e-4562.32gene:FBgn0001208 transcript:FBtr0076811[more]
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
th2.292e-5272.46tyrosine hydroxylase [Source:ZFIN;Acc:ZDB-GENE-990... [more]
th2.553e-5272.46tyrosine hydroxylase [Source:ZFIN;Acc:ZDB-GENE-990... [more]
th22.401e-4772.46tyrosine hydroxylase 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pah4.845e-4669.57phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GEN... [more]
tph24.081e-4468.12tryptophan hydroxylase 2 (tryptophan 5-monooxygena... [more]
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgcr3.936e-4869.573-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
hmgcr4.002e-4869.573-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
hmgcr4.240e-4869.573-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
hmgcr4.925e-4869.573-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
hmgcr5.051e-4869.573-hydroxy-3-methylglutaryl-CoA reductase [Source:X... [more]
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Th1.157e-5171.01tyrosine hydroxylase [Source:MGI Symbol;Acc:MGI:98... [more]
Th1.697e-5171.01tyrosine hydroxylase [Source:MGI Symbol;Acc:MGI:98... [more]
Pah2.593e-4672.46phenylalanine hydroxylase [Source:MGI Symbol;Acc:M... [more]
Tph23.389e-4468.12tryptophan hydroxylase 2 [Source:MGI Symbol;Acc:MG... [more]
Tph11.914e-4166.67tryptophan hydroxylase 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Tyrosine hydroxylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11982|TY3H_PHASP1.316e-5145.45Tyrosine 3-monooxygenase OS=Phasianidae sp. OX=900... [more]
sp|A0A060X6Z0|TY3H_ONCMY1.974e-5175.00Tyrosine 3-monooxygenase OS=Oncorhynchus mykiss OX... [more]
sp|P18459|TY3H_DROME2.307e-5171.01Tyrosine 3-monooxygenase OS=Drosophila melanogaste... [more]
sp|P07101|TY3H_HUMAN4.554e-5171.01Tyrosine 3-monooxygenase OS=Homo sapiens OX=9606 G... [more]
sp|O42091|TY3H_ANGAN5.290e-5171.01Tyrosine 3-monooxygenase OS=Anguilla anguilla OX=7... [more]
back to top
BLAST of Tyrosine hydroxylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A6P4D33.232e-8986.32Tyrosine hydroxylase OS=Dugesia japonica OX=6161 G... [more]
F6KBQ15.479e-7398.67Tyrosine hydroxylase (Fragment) OS=Schmidtea medit... [more]
A0A1S3HUS14.394e-5854.87phenylalanine-4-hydroxylase OS=Lingula unguis OX=7... [more]
A0A091J4P84.473e-5246.85Tyrosine 3-monooxygenase OS=Egretta garzetta OX=18... [more]
A0A2R7WDF95.271e-5273.91Tyrosine 3-monooxygenase OS=Oncopeltus fasciatus O... [more]
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
th2.759e-5272.46tyrosine hydroxylase [Source:NCBI gene;Acc:1030235... [more]
th3.906e-5272.46tyrosine hydroxylase [Source:NCBI gene;Acc:1030235... [more]
th4.573e-5272.46tyrosine hydroxylase [Source:NCBI gene;Acc:1030235... [more]
pah2.224e-4465.22phenylalanine hydroxylase [Source:ZFIN;Acc:ZDB-GEN... [more]
tph23.172e-4468.12tryptophan hydroxylase 2 (tryptophan 5-monooxygena... [more]
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tph1a8.113e-4468.12tryptophan hydroxylase 1 (tryptophan 5-monooxygena... [more]
ENSPMAT00000000676.11.476e-4241.96pep scaffold:Pmarinus_7.0:GL477040:200355:204568:-... [more]
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO317451.642e-3666.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine hydroxylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
