cilia- and flagella-associated protein 43

Overview
Namecilia- and flagella-associated protein 43
Smed IDSMED30023266
Length (bp)5578
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 43 (SMED30023266) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 43 (SMED30023266) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 43 (SMED30023266) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 43 (SMED30023266) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023266

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cilated neuronSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30023266SMESG000000491.1 dd_Smed_v6_10271_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
head regionSMED30023266SMESG000000491.1 SmedASXL_017100SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30023266SMESG000000491.1 Contig44979uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023266SMESG000000491.1 Contig44979newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023266SMESG000000491.1 Contig38099uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023266SMESG000000491.1 Contig38099newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023266SMESG000000491.1 Contig4300uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023266SMESG000000491.1 Contig4300newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023266SMESG000076528.1 Contig4300uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023266SMESG000076528.1 Contig4300newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023266SMESG000000491.1 dd_Smed_v4_10271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Human
Match: CFAP43 (cilia and flagella associated protein 43 [Source:HGNC Symbol;Acc:HGNC:26684])

HSP 1 Score: 484.182 bits (1245), Expect = 8.135e-142
Identity = 350/1054 (33.21%), Postives = 578/1054 (54.84%), Query Frame = 2
Query: 2375 PQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKD--GIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSS----RADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLI-QPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLD---QKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            P +  LSS  G  + T    G+L + D+     +A    H     G+     S+D   I   G+D   +          H+       Y  ++    + + ++N  L +   + +   + S SE T     + ST  S       D K    W +++  +  ++E   +   +  I++GIK++  TI  M+EEN+ L ++ K+D+QEF LD++  +++H + + E+ K+I ++E +NLAK Y+ ++IK+ECW+ M VKGR+L  F     V NFP++ R    L +++ V++++KIE E  K RK   E      L KQ+        +E ++          NL  + L           +   L SQ+EL +R++KI QIILLKDIIY++K  FN EF   Y++KE EI R+KE+N RI +I+ D+E+   + QP+ E     +     VV+D EI   +++    + K       +E     +     R R L DMMGGVLEVK+ED L+  IP+PAF+   KP   WT+EE+K F++Y+KKVKELN+ER+KY+K LEAE KKL N I ++  AFDE L  LF +++  +M   QEE+KI  + +SLL+DEEL++R K L    T    E       ++ ++  LD  +E YD ++AE+KVMD+ F++EF ++ G   D + KL+K+RPR       I         T   P+     SGK  +     L  A+ +LD   +  + ++P ++   C +R+ ++  E ++KQ   ++ +M  F QKR+EEE+ ++    ++   +  L+  + +F +N  IQ+++KQGQVE+E     + ++++++L++++IIEDLN  I+  G  KV  M ++KD  K+ + +EWE ++M ME EDL +K  +IQ    +++ Q+YL   +Y+ LI+ +I  MEQTI  L   H + ++   +   +L   ++ K I     N  +   + E  V V+ERK I          ++ V+ RY+ ++Q+Q L +++K QA ++++L++EVERLRM+TFPAL+Q
Sbjct:  641 PGLLYLSS-HGLWLITIAKCGILCIRDVYTLETFAWCRSHSHQGHGIQSMRISMDGQNILVNGRDDGTLVYLKWKRFGGHLASEILDYYQKLLISLSSAMDKENHYLSTTPKVSVD--LGSDSEHTKQ---KASTDLSQDELVLTDVKKEIPWIQQKSQEAIKKEVNLFSKKRKEIKQGIKSLSKTILNMMEENDKLENIAKLDQQEFGLDLEELERLHDESQEEVAKMIKDVEMHNLAKSYLAELIKEECWNSMAVKGRALKCFHIPCVVENFPMKARTVEELKELERVLQQKKIEAECLKLRKEIVEAQSGVKLIKQRHEEDDEEEEEEDKTVKYS-----NLPNYLLGSLST--DFGVDTSLLSSQLELHSREEKINQIILLKDIIYKVKTVFNNEFDAAYKQKEFEIARVKERNVRIREIILDLELEEAVWQPEFEDCEKPERTL--VVQDEEITAHKHIKPWHKAKELIVNHEKEHWLLIQDAST-RLRALMDMMGGVLEVKKEDILRMVIPQPAFM--AKPDAVWTEEERKQFKDYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQAFDEHLKRLFERRVKAEMVTNQEELKISNLAFSLLLDEELSSREKFLNNYLTRKQHEKSQTSEAVRKSREDLDVCKEHYDNLLAEDKVMDRSFKKEFSEIPGHQVDILYKLFKRRPR-------ISKQKTHSETTSVVPFGELPGSGKLNKDAFAQLMKAMDELDNISNMPEGLDPLVWNHFCMTRRAKVENEQKVKQKAADLLEMATFLQKRVEEEEKVQQEIERVFHELILLQEEKVRFQLNLTIQILLKQGQVELENFQ-LVLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKDVHKRILQIEWEHKKMEMEREDLNQKAWDIQMLFFSRDRQKYLNEPNYEALISIQIGIMEQTIAVLDKMHKKNVENCKKLLKKLGKFSNQKDIA----NYALSCNLREELVAVSERKDICNAMGSKLTCEKIVKERYENMMQQQKLTNISKQQAEQISILQTEVERLRMKTFPALVQ 1664          

