Casein kinase I isoform gamma-1

Overview
NameCasein kinase I isoform gamma-1
Smed IDSMED30023274
Length (bp)1675
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Casein kinase I isoform gamma-1 (SMED30023274) t-SNE clustered cells

Violin plots show distribution of expression levels for Casein kinase I isoform gamma-1 (SMED30023274) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Casein kinase I isoform gamma-1 (SMED30023274) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Casein kinase I isoform gamma-1 (SMED30023274) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023274

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v4_172_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023274SMESG000007869.1 SMESG000007858.1 SMESG000007847.1 dd_Smed_v6_172_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Human
Match: CSNK1G3 (casein kinase 1 gamma 3 [Source:HGNC Symbol;Acc:HGNC:2456])

HSP 1 Score: 489.96 bits (1260), Expect = 4.413e-170
Identity = 229/305 (75.08%), Postives = 261/305 (85.57%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +N + T  + + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   +G PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GR      +VIH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D++GY+FD E+DW
Sbjct:   24 HNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGS--GDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDW 326          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Human
Match: CSNK1G1 (casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HGNC:2454])

HSP 1 Score: 488.804 bits (1257), Expect = 1.016e-169
Identity = 228/293 (77.82%), Postives = 254/293 (86.69%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDW 328          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Human
Match: CSNK1G1 (casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HGNC:2454])

HSP 1 Score: 487.649 bits (1254), Expect = 1.043e-169
Identity = 228/294 (77.55%), Postives = 254/294 (86.39%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW 
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWV 329          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Human
Match: CSNK1G1 (casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HGNC:2454])

HSP 1 Score: 489.96 bits (1260), Expect = 1.350e-169
Identity = 228/293 (77.82%), Postives = 254/293 (86.69%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDW 328          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Human
Match: CSNK1G1 (casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HGNC:2454])

HSP 1 Score: 489.96 bits (1260), Expect = 1.350e-169
Identity = 228/293 (77.82%), Postives = 254/293 (86.69%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDW 328          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Celegans
Match: csnk-1 (Casein kinase I gamma [Source:UniProtKB/Swiss-Prot;Acc:Q8WQ99])

HSP 1 Score: 484.952 bits (1247), Expect = 8.531e-169
Identity = 224/297 (75.42%), Postives = 253/297 (85.19%), Query Frame = 1
Query:  247 NENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            N   VLMVGPNF+VGKKIGCGNFGELRLGKN+Y NEHVAIKLE  KS+APQLHLEYR+Y+LL   +AEG PQV YFGPC KYNALVMELLG SLEDLFD+C+R FSLKTV M+A+QL+ R EY H K LIYRDVKPENFL+GR S  +  V+H+ID GLAKEYI  DT KHI YREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T +E LC+G+P+ FA YLRY R +DFFETPDY++  NLF+S++D+ G  +D EFDW
Sbjct:   17 NSQGVLMVGPNFKVGKKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSKAPQLHLEYRFYKLL--GQAEGLPQVHYFGPCGKYNALVMELLGHSLEDLFDLCDRHFSLKTVAMVAMQLIRRIEYVHTKHLIYRDVKPENFLIGRYSTRKQHVLHIIDFGLAKEYIDCDTGKHIAYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRQTAVEVLCEGFPDEFAQYLRYARRLDFFETPDYDFCYNLFKSVLDRLGATYDYEFDW 311          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 333.954 bits (855), Expect = 3.135e-111
Identity = 164/292 (56.16%), Postives = 218/292 (74.66%), Query Frame = 1
Query:  262 LMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            L VG  FR+G+KIG G+FG++ LG+NI TNE VA+KLE  KS+ PQLH+E R Y+++      G P++ + G    YN +VMELLGPSLEDLF+ C+R+FSLKTVL++A Q+L R E+ H +  I+RD+KP+NFL+G     +  ++++ID GLAK Y  S  Q HI YRE+K+LTGTARY SINTH G EQSRRDD+E+LG++FMYF RG+LPWQGLKA T +++Y+ I E K +TR++DLC GYPEAFA YL Y R + F E PDY Y+RNLFR+L  ++ + +D  FDW
Sbjct:    3 LRVGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLG--GIGIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLGK--RGNLVYIIDFGLAKRYRDSKHQ-HIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDW 289          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 333.954 bits (855), Expect = 3.135e-111
Identity = 164/292 (56.16%), Postives = 218/292 (74.66%), Query Frame = 1
Query:  262 LMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            L VG  FR+G+KIG G+FG++ LG+NI TNE VA+KLE  KS+ PQLH+E R Y+++      G P++ + G    YN +VMELLGPSLEDLF+ C+R+FSLKTVL++A Q+L R E+ H +  I+RD+KP+NFL+G     +  ++++ID GLAK Y  S  Q HI YRE+K+LTGTARY SINTH G EQSRRDD+E+LG++FMYF RG+LPWQGLKA T +++Y+ I E K +TR++DLC GYPEAFA YL Y R + F E PDY Y+RNLFR+L  ++ + +D  FDW
Sbjct:    3 LRVGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLG--GIGIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLGK--RGNLVYIIDFGLAKRYRDSKHQ-HIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDW 289          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 334.339 bits (856), Expect = 3.865e-111
Identity = 164/292 (56.16%), Postives = 218/292 (74.66%), Query Frame = 1
Query:  262 LMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            L VG  FR+G+KIG G+FG++ LG+NI TNE VA+KLE  KS+ PQLH+E R Y+++      G P++ + G    YN +VMELLGPSLEDLF+ C+R+FSLKTVL++A Q+L R E+ H +  I+RD+KP+NFL+G     +  ++++ID GLAK Y  S  Q HI YRE+K+LTGTARY SINTH G EQSRRDD+E+LG++FMYF RG+LPWQGLKA T +++Y+ I E K +TR++DLC GYPEAFA YL Y R + F E PDY Y+RNLFR+L  ++ + +D  FDW
Sbjct:    3 LRVGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLG--GIGIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMG--LGKRGNLVYIIDFGLAKRYRDSKHQ-HIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDW 289          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Celegans
Match: kin-20 (Casein kinase I isoform delta [Source:UniProtKB/Swiss-Prot;Acc:Q20471])

HSP 1 Score: 333.183 bits (853), Expect = 6.482e-111
Identity = 164/292 (56.16%), Postives = 218/292 (74.66%), Query Frame = 1
Query:  262 LMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            L VG  FR+G+KIG G+FG++ LG+NI TNE VA+KLE  KS+ PQLH+E R Y+++      G P++ + G    YN +VMELLGPSLEDLF+ C+R+FSLKTVL++A Q+L R E+ H +  I+RD+KP+NFL+G     +  ++++ID GLAK Y  S  Q HI YRE+K+LTGTARY SINTH G EQSRRDD+E+LG++FMYF RG+LPWQGLKA T +++Y+ I E K +TR++DLC GYPEAFA YL Y R + F E PDY Y+RNLFR+L  ++ + +D  FDW
Sbjct:    3 LRVGNRFRLGRKIGSGSFGDIYLGQNIQTNEEVAVKLECVKSKHPQLHIESRLYRIMLG--GIGIPEIRWCGQEGDYNVMVMELLGPSLEDLFNFCQRKFSLKTVLLLADQMLSRVEFIHCRDYIHRDIKPDNFLMGLGK--RGNLVYIIDFGLAKRYRDSKHQ-HIAYRENKNLTGTARYASINTHRGIEQSRRDDIESLGYVFMYFNRGTLPWQGLKAVTKRQKYELISEKKISTRVDDLCAGYPEAFAQYLNYCRSLGFEEQPDYGYLRNLFRTLFHRQQFCYDYVFDW 289          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0083265)