th5.231e-5369.57tyrosine hydroxylase [Source:NCBI gene;Acc:1011715... [more]
th27.166e-5172.46tyrosine 3-monooxygenase-like [Source:NCBI gene;Ac... [more]
pah1.433e-4846.02phenylalanine hydroxylase [Source:NCBI gene;Acc:10... [more]
tph26.252e-4468.12tryptophan hydroxylase 2 [Source:NCBI gene;Acc:101... [more]
tph1b1.963e-4168.12tryptophan 5-hydroxylase 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Tyrosine hydroxylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000034472.11.992e-10298.29SMESG000034472.1[more]
SMESG000077798.18.327e-4874.63SMESG000077798.1[more]
SMESG000000522.12.056e-4265.22SMESG000000522.1[more]
SMESG000000522.13.271e-4265.22SMESG000000522.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023278 ID=SMED30023278|Name=Tyrosine hydroxylase|organism=Schmidtea mediterranea sexual|type=transcript|length=779bp
TCTAAACCTCTACATACTCCAGAACCTGATTGTATTCATGAGTTGCTTGG
CCATGTTCCGGTTTTATCAGATATGGAATTTGCAGAATTTTCTCAAGAAA
TAGGCTTATGTTCATTAGGAGCATCAGATGAAGATATTGAAAGATTGGCA
ACCCTGTATTGGTTTACTGTTGAATTTGGATTATGTTACGAAGACAAAAA
ATTAAAGCATTCGGTGCAGGGCTTCTATCTTCATCCGGTGAATTACAACA
TGCTATAAGTGATGTTCCTGAACATAGAATTTTCGAGCCTCAAACTGCTT
CGATTACTCCTTATAGAGATGAAGAATATCAGCCTGTTTATTATGTTATA
GATTCTGTAACAGATATGAAAGAGAAAATGAGACAATTTGCAAAGTCAAT
TCACCGCCAAAATCCGATTCGATACGATCCTTATACAGAAACAATCGAAG
TCCTGAATAACAAGAAATCCGTTTGTCATTTAGGGAGAGTTATAAAACGT
GAGTTGGATAATATGGAGAATTCTTTGAGCTCAATGCTCACCTTTTAAAT
TAAAATCTCTGAAAATAGAAATAAATGATTTAGGATTGTGCATGTAGTGA
GTCTTAGATCATTATAGAAAATTGGTGATTTAGAAATCATATAGAAAATG
AATTACATTTGATTTTGTGATAGAATTAACTATTATGCCAAATTTCATAG
ATTTTAGATTTAATTCTGTATTGTGATAACAACATTTTTTGGTAAATTCA
CTTTTGTTTGCTTAATAAAATTATTTATT
back to top

protein sequence of SMED30023278-orf-1

>SMED30023278-orf-1 ID=SMED30023278-orf-1|Name=SMED30023278-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MLRRQKIKAFGAGLLSSSGELQHAISDVPEHRIFEPQTASITPYRDEEYQ
PVYYVIDSVTDMKEKMRQFAKSIHRQNPIRYDPYTETIEVLNNKKSVCHL
GRVIKRELDNMENSLSSMLTF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000482dopaminergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR036951ArAA_hydroxylase_sf
IPR036329Aro-AA_hydroxylase_C_sf
IPR001273ArAA_hydroxylase
IPR019774Aromatic-AA_hydroxylase_C
IPR018301ArAA_hydroxylase_Fe/CU_BS
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0009072aromatic amino acid family metabolic process
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0004497monooxygenase activity
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019774Aromatic amino acid hydroxylase, C-terminalPRINTSPR00372FYWHYDRXLASEcoord: 30..49
score: 76.52
coord: 70..86
score: 62.7
IPR019774Aromatic amino acid hydroxylase, C-terminalPFAMPF00351Biopterin_Hcoord: 1..86
e-value: 4.0E-45
score: 154.3
IPR019774Aromatic amino acid hydroxylase, C-terminalPROSITEPS51410BH4_AAA_HYDROXYL_2coord: 1..86
score: 57.334
IPR036951Aromatic amino acid hydroxylase superfamilyGENE3DG3DSA:1.10.800.10coord: 1..86
e-value: 2.5E-44
score: 153.1
IPR001273Aromatic amino acid hydroxylasePANTHERPTHR11473AROMATIC AMINO ACID HYDROXYLASEcoord: 1..86
NoneNo IPR availablePANTHERPTHR11473:SF15TYROSINE 3-MONOOXYGENASEcoord: 1..86
IPR018301Aromatic amino acid hydroxylase, iron/copper binding sitePROSITEPS00367BH4_AAA_HYDROXYL_1coord: 9..20
IPR036329Aromatic amino acid monoxygenase, C-terminal domain superfamilySUPERFAMILYSSF56534Aromatic aminoacid monoxygenases, catalytic and oligomerization domainscoord: 2..85