HSP 2 Score: 208.379 bits (529), Expect = 3.616e-53
Identity = 158/637 (24.80%), Postives = 289/637 (45.37%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCD-YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLR--ISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDN---VEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIG-VLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIP 1933
            + + W  G+  + ++F++ NT+ Y  G YV F + E   +  +Q  +     +  +    + A ++  K  P IY Y++P L     +K   +LD    SFS C  YLA  S +P+F L+LWN+     LC+K     +V   S +P+NW+ + + S + +  ++IE     +  + + +KLP      G   N    ++ V   +S  + + Y   LP SA AG+  K  + F    D         H W+ T DLY GC +G L+ ++ D +    +LN  E +  + R    SP++             + + +EG+  +G DG V     +   I D    +E+  + +  + ++ F+ +YT L I +  GS+ I +  +     K +L+   G F  I  + PG  Y  T+  +G + +W + +   +S IY+N  A  +   P      +G E+G++  I  YD  + + +H+  L  + V  + + ++G  ++ G  +G V I++   S SF+++G T     IL +   +    D IV++ V +       G ++L  F + PT++   S  + +  G   +E I K     ++      LG      +S  +Y    +   +C Y +P
Sbjct:   19 LSVRWVQGFPKQNVHFVNDNTICYPCGNYVIFINIETKKKTVLQCSNGIVGVMATNIPCEVVAFSDR-KLKPLIYVYSFPGLTRRTKLKGNILLDYTLLSFSYCGTYLASYSSLPEFELALWNWESSIILCKKSQPGMDVNQMSFNPMNWRQLCLSSPSTVSVWTIERSNQEHCFRARSVKLP---LEDGSFFN----ETDVVFPQSLPKDLIYGPVLPLSAIAGLVGKEAETFRPKDDLYPLLHPTMHCWTPTSDLYIGCEEGHLLMINGDTLQV-TVLNKIEEESPLDRRNFISPVT-------------LVYQKEGVLASGIDGFV-----YSFIIKDRSYMIEDFLEIERPVEHMTFSPNYTVLLIQTDKGSVYIYTFGKEPTLNK-VLDACDGKFQAIDFITPGTQYFMTLTYSGEICVWWLEDCACVSKIYLNTLATVLACCPSSLSAAVGTEDGSVYFISVYDKESPQVVHKAFLSESSVQHVVYDQQGIFLLVGTAEGKVFIINANSSSSFQIIGFTEVAKDILQISTVSLLETD-IVEVMVLSSLPE--AGRSRLEMFTL-PTLLPQVSTTFADERGRLKDEIIHKYLYELEHALSSAVLGF-----QSNQIYGFCSQVPYICSYLLP 618          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Human
Match: CFAP43 (cilia and flagella associated protein 43 [Source:HGNC Symbol;Acc:HGNC:26684])

HSP 1 Score: 454.136 bits (1167), Expect = 1.100e-136
Identity = 346/1054 (32.83%), Postives = 564/1054 (53.51%), Query Frame = 2
Query: 2375 PQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKD--GIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSS----RADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLI-QPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHL-KMH--HARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            P +  LSS  G  + T    G+L + D+     +A    H     G+     S+D   I   G+D   +          H+       Y  ++    + + ++N  L +   + +   + S SE T     + ST  S       D K    W +++  +  ++E   +   +  I++GIK++  TI  M+EEN+ L ++ K+D+QEF LD++  +++H + + E+ K+I ++E +NLAK Y+ ++IK+ECW+ M VKGR+L  F     V NFP++ R    L +++ V++++KIE E  K RK   E      L KQ+        +E ++          NL  + L           +   L SQ+EL +R++KI QIILLKDIIY++K  FN EF   Y++KE EI R+KE+N RI +I+ D+E+   + QP+ E     +     VV+D EI   +++    + K       +E     +     R R L DMMGGVLEVK+ED L+  IP+PAF+   KP   WT+EE+K F++Y+KKVKELN+ER+KY+K LEAE KKL N I ++  AFDE L  LF +++  +M   QEE+KI  + +SLL+DEEL++R K L                               Y T    EKVMD+ F++EF ++ G   D + KL+K+RPR       I         T   P+     SGK  +     L  A+ +LD   +  + ++P ++   C +R+ ++  E ++KQ   ++ +M  F QKR+EEE+ ++    ++   +  L+  + +F +N  IQ+++KQGQVE+E     + ++++++L++++IIEDLN  I+  G  KV  M ++KD  K+ + +EWE ++M ME EDL +K  +IQ    +++ Q+YL   +Y+ LI+ +I  MEQTI  L KMH  +     +   +L   ++ K I     N  +   + E  V V+ERK I          ++ V+ RY+ ++Q+Q L +++K QA ++++L++EVERLRM+TFPAL+Q
Sbjct:    2 PGLLYLSS-HGLWLITIAKCGILCIRDVYTLETFAWCRSHSHQGHGIQSMRISMDGQNILVNGRDDGTLVYLKWKRFGGHLASEILDYYQKLLISLSSAMDKENHYLSTTPKVSVD--LGSDSEHTKQ---KASTDLSQDELVLTDVKKEIPWIQQKSQEAIKKEVNLFSKKRKEIKQGIKSLSKTILNMMEENDKLENIAKLDQQEFGLDLEELERLHDESQEEVAKMIKDVEMHNLAKSYLAELIKEECWNSMAVKGRALKCFHIPCVVENFPMKARTVEELKELERVLQQKKIEAECLKLRKEIVEAQSGVKLIKQRHEEDDEEEEEEDKTVKYS-----NLPNYLLGSLS--TDFGVDTSLLSSQLELHSREEKINQIILLKDIIYKVKTVFNNEFDAAYKQKEFEIARVKERNVRIREIILDLELEEAVWQPEFEDCEKPERTL--VVQDEEITAHKHIKPWHKAKELIVNHEKEHWLLIQDAST-RLRALMDMMGGVLEVKKEDILRMVIPQPAFM--AKPDAVWTEEERKQFKDYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQAFDEHLKRLFERRVKAEMVTNQEELKISNLAFSLLLDEELSSREKFL-----------------------------NNYLTRKQHEKVMDRSFKKEFSEIPGHQVDILYKLFKRRPR-------ISKQKTHSETTSVVPFGELPGSGKLNKDAFAQLMKAMDELDNISNMPEGLDPLVWNHFCMTRRAKVENEQKVKQKAADLLEMATFLQKRVEEEEKVQQEIERVFHELILLQEEKVRFQLNLTIQILLKQGQVELENFQ-LVLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKDVHKRILQIEWEHKKMEMEREDLNQKAWDIQMLFFSRDRQKYLNEPNYEALISIQIGIMEQTIAVLDKMHKKNVENCKKLLKKLGKFSNQKDIA----NYALSCNLREELVAVSERKDICNAMGSKLTCEKIVKERYENMMQQQKLTNISKQQAEQISILQTEVERLRMKTFPALVQ 996          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Human
Match: CFAP43 (cilia and flagella associated protein 43 [Source:HGNC Symbol;Acc:HGNC:26684])