HSP 1 Score: 503.827 bits (1296), Expect = 2.480e-175
Identity = 230/306 (75.16%), Postives = 265/306 (86.60%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            Y+ + ++     VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL +  AEG P+V+YFGPC KYNALVMELLGPSLEDLFDIC R+F+LK+VL+IAIQLL+R EY H + LIYRDVKPENFL+GR S  + ++IH+ID GLAKEYI  DT +HIPYREHKSLTGTARYMSINTHMG+EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LCDG+PE FATYLRYVR +DFFETPDY+++R LF+ L D++GY  + EFDW 
Sbjct:   43 YSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGS-HAEGVPEVYYFGPCGKYNALVMELLGPSLEDLFDICGRRFTLKSVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT 347          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0083263)

HSP 1 Score: 501.516 bits (1290), Expect = 6.301e-175
Identity = 230/306 (75.16%), Postives = 265/306 (86.60%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            Y+ + ++     VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL +  AEG P+V+YFGPC KYNALVMELLGPSLEDLFDIC R+F+LK+VL+IAIQLL+R EY H + LIYRDVKPENFL+GR S  + ++IH+ID GLAKEYI  DT +HIPYREHKSLTGTARYMSINTHMG+EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LCDG+PE FATYLRYVR +DFFETPDY+++R LF+ L D++GY  + EFDW 
Sbjct:    2 YSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGS-HAEGVPEVYYFGPCGKYNALVMELLGPSLEDLFDICGRRFTLKSVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT 306          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0100331)

HSP 1 Score: 476.093 bits (1224), Expect = 5.392e-166
Identity = 223/310 (71.94%), Postives = 261/310 (84.19%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLL--QTDRA-EGFPQVFYFGPCD-KYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            Y+ + ++     VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL    D A +G P++++ G C  +YNA+V+ELLG SLEDLF+IC R+FSLKTVLMIA QLL+R EY H + LIYRDVKPENFL+GR S  + ++IH+ID GLAKEYI  DT +HIPYREHKSLTGTARYMSINTHMG+EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LCDG+PE FATYLRYVR +DFFETPDY+++R LF+ L D++GY  + EFDW 
Sbjct:   43 YSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT 352          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0301304)

HSP 1 Score: 480.33 bits (1235), Expect = 8.484e-166
Identity = 223/310 (71.94%), Postives = 261/310 (84.19%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLL--QTDRA-EGFPQVFYFGPCD-KYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            Y+ + ++     VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL    D A +G P++++ G C  +YNA+V+ELLG SLEDLF+IC R+FSLKTVLMIA QLL+R EY H + LIYRDVKPENFL+GR S  + ++IH+ID GLAKEYI  DT +HIPYREHKSLTGTARYMSINTHMG+EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LCDG+PE FATYLRYVR +DFFETPDY+++R LF+ L D++GY  + EFDW 
Sbjct:   43 YSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT 352          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Fly
Match: gish (gene:FBgn0250823 transcript:FBtr0083262)

HSP 1 Score: 479.945 bits (1234), Expect = 8.499e-166
Identity = 223/310 (71.94%), Postives = 261/310 (84.19%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLL--QTDRA-EGFPQVFYFGPCD-KYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            Y+ + ++     VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL    D A +G P++++ G C  +YNA+V+ELLG SLEDLF+IC R+FSLKTVLMIA QLL+R EY H + LIYRDVKPENFL+GR S  + ++IH+ID GLAKEYI  DT +HIPYREHKSLTGTARYMSINTHMG+EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LCDG+PE FATYLRYVR +DFFETPDY+++R LF+ L D++GY  + EFDW 
Sbjct:   43 YSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT 352          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Zebrafish
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 491.115 bits (1263), Expect = 9.481e-171
Identity = 228/293 (77.82%), Postives = 256/293 (87.37%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGEL+LGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +  A+G PQVFYFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GRQ   +  +IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+RNLF  L D++GY FD  +DW
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGS--ADGLPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRNLFTELFDRKGYAFDYSYDW 327          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Zebrafish
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 492.271 bits (1266), Expect = 1.303e-170
Identity = 228/294 (77.55%), Postives = 256/294 (87.07%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGEL+LGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +  A+G PQVFYFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GRQ   +  +IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+RNLF  L D++GY FD  +DW 
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGS--ADGLPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRNLFTELFDRKGYAFDYSYDWV 328          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Zebrafish
Match: csnk1g2b (casein kinase 1, gamma 2b [Source:ZFIN;Acc:ZDB-GENE-060825-285])

HSP 1 Score: 488.034 bits (1255), Expect = 3.047e-169
Identity = 226/294 (76.87%), Postives = 253/294 (86.05%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q   +EG PQVFYFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R E+ H + LIYRDVKPENFL+GR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L D+ G++FD E+DW 
Sbjct:   36 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYK--QLGNSEGVPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLMGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFERPDYEYLRKLFTDLFDRNGFVFDFEYDWV 327          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Zebrafish
Match: csnk1g2b (casein kinase 1, gamma 2b [Source:ZFIN;Acc:ZDB-GENE-060825-285])

HSP 1 Score: 486.108 bits (1250), Expect = 6.681e-169
Identity = 226/293 (77.13%), Postives = 253/293 (86.35%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q   +EG PQVFYFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R E+ H + LIYRDVKPENFL+GR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L D+ G++FD E+DW
Sbjct:   36 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYK--QLGNSEGVPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLMGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFERPDYEYLRKLFTDLFDRNGFVFDFEYDW 326          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Zebrafish
Match: csnk1g2a (casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6445])

HSP 1 Score: 486.108 bits (1250), Expect = 7.676e-169
Identity = 230/305 (75.41%), Postives = 256/305 (83.93%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            + G     N   VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q   AEG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R E+ H + LIYRDVKPENFLVGR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L D+ GY+FD E+DW
Sbjct:   31 HGGSRGSGNNTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYK--QLGNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPGTKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPE-MATYLRYVRRLDFFERPDYEYLRKLFTDLFDRNGYVFDYEYDW 332          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 491.886 bits (1265), Expect = 1.338e-170
Identity = 228/305 (74.75%), Postives = 261/305 (85.57%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +N + T  + + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   +G PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GR      ++IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D++GY+FD E+DW
Sbjct:   26 HNTRGTGSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGS--GDGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDW 328          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 491.5 bits (1264), Expect = 1.787e-170
Identity = 228/305 (74.75%), Postives = 261/305 (85.57%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +N + T  + + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   +G PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GR      ++IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D++GY+FD E+DW
Sbjct:   24 HNTRGTGSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGS--GDGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDW 326          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 490.345 bits (1261), Expect = 2.935e-170
Identity = 228/305 (74.75%), Postives = 260/305 (85.25%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +N + T  + + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q    +G PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GR      ++IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D++GY+FD E+DW
Sbjct:   24 HNTRGTGSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYK--QLGSGDGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDW 326          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 490.73 bits (1262), Expect = 4.372e-170
Identity = 228/305 (74.75%), Postives = 261/305 (85.57%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +N + T  + + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   +G PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GR      ++IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D++GY+FD E+DW
Sbjct:   24 HNTRGTGSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGS--GDGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDW 326          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Xenopus
Match: sap30 (Sin3A associated protein 30kDa [Source:Xenbase;Acc:XB-GENE-942260])

HSP 1 Score: 489.574 bits (1259), Expect = 7.659e-170
Identity = 228/305 (74.75%), Postives = 261/305 (85.57%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +N + T  + + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   +G PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GR      ++IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D++GY+FD E+DW
Sbjct:   16 HNTRGTGSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGS--GDGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKNQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDW 318          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Mouse
Match: Csnk1g2 (casein kinase 1, gamma 2 [Source:MGI Symbol;Acc:MGI:1920014])

HSP 1 Score: 489.96 bits (1260), Expect = 2.574e-170
Identity = 229/305 (75.08%), Postives = 257/305 (84.26%), Query Frame = 1
Query:  226 NGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            +G  +    + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L T   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQL+ R EY H K LIYRDVKPENFLVGR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D+ GY+FD E+DW 
Sbjct:   28 HGVRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLST--TEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHSIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGYVFDYEYDWA 330          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Mouse
Match: Csnk1g1 (casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MGI:2660884])

HSP 1 Score: 490.73 bits (1262), Expect = 5.222e-170
Identity = 227/294 (77.21%), Postives = 254/294 (86.39%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEY+  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW 
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWV 329          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Mouse
Match: Csnk1g1 (casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MGI:2660884])

HSP 1 Score: 488.034 bits (1255), Expect = 6.034e-170
Identity = 227/294 (77.21%), Postives = 254/294 (86.39%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEY+  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW 
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDWV 329          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Mouse
Match: Csnk1g1 (casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MGI:2660884])

HSP 1 Score: 490.345 bits (1261), Expect = 6.261e-170
Identity = 227/293 (77.47%), Postives = 254/293 (86.69%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEY+  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW 328          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Mouse
Match: Csnk1g1 (casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MGI:2660884])

HSP 1 Score: 490.345 bits (1261), Expect = 6.261e-170
Identity = 227/293 (77.47%), Postives = 254/293 (86.69%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEY+  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYVDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW 328          
BLAST of Casein kinase I isoform gamma-1 vs. UniProt/SwissProt
Match: sp|Q5PRD4|KC1G1_DANRE (Casein kinase I isoform gamma-1 OS=Danio rerio OX=7955 GN=csnk1g1 PE=2 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 7.157e-170
Identity = 228/293 (77.82%), Postives = 256/293 (87.37%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGEL+LGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +  A+G PQVFYFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GRQ   +  +IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+RNLF  L D++GY FD  +DW
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGS--ADGLPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRNLFTELFDRKGYAFDYSYDW 327          
BLAST of Casein kinase I isoform gamma-1 vs. UniProt/SwissProt
Match: sp|A7E3X2|KC1G1_BOVIN (Casein kinase I isoform gamma-1 OS=Bos taurus OX=9913 GN=CSNK1G1 PE=2 SV=1)

HSP 1 Score: 491.886 bits (1265), Expect = 1.221e-169
Identity = 231/320 (72.19%), Postives = 262/320 (81.88%), Query Frame = 1
Query:  178 DNLKHVNNMQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            D  +       Q  E+  + +    + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW
Sbjct:    9 DERQRTTKPMAQRREHCSRPSGSTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW 327          
BLAST of Casein kinase I isoform gamma-1 vs. UniProt/SwissProt
Match: sp|Q62761|KC1G1_RAT (Casein kinase I isoform gamma-1 OS=Rattus norvegicus OX=10116 GN=Csnk1g1 PE=2 SV=1)

HSP 1 Score: 489.189 bits (1258), Expect = 1.515e-169
Identity = 228/294 (77.55%), Postives = 255/294 (86.73%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR+T IE LC+ +PE   TYLRYVR +DFFE PDYEY+RNLF  L +++GY FD  +DW 
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRSTPIEALCENFPEEMMTYLRYVRRLDFFEKPDYEYLRNLFTDLFERKGYTFDYAYDWV 329          
BLAST of Casein kinase I isoform gamma-1 vs. UniProt/SwissProt
Match: sp|Q4R9A9|KC1G1_MACFA (Casein kinase I isoform gamma-1 OS=Macaca fascicularis OX=9541 GN=CSNK1G1 PE=2 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 1.685e-169
Identity = 228/294 (77.55%), Postives = 254/294 (86.39%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQLL R EY H K LIYRDVKPENFL+GRQ   +  VIH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW 
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSA-GEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWV 329          
BLAST of Casein kinase I isoform gamma-1 vs. UniProt/SwissProt
Match: sp|Q8BVP5|KC1G2_MOUSE (Casein kinase I isoform gamma-2 OS=Mus musculus OX=10090 GN=Csnk1g2 PE=1 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 1.801e-169
Identity = 229/305 (75.08%), Postives = 257/305 (84.26%), Query Frame = 1
Query:  226 NGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            +G  +    + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L T   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R F+LKTVLMIAIQL+ R EY H K LIYRDVKPENFLVGR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D+ GY+FD E+DW 
Sbjct:   28 HGVRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLST--TEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHSIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGYVFDYEYDWA 330          
BLAST of Casein kinase I isoform gamma-1 vs. TrEMBL
Match: A0A1I8NRP5 (Protein kinase domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106083592 PE=3 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 3.075e-173
Identity = 232/306 (75.82%), Postives = 266/306 (86.93%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            Y+ + ++     VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL +  AEG P+V+YFGPC KYNALVMELLGPSLEDLFDIC R+F+LKTVL+IAIQLL+R EY H + LIYRDVKPENFL+GR S  + ++IH+ID GLAKEYI  DT +HIPYREHKSLTGTARYMSINTHMG+EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LCDG+PE FATYLRYVR +DFFETPDY+++R LF+ L D++GY+ D EFDW 
Sbjct:    2 YSARQSVSTSTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGS-HAEGVPEVYYFGPCGKYNALVMELLGPSLEDLFDICGRRFTLKTVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTRREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYVDDGEFDWT 306          
BLAST of Casein kinase I isoform gamma-1 vs. TrEMBL
Match: N6UKM0 (Protein kinase domain-containing protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=YQE_02391 PE=3 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 7.181e-173
Identity = 233/306 (76.14%), Postives = 267/306 (87.25%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            +N ++++ N + VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL +   EG P+V+YFGPC KYNALVMELLGPSLEDLFD+C+R+FSLKTVLMIAIQLL+R EY H + LIYRDVKPENFL+GRQS  + ++IH+ID GLAKEYI S+T KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T I+ LC+ +PE  ATYLRYVR +DFFE PDYEY+RNLF SL  ++GY  D EFDW 
Sbjct:   33 HNARHSV-NSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSH--EGIPEVYYFGPCGKYNALVMELLGPSLEDLFDLCDRKFSLKTVLMIAIQLLHRIEYVHTRHLIYRDVKPENFLIGRQSTKREKIIHIIDFGLAKEYIESETNKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATTIDTLCENHPEEMATYLRYVRRLDFFEMPDYEYLRNLFTSLFKKKGYADDGEFDWT 335          
BLAST of Casein kinase I isoform gamma-1 vs. TrEMBL
Match: U4TYR5 (Protein kinase domain-containing protein OS=Dendroctonus ponderosae OX=77166 GN=D910_02590 PE=3 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 8.405e-173
Identity = 233/306 (76.14%), Postives = 267/306 (87.25%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            +N ++++ N + VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL +   EG P+V+YFGPC KYNALVMELLGPSLEDLFD+C+R+FSLKTVLMIAIQLL+R EY H + LIYRDVKPENFL+GRQS  + ++IH+ID GLAKEYI S+T KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T I+ LC+ +PE  ATYLRYVR +DFFE PDYEY+RNLF SL  ++GY  D EFDW 
Sbjct:   33 HNARHSV-NSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSH--EGIPEVYYFGPCGKYNALVMELLGPSLEDLFDLCDRKFSLKTVLMIAIQLLHRIEYVHTRHLIYRDVKPENFLIGRQSTKREKIIHIIDFGLAKEYIESETNKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATTIDTLCENHPEEMATYLRYVRRLDFFEMPDYEYLRNLFTSLFKKKGYADDGEFDWT 335          
BLAST of Casein kinase I isoform gamma-1 vs. TrEMBL
Match: A0A034VW15 (Casein kinase I isoform gamma-1 OS=Bactrocera dorsalis OX=27457 GN=KC1G1 PE=3 SV=1)