HSP 1 Score: 285.419 bits (729), Expect = 2.835e-83
Identity = 188/524 (35.88%), Postives = 313/524 (59.73%), Query Frame = 2
Query: 3944 WTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHL-KMH--HARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            WT+EE+K F++Y+KKVKELN+ER+KY+K LEAE KKL N I ++  AFDE L  LF +++  +M   QEE+KI  + +SLL+DEEL++R K L    T    E       ++ ++  LD  +E YD ++AE+KVMD+ F++EF ++ G   D + KL+K+RPR       I         T   P+     SGK  +     L  A+ +LD   +  + ++P ++   C +R+ ++  E ++KQ   ++ +M  F QKR+EEE+ ++    ++   +  L+  + +F +N  IQ+++KQGQVE+E     + ++++++L++++IIEDLN  I+  G  KV  M ++KD  K+ + +EWE ++M ME EDL +K  +IQ    +++ Q+YL   +Y+ LI+ +I  MEQTI  L KMH  +     +   +L   ++ K I     N  +   + E  V V+ERK I          ++ V+ RY+ ++Q+Q L +++K QA ++++L++EVERLRM+TFPAL+Q
Sbjct:    2 WTEEERKQFKDYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQAFDEHLKRLFERRVKAEMVTNQEELKISNLAFSLLLDEELSSREKFLNNYLTRKQHEKSQTSEAVRKSREDLDVCKEHYDNLLAEDKVMDRSFKKEFSEIPGHQVDILYKLFKRRPR-------ISKQKTHSETTSVVPFGELPGSGKLNKDAFAQLMKAMDELDNISNMPEGLDPLVWNHFCMTRRAKVENEQKVKQKAADLLEMATFLQKRVEEEEKVQQEIERVFHELILLQEEKVRFQLNLTIQILLKQGQVELENFQ-LVLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKDVHKRILQIEWEHKKMEMEREDLNQKAWDIQMLFFSRDRQKYLNEPNYEALISIQIGIMEQTIAVLDKMHKKNVENCKKLLKKLGKFSNQKDIA----NYALSCNLREELVAVSERKDICNAMGSKLTCEKIVKERYENMMQQQKLTNISKQQAEQISILQTEVERLRMKTFPALVQ 513          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Human
Match: CFAP43 (cilia and flagella associated protein 43 [Source:HGNC Symbol;Acc:HGNC:26684])