HSP 1 Score: 500.36 bits (1287), Expect = 9.160e-173
Identity = 233/305 (76.39%), Postives = 264/305 (86.56%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            Y  +  +     VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL +  AEG P+V+YFGPC KYNALVMELLGPSLEDLFDIC R+F+LKTVL+IAIQLL+R EY H + LIYRDVKPENFL+GR S  + ++IH+ID GLAKEYI  DT +HIPYREHKSLTGTARYMSINTHMG+EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LCDG+PE FATYLRYVR +DFFETPDYE++R LF+ L D++GY+ D EFDW
Sbjct:    2 YATRQAVGASTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGS-HAEGVPEVYYFGPCGKYNALVMELLGPSLEDLFDICGRRFTLKTVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTRREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYEFLRRLFQDLFDRKGYVDDGEFDW 305          
BLAST of Casein kinase I isoform gamma-1 vs. TrEMBL
Match: A0A034VW20 (Casein kinase I isoform gamma-1 OS=Bactrocera dorsalis OX=27457 GN=KC1G1 PE=3 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 9.426e-173
Identity = 233/305 (76.39%), Postives = 264/305 (86.56%), Query Frame = 1
Query:  223 YNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            Y  +  +     VLMVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIK+E  KS+APQLHLEYR+Y+LL +  AEG P+V+YFGPC KYNALVMELLGPSLEDLFDIC R+F+LKTVL+IAIQLL+R EY H + LIYRDVKPENFL+GR S  + ++IH+ID GLAKEYI  DT +HIPYREHKSLTGTARYMSINTHMG+EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LCDG+PE FATYLRYVR +DFFETPDYE++R LF+ L D++GY+ D EFDW
Sbjct:    2 YATRQAVGASTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGS-HAEGVPEVYYFGPCGKYNALVMELLGPSLEDLFDICGRRFTLKTVLLIAIQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTRREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYEFLRRLFQDLFDRKGYVDDGEFDW 305          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Cavefish
Match: csnk1g2b (casein kinase 1 gamma 2 [Source:NCBI gene;Acc:103042572])

HSP 1 Score: 492.271 bits (1266), Expect = 6.827e-171
Identity = 228/294 (77.55%), Postives = 253/294 (86.05%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q   +EG PQVFYFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H + LIYRDVKPENFLVGR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D+ GY+FD E+DW 
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYK--QLGNSEGIPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRAFSLKTVLMIAIQLITRMEYVHTRSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEELATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRNGYVFDYEYDWV 328          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Cavefish
Match: csnk1g1 (casein kinase 1 gamma 1 [Source:NCBI gene;Acc:103023720])

HSP 1 Score: 491.5 bits (1264), Expect = 1.304e-170
Identity = 227/294 (77.21%), Postives = 255/294 (86.73%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGEL+LGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +  AEG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GRQ   +  +IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW 
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGST-AEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTELFERKGYTFDYTYDWV 329          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Cavefish
Match: csnk1g2b (casein kinase 1 gamma 2 [Source:NCBI gene;Acc:103042572])

HSP 1 Score: 489.96 bits (1260), Expect = 1.401e-170
Identity = 228/293 (77.82%), Postives = 253/293 (86.35%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q   +EG PQVFYFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H + LIYRDVKPENFLVGR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D+ GY+FD E+DW
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYK--QLGNSEGIPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRAFSLKTVLMIAIQLITRMEYVHTRSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEELATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRNGYVFDYEYDW 327          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Cavefish
Match: csnk1g1 (casein kinase 1 gamma 1 [Source:NCBI gene;Acc:103023720])

HSP 1 Score: 490.345 bits (1261), Expect = 3.117e-170
Identity = 227/294 (77.21%), Postives = 255/294 (86.73%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGEL+LGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +  AEG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GRQ   +  +IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW 
Sbjct:   37 VLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGST-AEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTELFERKGYTFDYTYDWV 329          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Cavefish
Match: CSNK1G1 (casein kinase I-like [Source:NCBI gene;Acc:103043194])

HSP 1 Score: 488.804 bits (1257), Expect = 5.261e-170
Identity = 226/294 (76.87%), Postives = 254/294 (86.39%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VLMVGPNFRVGKKIGCGNFGEL+LGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +   EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GRQ   +  +IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW 
Sbjct:   34 VLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGST-VEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGSKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTELFERKGYTFDYTYDWV 326          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Sea Lamprey
Match: csnk1g2a (casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6445])

HSP 1 Score: 495.738 bits (1275), Expect = 2.223e-173
Identity = 233/293 (79.52%), Postives = 257/293 (87.71%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q   AEG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C R F+LKTVLMIAIQLL R EY H + LIYRDVKPENFL+GRQS N+  +IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEYMRNLF  L +++GY FD EFDW
Sbjct:   31 VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYK--QLGNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCNRTFTLKTVLMIAIQLLTRMEYVHSRNLIYRDVKPENFLIGRQSTNKQHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFERPDYEYMRNLFMDLFERKGYSFDYEFDW 321          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Sea Lamprey
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 384.03 bits (985), Expect = 2.868e-132
Identity = 180/222 (81.08%), Postives = 199/222 (89.64%), Query Frame = 1
Query:  253 NTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLK 918
            + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q   AEG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIA+QL+ R EY H + LIYRDVKPENFLVGRQ  ++H  IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLK
Sbjct:   23 SGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYK--QLGNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAMQLISRMEYVHSRSLIYRDVKPENFLVGRQGTSKHHNIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLK 242          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008477.1 (pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gene:ENSPMAG00000007664.1 transcript:ENSPMAT00000008477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.102 bits (845), Expect = 1.899e-109
Identity = 161/293 (54.95%), Postives = 215/293 (73.38%), Query Frame = 1
Query:  262 LMVGPNFRVGKKIGCGNFGELRL-GKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            L +G  +R+G+KIG G+FG++ L G NI T E VAIKLE  K++ PQLH+E + Y+LLQ     G P + + G    YN +VMELLGPS+EDLF+ C R+FSLKTVL++A Q++ R EY H K  I+RD+KP+NFL+G     +  ++++IDLGLAK+Y  S T +HIPYRE+K+LTGTARY SINTH+G EQSRRDDLE+LG++ MYF  GSLPWQGLKA T +++Y++I E K +T IE LC  YP  FATYL + R + F + PDY Y+R LFR+L  ++G+ +D  FDW
Sbjct:    3 LRIGNKYRLGRKIGSGSFGDIYLVGTNIATGEEVAIKLECVKTKHPQLHIESKIYKLLQG--GVGIPVIKWCGAEGDYNVMVMELLGPSMEDLFNFCSRKFSLKTVLLLADQMISRIEYLHSKNFIHRDIKPDNFLMGLG--KKGNLVYIIDLGLAKKYRDSRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEMLCKTYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDW 291          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001691.1 (pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1 gene:ENSPMAG00000001522.1 transcript:ENSPMAT00000001691.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.675 bits (509), Expect = 1.159e-61
Identity = 100/193 (51.81%), Postives = 137/193 (70.98%), Query Frame = 1
Query:  262 LMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVG-RQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQ 837
             +VG  +R+ +KIG G+FG++ L  NI   E VA+KLE  K+R PQL  E + Y++LQ     G P + ++G    YN LVM+LLGPSLEDLF+ C R+F++KTVLM+A Q++ R EY H K  I+RD+KP+NFL+G  + CN+   + +ID GLAK+Y  + T++HIPYRE K+LTGTARY SIN H+G EQ
Sbjct:   11 FIVGGKYRLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQG--GVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGIGRHCNK---LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQ 198          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004926.1 (pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gene:ENSPMAG00000004461.1 transcript:ENSPMAT00000004926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 1.226e-31
Identity = 75/222 (33.78%), Postives = 112/222 (50.45%), Query Frame = 1
Query:  475 GPCDKYNALVMELLGPSLEDLFDICER-QFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            G  DK+N +VM+L G +L DL     R  FSL T L +  Q+L   E  H    ++RD+KP NF +GR     H+   M+D GLA++Y +S  +   P R      GT RY SIN H  KE  R DDL +L +M + F  G LPW+ +K        +++G +K       L    P  F  +L +V  +D+   P+Y+ + +    +M +R    +  +DW
Sbjct:   11 GRNDKFNYVVMQLQGRNLADLRRSQPRGTFSLSTTLRLGRQMLEAIESIHAVGFLHRDIKPSNFAMGRLPSTTHKCF-MLDYGLARQYTNSSGEVRPP-RAVAGFRGTVRYASINAHRNKEMGRHDDLWSLFYMLVEFTVGQLPWRKIKDK------EQVGLIKERYDHRLLLRHMPTDFHIFLDHVSTLDYCTRPNYQSIHSCALHIMRERSITENEPYDW 224          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Yeast
Match: YCK2 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck1p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK2 has a paralog, YCK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005098])

HSP 1 Score: 328.946 bits (842), Expect = 1.279e-106
Identity = 158/291 (54.30%), Postives = 203/291 (69.76%), Query Frame = 1
Query:  265 MVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +VG ++++GKKIG G+FG L  G N+     VAIK E  K+ APQL  EYR Y++L      G PQ +YFG    +N LV++LLGPSLEDLFD C R+FS+KTV+ +A+Q++   E  H   LIYRD+KP+NFL+GR        +H+ID G+AK+Y    T++HIPYRE KSL+GTARYMSINTH+G+EQSRRDD+EA+GH+F YFLRG LPWQGLKA   K++Y+KIGE KR T + DL  G P  F  YL  VR + F ETPDYE  R L  S++D  G   D ++DW
Sbjct:   71 IVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAG--TPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDW 359          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Yeast
Match: YCK1 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck2p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK1 has a paralog, YCK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001177])

HSP 1 Score: 323.939 bits (829), Expect = 6.856e-105
Identity = 156/291 (53.61%), Postives = 202/291 (69.42%), Query Frame = 1
Query:  265 MVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +VG ++++GKKIG G+FG L  G N+     VAIK E  K+ APQL  EY+ Y++L  +     P  +YFG    +N LV++LLGPSLEDLFD C R+FS+KTV+ +A+Q++   E  H   LIYRD+KP+NFL+GR        IH+ID G+AK+Y    T++HIPYRE KSL+GTARYMSINTH+G+EQSRRDD+EALGH+F YFLRG LPWQGLKA   K++Y+KIGE KR+T + DL  G P  F  YL  VR + F E PDYE  R L  S++D  G   D ++DW
Sbjct:   64 IVGLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKIL--NGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDW 352          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Yeast
Match: HRR25 (Conserved casein kinase; regulates diverse events including: vesicular traffic, DNA repair, the CVT pathway, monopolar attachment of sister kinetochores at meiosis I, and ribosomal subunit biogenesis; monopolin subunit; binds the RNAPII CTD; phosphorylates COPII coat subunits; interacts with Sit4p phosphatase; antagonizes calcineurin signaling, reducing nuclear accumulation of Crz1p; phosphorylates Dsn1p, the kinetochore receptor for monopolin; homolog of mammalian CK1delta [Source:SGD;Acc:S000006125])

HSP 1 Score: 306.605 bits (784), Expect = 1.039e-98
Identity = 150/295 (50.85%), Postives = 203/295 (68.81%), Query Frame = 1
Query:  262 LMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFL--VGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            L VG  FR+G+KIG G+FG++  G N+ + E VAIKLE  +SR PQL  E R Y+ L      G P + +FG   +YNA+V++LLGPSLEDLF+ C R+FS KTV+M+A+Q+  R +Y H +  I+RD+KP+NFL  VGR+       +H+ID GL+K+Y   +T +HIPYRE+KSLTGTARY S+NTH+G EQSRRDDLE+LG++ +YF +GSLPWQGLKA T K++Y +I E K    +E LC G P  F  Y+ Y + + F E PDY ++  LF+ L  +  Y  D+ FDW 
Sbjct:    3 LRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSG--GVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSFIHRDIKPDNFLMGVGRRGS----TVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETLCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWT 291          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Yeast
Match: YCK3 (Palmitoylated vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of Vps41p; shares essential functions with Hrr25p; regulates vesicle fusion in AP-3 pathway [Source:SGD;Acc:S000000925])

HSP 1 Score: 285.804 bits (730), Expect = 2.369e-90
Identity = 153/334 (45.81%), Postives = 204/334 (61.08%), Query Frame = 1
Query:  241 MYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIY-----------------TNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGR-----------QSC-----NQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLC--DGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            M   ++  +VG ++ VG KIG G+FG +  G+NI                   NE VAIK E   S APQL  E+R Y++L  +   G P  +YFG    +N L+++LLGPSLEDLF+ C R+FS+KT  M+A Q++ R    H   LIYRD+KP+NFL+ +           +SC     N   +I+M+D G+AK+Y    T++HIPYRE KSL+GTARYMSINTH G+EQSRRDDLE+LGH+F YFLRGSLPWQGLKA   K +Y+KIG  K+    +DL   +  P  FATYL+Y R + F E PDY+Y+ +L    +       D  +DW
Sbjct:    1 MSQRSSQHIVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKFEPRHSDAPQLRDEFRAYRIL--NGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRKFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDYDYLISLMDDALRLNDLKDDGHYDW 332          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 67.0106 bits (162), Expect = 2.427e-12
Identity = 50/159 (31.45%), Postives = 78/159 (49.06%), Query Frame = 1
Query:  277 NFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKS---RAPQLHLEYRYYQLLQTDRAEGFPQVF----YFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKE 732
            N+  G+ +G G+FG +R  + + TNE VAIK+   K+      QL + Y    +LQ       P +     +F   DK+  +     G  L D   +   +F+    + I +Q+L   EY H K +++RD+KPEN L   +S N   VI   D G+AK+
Sbjct:   46 NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQK---LSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRI-LSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVI--ADFGIAKQ 198          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Nematostella
Match: EDO34289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPP6])

HSP 1 Score: 497.278 bits (1279), Expect = 3.823e-173
Identity = 229/294 (77.89%), Postives = 257/294 (87.41%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            V+MVGPNFRVGKKIGCGNFGELRLGKN+Y NEHVAIKLE  KSRAPQLHLEYR+Y+ L    AEG PQV YFGPC KYNALVMELLGPSLEDLFD+C RQFSLKTVLM+A+QL+ R EY H K +IYRD+KPENFL+GR+S  + + I++ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFETPDYEY+R LFR LM+++GY+ D EFDW 
Sbjct:   39 VMMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSRAPQLHLEYRFYKALGN--AEGIPQVHYFGPCGKYNALVMELLGPSLEDLFDLCNRQFSLKTVLMVALQLISRIEYVHSKNMIYRDIKPENFLIGRKSAGKEKTINIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENHPEEMATYLRYVRRLDFFETPDYEYLRKLFRDLMERKGYVEDFEFDWT 330          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Nematostella
Match: EDO34742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG2])