HSP 1 Score: 197.978 bits (502), Expect = 7.784e-51
Identity = 157/641 (24.49%), Postives = 291/641 (45.40%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCD-YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILN------PSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDN---VEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIG-VLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIP 1933
            + + W  G+  + ++F++ NT+ Y  G YV F + E   +  +Q  +     +  +    + A ++  K  P IY Y++P L     +K   +LD    SFS C  YLA  S +P+F L+LWN+     LC+K     +V   S +P+NW+ + + S + +  ++IE     +  + + +KLP        +  +   ++ V   +S  + + Y   LP SA AG+  K  + F    D         H W+ T DLY GC +G L+ ++ D +    +LN      P E++R  +   SP++             + + +EG+  +G DG V     +   I D    +E+  + +  + ++ F+ +YT L I +  GS+ I +  +     K +L+   G F  I  + PG  Y  T+  +G + +W + +   +S IY+N  A  +   P      +G E+G++  I  YD  + + +H+  L  + V  + + ++G  ++ G  +G V I++   S SF+++G T     IL +   +    D IV++ V +       G ++L  F + PT++   S  + +  G   +E I K     ++      LG      +S  +Y    +   +C Y +P
Sbjct:   19 LSVRWVQGFPKQNVHFVNDNTICYPCGNYVIFINIETKKKTVLQCSNGIVGVMATNIPCEVVAFSDR-KLKPLIYVYSFPGLTRRTKLKGNILLDYTLLSFSYCGTYLASYSSLPEFELALWNWESSIILCKKSQPGMDVNQMSFNPMNWRQLCLSSPSTVSVWTIERSNQEHCFRARSVKLP-------LEDGSFFNETDVVFPQSLPKDLIYGPVLPLSAIAGLVGKEAETFRPKDDLYPLLHPTMHCWTPTSDLYIGCEEGHLLMINGDTLQVT-VLNKIEEESPLEDRRNFI---SPVT-------------LVYQKEGVLASGIDGFV-----YSFIIKDRSYMIEDFLEIERPVEHMTFSPNYTVLLIQTDKGSVYIYTFGKEPTLNK-VLDACDGKFQAIDFITPGTQYFMTLTYSGEICVWWLEDCACVSKIYLNTLATVLACCPSSLSAAVGTEDGSVYFISVYDKESPQVVHKAFLSESSVQHVVYDQQGIFLLVGTAEGKVFIINANSSSSFQIIGFTEVAKDILQISTVSLLETD-IVEVMVLSSLPE--AGRSRLEMFTL-PTLLPQVSTTFADERGRLKDEIIHKYLYELEHALSSAVLGF-----QSNQIYGFCSQVPYICSYLLP 619          

HSP 2 Score: 114.39 bits (285), Expect = 1.104e-24
Identity = 84/302 (27.81%), Postives = 151/302 (50.00%), Query Frame = 2
Query: 2375 PQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKD--GIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSS----RADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTK 3262
            P +  LSS  G  + T    G+L + D+     +A    H     G+     S+D   I   G+D   +          H+       Y  ++    + + ++N  L +   + +   + S SE T     + ST  S       D K    W +++  +  ++E   +   +  I++GIK++  TI  M+EEN+ L ++ K+D+QEF LD++  +++H + + E+ K+I ++E +NLAK Y+ ++IK+ECW+ M VKGR+L  F     V NFP++ R    L +++ V++++KIE E  K
Sbjct:  642 PGLLYLSS-HGLWLITIAKCGILCIRDVYTLETFAWCRSHSHQGHGIQSMRISMDGQNILVNGRDDGTLVYLKWKRFGGHLASEILDYYQKLLISLSSAMDKENHYLSTTPKVSVD--LGSDSEHTKQ---KASTDLSQDELVLTDVKKEIPWIQQKSQEAIKKEVNLFSKKRKEIKQGIKSLSKTILNMMEENDKLENIAKLDQQEFGLDLEELERLHDESQEEVAKMIKDVEMHNLAKSYLAELIKEECWNSMAVKGRALKCFHIPCVVENFPMKARTVEELKELERVLQQKKIEAECLK 937          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Human
Match: CFAP43 (cilia and flagella associated protein 43 [Source:HGNC Symbol;Acc:HGNC:26684])

HSP 1 Score: 163.696 bits (413), Expect = 5.376e-42
Identity = 122/490 (24.90%), Postives = 226/490 (46.12%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCD-YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMI-----LNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDN---VEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIG-VLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPV 1483
            + + W  G+  + ++F++ NT+ Y  G YV F + E   +  +Q  +     +  +    + A ++  K  P IY Y++P L     +K   +LD    SFS C  YLA  S +P+F L+LWN+     LC+K     +V   S +P+NW+ + + S + +  ++IE     +  + + +KLP        +  +   ++ V   +S  + + Y   LP SA AG+  K  + F    D         H W+ T DLY GC +G L+ ++ D +   ++      +P E++R  +   SP++             + + +EG+  +G DG V     +   I D    +E+  + +  + ++ F+ +YT L I +  GS+ I +  +     K +L+   G F  I  + PG  Y  T+  +G + +W + +   +S IY+N  A  +   P      +G E+G++  I  YD  + + +H+  L  + V
Sbjct:   19 LSVRWVQGFPKQNVHFVNDNTICYPCGNYVIFINIETKKKTVLQCSNGIVGVMATNIPCEVVAFSDR-KLKPLIYVYSFPGLTRRTKLKGNILLDYTLLSFSYCGTYLASYSSLPEFELALWNWESSIILCKKSQPGMDVNQMSFNPMNWRQLCLSSPSTVSVWTIERSNQEHCFRARSVKLP-------LEDGSFFNETDVVFPQSLPKDLIYGPVLPLSAIAGLVGKEAETFRPKDDLYPLLHPTMHCWTPTSDLYIGCEEGHLLMINGDTLQVTVLNKIEEESPLEDRRNFI---SPVT-------------LVYQKEGVLASGIDGFV-----YSFIIKDRSYMIEDFLEIERPVEHMTFSPNYTVLLIQTDKGSVYIYTFGKEPTLNK-VLDACDGKFQAIDFITPGTQYFMTLTYSGEICVWWLEDCACVSKIYLNTLATVLACCPSSLSAAVGTEDGSVYFISVYDKESPQVVHKAFLSESSV 478          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Fly
Match: CG17687 (gene:FBgn0036348 transcript:FBtr0075838)

HSP 1 Score: 96.6709 bits (239), Expect = 1.716e-19
Identity = 151/592 (25.51%), Postives = 267/592 (45.10%), Query Frame = 2
Query: 3824 WRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQL-EAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLEL-----KTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLK--NAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXX-----XXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWE----------LRRML---------MEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARK-LDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPAL 5497
            W  R L  MM GVLE   E+E+KKDIP+P F+   +P E +  EE+KIF  Y++ V  L  +R KY + L E E K L         A     +   N++  ++M +  E++   R+Q    + +  N  RK++ +L     + SN L+           KA LD  +   +     ++ +++QFR +FL +       +TKL+KKRP+   L  ++  NS +     +N  SG+ S         + L+  N + + D+ +     V+P  ++   K R+++   E  +K +  ++ D Q             +E  +       DS+   LE  R     N  IQL +  GQVEV     F    + +VL+H   I D+N++I+  G+ K+K M +    +++ I  EWE          L+ ML         ME+ ++ R  ++++      E Q+Y+A     G I   I+Q        K+   RK +D+   ++  +  ++ ++IK  N+ +  ++  + V V  +  +      D   +   E R  +I   + L++  +     V  L++ +E LR+RT+P L
Sbjct:  988 W-ARALIVMMDGVLEKLWEEEIKKDIPEPEFMQKKQPHE-FNLEEQKIFRAYEEAVHLLELDRRKYLRILHENEEKTL---------ALKASQILKLNQRGQLRM-LTLEKINFGRVQ----MRKRYNMFRKDIDKLNDYMTRYSNLLDFY--------DKAFLDV-KTRLEAQQTRDRAVERQFRSQFLPLVPHATHEMTKLFKKRPK---LPGKVF-NSVLICMEASNKLSGKPSHRTPFPLPDDVLEFLNYLAEFDQPKQCPPNVDPKSWDAFVKLRRQKTESELRLKGIGYQLLDSQALLGVLNKDLAALKESKILTQRNSEDSIQTYLEKMR-----NMTIQLTLTMGQVEVSVMGQFT-KLSNTVLMHVDDINDVNRQIQEAGNKKIKAMQRVAVFRRQVIFKEWEHKLYKANIAYLKYMLDAIEKCKVSMEFLNILRNWEKVK-----TERQKYIA-----GAIERVIEQ--------KIAVFRKNIDRVNIKIDAVK-AQTLEIKRSNHAIDFKIERIKVDVTFQNTLRDTMMEDKRDREQRE-RMSQIKTHRQLMENVRRNYAHVLELQTILELLRLRTYPTL 1524          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Zebrafish
Match: cfap43 (cilia and flagella associated protein 43 [Source:ZFIN;Acc:ZDB-GENE-080815-3])