HSP 1 Score: 330.487 bits (846), Expect = 9.355e-109
Identity = 159/292 (54.45%), Postives = 213/292 (72.95%), Query Frame = 1
Query:  262 LMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            L VG  +R+G+KIG G+FG++ LG +I T E VAIKLE  K++ PQLH+E ++Y+++Q     G P + + G    YN LVMELLGPSLEDLF+ C R+FS+KTVL++A Q + R EY H K  I+RD+KP+NFL+G     +  ++++ID GLAK+Y    T +HIPYRE+K+LTGTARY SINTH+G EQSRRDDLE+LG++ MYF  GSLPWQGLKA T +++Y++I E K +T IE LC G+P  FATYL   R + F + PDY Y+R LFR+L  ++GY +D  FDW
Sbjct:    3 LRVGNKYRLGRKIGSGSFGDIYLGTSISTGEEVAIKLECVKTKHPQLHIEAKFYKMMQG--GVGIPTIKWCGTEGDYNVLVMELLGPSLEDLFNFCNRKFSIKTVLLLADQTISRIEYVHSKNFIHRDIKPDNFLMG--LGKKGNLVYIIDFGLAKKYRDPRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGFPSEFATYLNNCRSLRFDDKPDYSYLRQLFRNLFHRQGYTYDYVFDW 290          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Nematostella
Match: EDO46523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ6])

HSP 1 Score: 322.013 bits (824), Expect = 3.270e-106
Identity = 160/292 (54.79%), Postives = 205/292 (70.21%), Query Frame = 1
Query:  268 VGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVG-RQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
            VG  +R+ +KIG G+FG++ L  N    E VA+KLE  K+R PQL  E + Y++LQ     G P V Y+G    YN LVMELLGPSLEDLF+ C R+F++KTVLM+A Q++ R EY H K  I+RD+KP+NFL+G  + CN+   + +ID GLAK+Y  S T++HIPYRE K+LTGTARY SIN H+G EQSRRDD+E+LG++ MYF R SLPWQGLKA T K++Y+KI E K +T +E LC G+P  FA YL Y RG+ F E PDY Y+R LFR L     Y +D  FDW 
Sbjct:   15 VGGKYRLVRKIGSGSFGDIYLAINTTNGEEVAVKLESQKARHPQLLYESKLYKILQG--GVGIPSVRYYGQERDYNVLVMELLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGVGKHCNK---LFLIDFGLAKKYRDSRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNYQYDYIFDWT 301          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Nematostella
Match: EDO48738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM1])

HSP 1 Score: 299.286 bits (765), Expect = 1.746e-97
Identity = 149/300 (49.67%), Postives = 205/300 (68.33%), Query Frame = 1
Query:  241 MYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVG-RQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            M    +  +V   +R+ +KIG G+FG++ L  +    E  A+KLE  K+R PQL  E + Y++L      G P + +F   + YN LVM+LLGPSLEDLF+ C R+F++KTVLM+A Q++ R EY H K  I+RD+KP+NFL+G  + CN+   +++ID GLAK+Y  S T++HI YRE K+LTGTARY SIN H+G EQSRRDD+E+LG++ MYF R +LPWQGLKA T K++Y+KI E K +T +E LC G+P  F+ YL Y +G+ F E PDY Y+R LFR L     + +D  FDW
Sbjct:    1 MSTPKSEFIVQGKYRLVRKIGSGSFGDIYLCVHTENGEEKAVKLESQKARHPQLLYESKLYKILAG--GSGIPAIRHFSQENDYNVLVMDLLGPSLEDLFNFCNRKFNMKTVLMLADQMIARIEYVHNKNFIHRDIKPDNFLMGIGRHCNK---LYLIDFGLAKKYRDSRTKQHISYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRSNLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFSMYLNYCKGLRFEEAPDYMYLRQLFRILFRTLNHQYDYIFDW 295          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Nematostella
Match: EDO46789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP40])

HSP 1 Score: 130.954 bits (328), Expect = 4.293e-34
Identity = 81/279 (29.03%), Postives = 139/279 (49.82%), Query Frame = 1
Query:  313 FGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPC---DKYNALVMELLGPSLEDLFDICERQ-FSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            FGE+  G +  T ++VAIKLE        L +E    + LQ     G   +  F  C   + +N LVM L G +L +L     +  FS  T+L +  Q+L   +  H    ++RD+KP NF +G      H + +M+D GL++++  ++ +   P R      GT RY SIN H  KE  R DDL +  ++ + F  G LPW+ +K        +++G++K+T  I +L    P  F  ++ ++  + + + PDY+ +  L   ++ ++G    + +DW
Sbjct:   26 FGEIYRGLDQVTKDYVAIKLESVHQSKQVLKMEVAVLKKLQ-----GVDHICKFISCGRNESFNYLVMSLQGSNLAELRRSQPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIKPSNFAMGNTPDTVH-ICYMLDFGLSRQFTKANGEVRPP-RNTAGFRGTVRYASINAHENKEMGRHDDLWSFFYLMVEFTVGQLPWRKMKDK------EQVGKMKKTYDIANLLKSMPGEFKQFVDHISKLKYEDKPDYKMLLGLLEQIIKRKGIKESDPYDW 291          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Medaka
Match: csnk1g2b (casein kinase I [Source:NCBI gene;Acc:101172235])

HSP 1 Score: 494.197 bits (1271), Expect = 1.135e-171
Identity = 230/305 (75.41%), Postives = 257/305 (84.26%), Query Frame = 1
Query:  226 NGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWC 1140
             G  +    + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q   +EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFLVGR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+G+PE  ATYLRYVR +DFFE PDYEY+R LF  L D+ G++FD E+DW 
Sbjct:   26 TGGRSSGTNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYK--QLGNSEGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCEGFPEEMATYLRYVRRLDFFEKPDYEYLRKLFTDLFDRSGHVFDYEYDWV 328          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Medaka
Match: csnk1g2b (casein kinase I [Source:NCBI gene;Acc:101172235])

HSP 1 Score: 491.5 bits (1264), Expect = 3.798e-171
Identity = 230/304 (75.66%), Postives = 257/304 (84.54%), Query Frame = 1
Query:  226 NGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
             G  +    + VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+  Q   +EG PQV+YFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFLVGR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+G+PE  ATYLRYVR +DFFE PDYEY+R LF  L D+ G++FD E+DW
Sbjct:   26 TGGRSSGTNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYK--QLGNSEGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCEGFPEEMATYLRYVRRLDFFEKPDYEYLRKLFTDLFDRSGHVFDYEYDW 327          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Medaka
Match: CSNK1G2 (casein kinase I [Source:NCBI gene;Acc:101160101])

HSP 1 Score: 491.115 bits (1263), Expect = 6.262e-171
Identity = 230/306 (75.16%), Postives = 260/306 (84.97%), Query Frame = 1
Query:  220 EYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +Y+G+    N   VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +  +EG PQVFYFGPC KYNA+V+ELLGPSLEDLFD+CER FSLKTVLMIAIQL+ R E+ H + LIYRDVKPENFLVGR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D+ GY+FD ++DW
Sbjct:   28 KYSGRGAGSNSG-VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKQLGS--SEGIPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCERTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRDTPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRNGYVFDFQYDW 330          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Medaka
Match: CSNK1G2 (casein kinase I [Source:NCBI gene;Acc:101160101])

HSP 1 Score: 490.345 bits (1261), Expect = 1.201e-170
Identity = 230/306 (75.16%), Postives = 260/306 (84.97%), Query Frame = 1
Query:  220 EYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            +Y+G+    N   VLMVGPNFRVGKKIGCGNFGELRLGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L +  +EG PQVFYFGPC KYNA+V+ELLGPSLEDLFD+CER FSLKTVLMIAIQL+ R E+ H + LIYRDVKPENFLVGR    +   IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDY+Y+R LF  L D+ GY+FD ++DW
Sbjct:   28 KYSGRGAGSNSG-VLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKQLGS--SEGIPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCERTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRDTPIEVLCESFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRNGYVFDFQYDW 330          
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Medaka
Match: csnk1g1 (casein kinase 1 gamma 1 [Source:NCBI gene;Acc:101164710])