HSP 1 Score: 532.717 bits (1371), Expect = 3.983e-159
Identity = 363/1043 (34.80%), Postives = 609/1043 (58.39%), Query Frame = 2
Query: 2414 VATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCG-KDGIFSQHHVGIPNHVKISNEQDYA-NVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNK-------TWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPH-LIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLD--QKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            +A+ G +G+LR+ +I +   + Q+  H    GGV    F+ DS  I + G +DG      + +    K +    Y+ +V   F++ +  +N+ L            +  S  T  ++L+G  + S  A+ ++N        TW + +++   +EE QQY +TK ++RR IK +R TI+ M+EENE L+D+EK+++QEF LD++ ++++  + + E+ +V  EIE  NLAK Y  +V+K+ECWD M VKG+++ +F +  EV N+P+++R    L+++ MV   R+IE ED++      E +L +    ++E +S   S                  T  L     +  + P   +LY+Q  L  R+QKI QI LLKD+IY +K  FNKEF  VY++KEQEI+R KEKN RI +I+  + +   L +P   L+  E PE+ L V D EIKVE+YLT EQ+ K  + +  EE ++   K +N R++GL  MMGGVLE+K+ED L+ ++P+P F+   KP+  WT+EE+K F+E++KK KEL++E+EKY+K LE E KKL+  I +A   FDE L  LF +++  +M IYQEE+KI  +  S+  +EE+  R K+L        ++   +   ++  K  +DE +E YD  VAE+K++DK FR+EF DV G   D + KLYK+RPR + + +Q          T+NNP+      G       + +  A+++LD  +   + ++PA++ER C +R+ ++  E ++K   L + +MQ F Q+R++E+   +     L   +  L + + +F ++  +Q+V++QGQVEVEA   FI D++ ++L+ R ++EDLN  I+ LG  K+  M + KD +K  I  EWE RRM M+ EDL  K + IQ  + T+++Q YL   + D  ++ ++  +E+T++  K  H +K++  +KQ R     D ++ K++ +N  + +++ E+ + V ER++       ++  +   +  YQ IL R+ L+ +A++Q+ E+ +LR+E+E+LRM+ FP+L Q
Sbjct:  661 LASVGRDGLLRICEISEMDRYVQLQCHSCWQGGVGSVCFTPDSQTIITSGLRDGSLVCSRLKLSGVGKANAATQYSQSVADSFESVVSSENTVLTKM--------TDRDSFHTGEVSLKG--KMSHEAEQEENYFTSPTSYTWLDGKLDAVLQEEAQQYAETKKNLRRNIKVLRDTIKAMMEENESLADIEKLEQQEFNLDVEEQQRLQLEGDQEVNRVRKEIEMENLAKSYQREVLKRECWDSMQVKGKAIKAFHSENEVKNYPMKERTAKELEELRMVENMRQIEQEDSQ----LQEGVLDTLFGDKEEEVSLTESPAL---------------TGSLSSL--YGGVNP---YLYNQFNLHVREQKINQITLLKDVIYNVKSAFNKEFEAVYKQKEQEIHRTKEKNKRIFQIMAKLGISETLWEP--RLTDNECPERALTVTDSEIKVEKYLTLEQKEKEAKLREEEERQRLAAKSENMRDQGLSVMMGGVLELKKEDVLRMEVPQPEFM--SKPEAQWTEEERKSFKEFEKKAKELSEEQEKYRKTLETEMKKLLTSIKEATQMFDEKLAKLFERKVKSEMVIYQEELKIANLVLSIQTEEEILTREKQLSFKLEKARIKKNEIGEELKKHKETVDEFREAYDNTVAEDKLLDKGFRKEFYDVPGHSIDQLYKLYKRRPRVQRMKTQ----------TENNPF----KEGAAPSDGLSLMMKAMEELDAPEHMLEGLDPAVWERFCLARRAKVESEQKVKLKALTLAEMQAFLQRRIDEDDEAQLEIKNLIDELNGLCDEKMRFRLDSMVQIVLQQGQVEVEAGE-FIADYSNALLIQRKVVEDLNSTIRALGDQKIATMVECKDFRKGIIQQEWEHRRMRMQLEDLSNKARNIQTLRITQDIQDYLNETNNDNRVSKQLTTLERTLDLQKTAHQKKIEICKKQKRQL---DRQVAKMQEKNAALDLRVAEMEITVAERRNFYEAAAMEDNQETESDKNYQDILLRKKLLAIARAQSEELLLLRAELEKLRMKNFPSLSQ 1647          

HSP 2 Score: 172.94 bits (437), Expect = 1.373e-42
Identity = 139/626 (22.20%), Postives = 267/626 (42.65%), Query Frame = 2
Query:   38 EMDM----KIEWNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCD---YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAV--------LLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKG---RISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIA-TMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGI 1855
            EMD+    +++W  G+ +    F+D+ TV Y  G ++ F + E   +  +Q P       T        A ++ +   P I+ Y YP LE    +K    L     +   CD   YL   S +PD  ++LWN+     LC   L  ++++    +P+NW  I  I    +  +++E C + +LM+   + LP      G D +A+        LL+ ++T             ++P SA AG+       F+  +  + R   ++  WS + DLY GC +G L+ ++ + +H  ++  P   + EV   +S +   E      + + +      ++ AG + V+R  Q     I  N  E+ QT       S + F+     L + S+ G +         +  K +L++  G FV +  +  +  I  ++R  G +Q+W +++   + SI +     SM   P+   I +G   G++  ++       R +H + L++ PV  L F + GN ++TGA D  V +L    S+ F ++G     G I+ L    +  + +I  + +  +   +++    L+   +    + + ++   + +G   +E      L        C L +
Sbjct:   13 EMDVLRNFEVQWVQGFTNGTFRFVDKKTVCYTCGNFIVFLNVETKERKTLQSPGSGIGAFTASGQRRCIAFSD-LGLKPSIFIYKYPELELTSELKGTTKLGYTALAL--CDTGPYLVSASPMPDHIITLWNWESGLPLCSHSLLDEDISALVFNPMNWCQICAIKSKSLTIWNVERCDNYHLMKPSAVNLP------GTDGSAIECEPNQSHLLNGKLTYLGP---------QMPTSAIAGLIGDQADNFVPLKLIKPRLCPSAICWSISSDLYVGCKEGFLLCVNPETLHVSVLYKP---QTEVTTGNSEMPMQE-----GSFQSLVLQDSKLFAAGMESVLRSIQ-----IKGNKLEVVQTWALEEAASAMCFSPDGETLLLTSNTGCVYRFKPLLKDKAVK-VLDVLCGDFVTVAPVYTDRSICLSVREAGVVQLWTLDDGLCMGSISLQTHVTSMACCPIAQYIVVGTATGDVLFVEMTTKQKPRLVHRVHLYHVPVDHLVFDQGGNCLITGASDSRVFVLDSRPSKGFDIIGWIEAPGAIVGLSTQYHQESKQIKVLVLCNKSEKEISEGNVLLLLTLFAQQLTESTSCM-DAHGCLRKEVFDSCVLELPNSLCSCVLAV 605          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Xenopus
Match: dok4 (docking protein 4 [Source:Xenbase;Acc:XB-GENE-948694])