HSP 1 Score: 490.73 bits (1262), Expect = 4.824e-170
Identity = 228/293 (77.82%), Postives = 255/293 (87.03%), Query Frame = 1
Query:  259 VLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW 1137
            VLMVGPNFRVGKKIGCGNFGEL+LGKN+YTNE+VAIKLE  KSRAPQLHLEYR+Y+ L T  +EG PQVFYFGPC KYNA+V+ELLGPSLEDLFD+C+R FSLKTVLMIAIQL+ R EY H K LIYRDVKPENFL+GRQ   +  +IH+ID GLAKEYI  +T+KHIPYREHKSLTGTARYMSINTH+GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIG+ KR T IE LC+ +PE  ATYLRYVR +DFFE PDYEY+R LF  L +++GY FD  +DW
Sbjct:   44 VLMVGPNFRVGKKIGCGNFGELKLGKNLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGT--SEGVPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRALFTELFERKGYTFDYTYDW 334          
BLAST of Casein kinase I isoform gamma-1 vs. Planmine SMEST
Match: SMESG000007847.1 (SMESG000007847.1)

HSP 1 Score: 996.497 bits (2575), Expect = 0.000e+0
Identity = 509/509 (100.00%), Postives = 509/509 (100.00%), Query Frame = 1
Query:  100 NPENGAVLYKMRRQNQLLPQTKIVGYDNLKHVNNMQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCXXXXXXXXXXXXXXXXXHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDXXXXXXXXXXXXXXADSYNCVRDGCCNLF 1626
            NPENGAVLYKMRRQNQLLPQTKIVGYDNLKHVNNMQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF
Sbjct:    5 NPENGAVLYKMRRQNQLLPQTKIVGYDNLKHVNNMQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF 513          
BLAST of Casein kinase I isoform gamma-1 vs. Planmine SMEST
Match: SMESG000007847.1 (SMESG000007847.1)

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 499/499 (100.00%), Postives = 499/499 (100.00%), Query Frame = 1
Query:  130 MRRQNQLLPQTKIVGYDNLKHVNNMQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCXXXXXXXXXXXXXXXXXHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDXXXXXXXXXXXXXXADSYNCVRDGCCNLF 1626
            MRRQNQLLPQTKIVGYDNLKHVNNMQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF
Sbjct:    1 MRRQNQLLPQTKIVGYDNLKHVNNMQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF 499          
BLAST of Casein kinase I isoform gamma-1 vs. Planmine SMEST
Match: SMESG000007847.1 (SMESG000007847.1)

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 475/475 (100.00%), Postives = 475/475 (100.00%), Query Frame = 1
Query:  202 MQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCXXXXXXXXXXXXXXXXXHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDXXXXXXXXXXXXXXADSYNCVRDGCCNLF 1626
            MQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF
Sbjct:    1 MQTQEMEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF 475          
BLAST of Casein kinase I isoform gamma-1 vs. Planmine SMEST
Match: SMESG000007847.1 (SMESG000007847.1)

HSP 1 Score: 915.605 bits (2365), Expect = 0.000e+0
Identity = 470/470 (100.00%), Postives = 470/470 (100.00%), Query Frame = 1
Query:  217 MEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCXXXXXXXXXXXXXXXXXHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDXXXXXXXXXXXXXXADSYNCVRDGCCNLF 1626
            MEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF
Sbjct:    1 MEYNGKNTMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF 470          
BLAST of Casein kinase I isoform gamma-1 vs. Planmine SMEST
Match: SMESG000007847.1 (SMESG000007847.1)