HSP 1 Score: 558.14 bits (1437), Expect = 5.043e-168
Identity = 379/1071 (35.39%), Postives = 618/1071 (57.70%), Query Frame = 2
Query: 2312 AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGK-DGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNK----TWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPH-LIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            +G+  + L   KV +   H  P +  LS    + ++  G +G++ V DIK+    AQV  H    GG+   +FSLD   I + G  DG             ++    +Y    +      +++ +++ S +  E      S++  +     R  +   +  D+  N     TW  +++ + +++E ++Y   K  I+ GIK +R TIQ M+ ENE L D+EK+D+QEF LD + +++++ + E E+ +V  EIE  NL+KQY+ +VIK+ECWD M VKGRS+ +F T  EV N+P+++R    L+    V+  +KIE  D K RK   E     T  K K        +E      + S    +L+          D    +  +LYSQ+ L +R++KI QIILL+DII+ +K  FNK+F    ++KEQE+ R+KE+N+RI +I+ ++ +   L++P    +  EKPE+ L V+D E+KVERYLT EQ+ K E+    EE ++  E+ DN ++R L+DMMGGVLEVK+ED L+ ++P+P F+   + + +WTDEEKK F+EY+KK K+L++E+EKY K LEAE KKL   + +   +FD++L  LF K++  +M+IYQEE+KI  + +SLL++EE+N R   L  +      +      I+++ K  +   +E YD +VAE+K++D+ F++EF D+     D + KLYK+RPR + L +Q    +         P+  R  S K  +     L  A+ +LD  ++  + VE  ++ER C +R+ +I  E ++K   L + +MQ F  KR+EE++ +  +   +   +  L + + +F ++  +Q ++KQGQVE+E  S  I  F +++LLHRS+IEDLN  I+ LG  K+  M ++KD +K    LEWE R++ ME EDLE+K ++I     +K+ Q +L+  +YD  I+ +IQ +E T+N  +  H + +   +  LK + ++ + K +  N ++   + EL V  +ERKHI      +   ++  + RY +I+QR+ LVDLAK QA+E+  LR+EV+RLRM+TFPAL+Q
Sbjct:  620 SGDPLTALVTEKVVRGS-HLGPGVLCLSPHL-KWISVSGRDGIVYVKDIKNMETVAQVQCHSYHTGGINSLSFSLDGQSIITTGTFDGALVCLQWKSTGSSRLGAAVEYGKAFTLSLQAAMKEENQMLSRMP-EWTADTSSMAVESKEKEYRNLSVDVTEQDTFPNTSADVTWIYRKLEEAKKKETEKYAAEKEIIKTGIKKLRKTIQAMMRENESLPDIEKLDQQEFNLDTEEQERLYLESEKEVARVRQEIELENLSKQYLREVIKQECWDSMAVKGRSVMAFHTGYEVMNYPMKERTPKELEDFARVLNLKKIEAVDLKVRKEIVE-----TQPKIKADDEEEVEEESVSKSQDSSSLVGSLS----------DLYGGDTSYLYSQLILHSREEKINQIILLQDIIHNIKKAFNKDFDIACRQKEQEVTRVKERNNRIQEIMVELNLQEKLLEP--TFTDNEKPERALTVDDSEVKVERYLTPEQKAKAEKLAKEEEAKRLAEQEDNAKQRALDDMMGGVLEVKKEDILRMEVPQPGFI--ARAEAEWTDEEKKQFKEYEKKCKDLSEEKEKYSKVLEAEMKKLQLSVIETTQSFDDVLARLFEKKVKSEMAIYQEELKINNLLFSLLIEEEINTRVAHLAHILDKKRKQKNQTAEIVKSFKTQVLAFRESYDNLVAEDKLLDRGFKKEFSDITSYQVDQLYKLYKRRPRVQRLRTQTDSAA---------PFGERPGSAKANKDSIALLMKAMDELDTPENMPEGVELPVWERFCLARRSKIEYEQQVKIKALVLAEMQAFLDKRIEEDEKIRQDTENIMQELNVLRSEKMKFQLDLTVQFLLKQGQVELE-NSDLIPSFEDAILLHRSVIEDLNSTIRGLGEQKIASMVESKDFRKGIFQLEWEHRKIRMEMEDLEQKSRDISLLHVSKDFQVFLSEQNYDKRISDQIQVLEATLNAQEKQHEKNVKTYKKSLKDL-ETNINKKRTANLDLDKDLQELLVSFSERKHIYDVVGVEQSTEKAAKERYVEIVQRRKLVDLAKIQAQEIIELRTEVDRLRMKTFPALVQ 1657          