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 462/462 (100.00%), Postives = 462/462 (100.00%), Query Frame = 1
Query:  241 MYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCXXXXXXXXXXXXXXXXXHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDXXXXXXXXXXXXXXADSYNCVRDGCCNLF 1626
            MYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF
Sbjct:    1 MYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKSRAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDLFDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCNQHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDLCDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDWCSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNYSTSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYMISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSADSYNCVRDGCCNLF 462          
The following BLAST results are available for this feature:
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSNK1G34.413e-17075.08casein kinase 1 gamma 3 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1G11.016e-16977.82casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1G11.043e-16977.55casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1G11.350e-16977.82casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
CSNK1G11.350e-16977.82casein kinase 1 gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk-18.531e-16975.42Casein kinase I gamma [Source:UniProtKB/Swiss-Pro... [more]
kin-203.135e-11156.16Casein kinase I isoform delta [Source:UniProtKB/S... [more]
kin-203.135e-11156.16Casein kinase I isoform delta [Source:UniProtKB/S... [more]
kin-203.865e-11156.16Casein kinase I isoform delta [Source:UniProtKB/S... [more]
kin-206.482e-11156.16Casein kinase I isoform delta [Source:UniProtKB/S... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gish2.480e-17575.16gene:FBgn0250823 transcript:FBtr0083265[more]
gish6.301e-17575.16gene:FBgn0250823 transcript:FBtr0083263[more]
gish5.392e-16671.94gene:FBgn0250823 transcript:FBtr0100331[more]
gish8.484e-16671.94gene:FBgn0250823 transcript:FBtr0301304[more]
gish8.499e-16671.94gene:FBgn0250823 transcript:FBtr0083262[more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1g19.481e-17177.82casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
csnk1g11.303e-17077.55casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
csnk1g2b3.047e-16976.87casein kinase 1, gamma 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
csnk1g2b6.681e-16977.13casein kinase 1, gamma 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
csnk1g2a7.676e-16975.41casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sap301.338e-17074.75Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
sap301.787e-17074.75Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
sap302.935e-17074.75Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
sap304.372e-17074.75Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
sap307.659e-17074.75Sin3A associated protein 30kDa [Source:Xenbase;Acc... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Csnk1g22.574e-17075.08casein kinase 1, gamma 2 [Source:MGI Symbol;Acc:MG... [more]
Csnk1g15.222e-17077.21casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1g16.034e-17077.21casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1g16.261e-17077.47casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MG... [more]
Csnk1g16.261e-17077.47casein kinase 1, gamma 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5PRD4|KC1G1_DANRE7.157e-17077.82Casein kinase I isoform gamma-1 OS=Danio rerio OX=... [more]
sp|A7E3X2|KC1G1_BOVIN1.221e-16972.19Casein kinase I isoform gamma-1 OS=Bos taurus OX=9... [more]
sp|Q62761|KC1G1_RAT1.515e-16977.55Casein kinase I isoform gamma-1 OS=Rattus norvegic... [more]
sp|Q4R9A9|KC1G1_MACFA1.685e-16977.55Casein kinase I isoform gamma-1 OS=Macaca fascicul... [more]
sp|Q8BVP5|KC1G2_MOUSE1.801e-16975.08Casein kinase I isoform gamma-2 OS=Mus musculus OX... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8NRP53.075e-17375.82Protein kinase domain-containing protein OS=Stomox... [more]
N6UKM07.181e-17376.14Protein kinase domain-containing protein (Fragment... [more]
U4TYR58.405e-17376.14Protein kinase domain-containing protein OS=Dendro... [more]
A0A034VW159.160e-17376.39Casein kinase I isoform gamma-1 OS=Bactrocera dors... [more]
A0A034VW209.426e-17376.39Casein kinase I isoform gamma-1 OS=Bactrocera dors... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1g2b6.827e-17177.55casein kinase 1 gamma 2 [Source:NCBI gene;Acc:1030... [more]
csnk1g11.304e-17077.21casein kinase 1 gamma 1 [Source:NCBI gene;Acc:1030... [more]
csnk1g2b1.401e-17077.82casein kinase 1 gamma 2 [Source:NCBI gene;Acc:1030... [more]
csnk1g13.117e-17077.21casein kinase 1 gamma 1 [Source:NCBI gene;Acc:1030... [more]
CSNK1G15.261e-17076.87casein kinase I-like [Source:NCBI gene;Acc:1030431... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1g2a2.223e-17379.52casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
csnk1g12.868e-13281.08casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
ENSPMAT00000008477.11.899e-10954.95pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gen... [more]
ENSPMAT00000001691.11.159e-6151.81pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1... [more]
ENSPMAT00000004926.11.226e-3133.78pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gen... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YCK21.279e-10654.30Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK16.856e-10553.61Palmitoylated plasma membrane-bound casein kinase ... [more]
HRR251.039e-9850.85Conserved casein kinase; regulates diverse events ... [more]
YCK32.369e-9045.81Palmitoylated vacuolar membrane-localized casein k... [more]
CMK22.427e-1231.45Calmodulin-dependent protein kinase; may play a ro... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342893.823e-17377.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347429.355e-10954.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465233.270e-10654.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487381.746e-9749.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467894.293e-3429.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk1g2b1.135e-17175.41casein kinase I [Source:NCBI gene;Acc:101172235][more]
csnk1g2b3.798e-17175.66casein kinase I [Source:NCBI gene;Acc:101172235][more]
CSNK1G26.262e-17175.16casein kinase I [Source:NCBI gene;Acc:101160101][more]
CSNK1G21.201e-17075.16casein kinase I [Source:NCBI gene;Acc:101160101][more]
csnk1g14.824e-17077.82casein kinase 1 gamma 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Casein kinase I isoform gamma-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007847.10.000e+0100.00SMESG000007847.1[more]
SMESG000007847.10.000e+0100.00SMESG000007847.1[more]
SMESG000007847.10.000e+0100.00SMESG000007847.1[more]
SMESG000007847.10.000e+0100.00SMESG000007847.1[more]
SMESG000007847.10.000e+0100.00SMESG000007847.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023274 ID=SMED30023274|Name=Casein kinase I isoform gamma-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1675bp
ATATTCAAAGAATTGCATATTATATTTTATAAATGGTGATATAAATAGAC
AAAATTAAATTTTTTATTTCTATTTAAGTAATTTTCAATGTTAACAACAA
ATCCTGAAAATGGTGCAGTTTTATATAAAATGAGACGTCAAAATCAATTA
CTACCTCAAACTAAAATTGTAGGATATGATAATTTAAAACATGTAAATAA
TATGCAAACTCAAGAAATGGAATATAATGGAAAAAATACCATGTATAATG
AAAATACGGTATTGATGGTTGGCCCAAATTTTAGGGTTGGCAAAAAAATT
GGATGTGGTAATTTCGGCGAATTACGACTTGGAAAAAATATTTATACAAA
TGAACATGTTGCTATAAAATTAGAACAAACGAAAAGTCGTGCTCCACAAT
TGCACTTGGAATATCGATACTATCAGTTATTACAAACGGATAGAGCAGAG
GGCTTTCCTCAAGTTTTTTATTTTGGTCCATGTGATAAATACAACGCTCT
AGTAATGGAGTTGCTTGGTCCGTCTCTTGAGGATCTGTTTGATATTTGCG
AGAGGCAATTTTCATTGAAAACCGTCCTGATGATAGCTATTCAATTGCTC
TACAGATTTGAATATTTCCATCTAAAGAGACTTATATACAGAGATGTTAA
ACCAGAAAACTTCCTTGTCGGTCGCCAGTCTTGTAATCAGCATCGTGTTA
TACATATGATTGATCTCGGTCTTGCCAAAGAATATATCAGTTCAGATACT
CAGAAACACATTCCTTATCGTGAACATAAAAGTCTAACGGGAACCGCCCG
TTACATGAGTATTAATACACATATGGGAAAAGAACAGAGTAGGCGAGATG
ATCTCGAAGCATTGGGACACATGTTTATGTATTTCTTGAGAGGTAGTCTT
CCATGGCAAGGTCTCAAAGCTGATACATTGAAAGAAAGATATCAGAAAAT
CGGAGAAGTAAAACGTACAACGAGAATAGAAGACTTATGTGACGGCTATC
CTGAAGCATTCGCAACATACCTCAGATATGTTAGAGGAATGGATTTTTTT
GAAACACCAGACTATGAATATATGAGGAATTTGTTCAGAAGTTTAATGGA
TCAAAGAGGATATATTTTTGATAATGAATTTGATTGGTGTTCTCGATCCC
AATCCAACAGTACCAGATCTTCATCTATCAGAAATTCTAGTCATTATAAG
CCAGCTCTTATTAGAGCTCAAGTTGATAATTCTCCTAGTCGTCGCCAGCT
AATATCTTTAGCAACAGGGCCGATGGTGAACAATTACTCTACGTCCATAG
AATTAAGCAATAATAATAATAATATCAAAGAATTTATCCCTTCAAAACCT
TTACATGCTCCGATAAATAATACAAAGTTAACATATAAAAGCAGTCCGCT
CTCAGAACAATACGGTCTTGGTAACCAAGCATATATGATTAGTTCAGTCA
CACCCAAAAGTGCAATTTCAATAAATAATCACACAGATATAGTAGAAATG
TATAATTCAAATATGTGCTCATCACTCACTCCTATTGACAGTTCCAAAAA
GAAATCCAGGAAGAATAGTACAAACTCTTCAGCTGATAGCTATAACTGTG
TACGAGATGGATGCTGCAACTTATTCCGTTTAAAGAGTAAATCAAAAAGC
ATAAAAAGACTAAAATAACAAATCA
back to top

protein sequence of SMED30023274-orf-1

>SMED30023274-orf-1 ID=SMED30023274-orf-1|Name=SMED30023274-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=527bp
MLTTNPENGAVLYKMRRQNQLLPQTKIVGYDNLKHVNNMQTQEMEYNGKN
TMYNENTVLMVGPNFRVGKKIGCGNFGELRLGKNIYTNEHVAIKLEQTKS
RAPQLHLEYRYYQLLQTDRAEGFPQVFYFGPCDKYNALVMELLGPSLEDL
FDICERQFSLKTVLMIAIQLLYRFEYFHLKRLIYRDVKPENFLVGRQSCN
QHRVIHMIDLGLAKEYISSDTQKHIPYREHKSLTGTARYMSINTHMGKEQ
SRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGEVKRTTRIEDL
CDGYPEAFATYLRYVRGMDFFETPDYEYMRNLFRSLMDQRGYIFDNEFDW
CSRSQSNSTRSSSIRNSSHYKPALIRAQVDNSPSRRQLISLATGPMVNNY
STSIELSNNNNNIKEFIPSKPLHAPINNTKLTYKSSPLSEQYGLGNQAYM
ISSVTPKSAISINNHTDIVEMYNSNMCSSLTPIDSSKKKSRKNSTNSSAD
SYNCVRDGCCNLFRLKSKSKSIKRLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006897endocytosis
GO:0008360regulation of cell shape
GO:0016055Wnt signaling pathway
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 65..397
e-value: 3.0E-12
score: 41.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 66..287
e-value: 6.4E-23
score: 81.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 65..397
score: 24.966
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 28..387
e-value: 1.8E-99
score: 335.4
NoneNo IPR availablePANTHERPTHR11909CASEIN KINASE-RELATEDcoord: 51..414
NoneNo IPR availablePANTHERPTHR11909:SF155GILGAMESH, ISOFORM Lcoord: 51..414
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 71..94
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 182..194
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 61..350