HSP 2 Score: 249.98 bits (637), Expect = 5.391e-66
Identity = 158/608 (25.99%), Postives = 297/608 (48.85%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDG-SQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNC-DYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLP-GNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDL---TGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLG 1852
            +++ W  G + + + FI+ +TV Y  G ++ FH  +   Q ++Q  + +    +V+    + A ++  K +P IY Y +P       +K+ A LD    +FSN   YLA  S +PD  L++WN++    LC +       T  + +P+NW  + + SE  +  ++IE C +LY ++   +KLPS       +   + ++     + + + +  Y   +P SA AG+  +  + F+  +  +     + H W+ T DLY GC  G+++ +  +     ++    ++       + P+S +    L+ NIK M F +EG+Y+AG DGV+R      +E+   +E+    +  I ++ F+ +Y  L+I +  GS+ + + + N      + ++  G  +    L  GN Y  +   +G +Q+W V +   +SS+ +N  A +M   P  N   +G   G++  IDA     LR +  ++L+  PV  + F  RGN ++TGA D ++ IL    S SF+VLG     G IL L   ++ ++ +   +A+    +N+     G T+L  F +   +++ PS + +   G F +  ++K++   D P F   LG
Sbjct:    9 LEVRWVQGINKKKVTFINDHTVCYPCGNFIVFHDTNTRKQSFLQCMTGSIGAFSVNTYSEVVAFSDQ-KLHPSIYVYTFPGFVKRVELKEGAQLDYSLIAFSNAAPYLASFSSVPDHVLTIWNWQEGIPLCSQSESQTTYTTLTFNPMNWHQLCLSSETSLIVWNIEICDNLYQLKAMPVKLPS-------EDGTIGVEEENFNSSAPNGVSYYGPVMPKSAVAGLVGEEAEIFIPKEQRKHSVQPSFHCWNATSDLYVGCERGKILTISAETQKVIVLAQKDQD-------ADPLSGV--TLLEGNIKTMAFHKEGLYIAGKDGVLRSCTIKGSEL--KLEDCWSVQESIESISFSPNYKMLSIATCKGSVYLYN-HRNPGETYKVFDVYSGDLLAADFLTFGNKYCLSTDISGHVQLWSVEDGRSVSSLSLNIQATAMACCPSSNYAAVGSSTGHIYFIDAMKIEALRVVQRMRLYCVPVQHIHFDPRGNFLLTGAADRHIFILDARPSHSFEVLGYIVVCGEILTLSSLSSEDSQQTKAMALICP-VNEGKEEKGGTRLEMFSLPLQMLSSPSEYIDE-KGMFKDAMVQKISYDVDQPLFSAVLG 594          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Xenopus
Match: dok4 (docking protein 4 [Source:Xenbase;Acc:XB-GENE-948694])

HSP 1 Score: 436.417 bits (1121), Expect = 5.114e-126
Identity = 334/1013 (32.97%), Postives = 551/1013 (54.39%), Query Frame = 2
Query: 2312 AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGK-DGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNK----TWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPH-LIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHI 5329
            +G+  + L   KV +   H  P +  LS    + ++  G +G++ V DIK+    AQV  H    GG+   +FSLD   I + G  DG             ++    +Y    +      +++ +++ S +  E      S++  +     R  +   +  D+  N     TW  +++ + +++E ++Y   K  I+ GIK +R TIQ M+ ENE L D+EK+D+QEF LD + +++++ + E E+ +V  EIE  NL+KQY+ +VIK+ECWD M VKGRS+ +F T  EV N+P+++R    L+    V+  +KIE  D K RK   E     T  K K        +E      + S    +L+          D    +  +LYSQ+ L +R++KI QIILL+DII+ +K  FNK+F    ++KEQE+ R+KE+N+RI +I+ ++ +   L++P    +  EKPE+ L V+D E+KVERYLT EQ+ K E+    EE ++  E+ DN ++R L+DMMGGVLEVK+ED L+ ++P+P F+   + + +WTDEEKK F+EY+KK K+L++E+EKY K+     +  IN              NL                      +SLL++EE+N R   L  +      +      I+++ K  +   +E YD +VAE+K++D+ F++EF D+     D + KLYK+RPR + L +Q    +         P+  R  S K  +     L  A+ +LD  ++  + VE  ++ER C +R+ +I  E ++K   L + +MQ F  KR+EE++ +  +   +   +  L + + +F ++  +Q ++KQGQVE+E  S  I  F +++LLHRS+IEDLN  I+ LG  K+  M ++KD +K    LEWE R++ ME EDLE+K ++I     +K+ Q +L+  +YD  I+ +IQ +E T+N  +  H + +   +  LK + ++ + K +  N ++   + EL V  +ERKHI
Sbjct:  620 SGDPLTALVTEKVVRGS-HLGPGVLCLSPHL-KWISVSGRDGIVYVKDIKNMETVAQVQCHSYHTGGINSLSFSLDGQSIITTGTFDGALVCLQWKSTGSSRLGAAVEYGKAFTLSLQAAMKEENQMLSRMP-EWTADTSSMAVESKEKEYRNLSVDVTEQDTFPNTSADVTWIYRKLEEAKKKETEKYAAEKEIIKTGIKKLRKTIQAMMRENESLPDIEKLDQQEFNLDTEEQERLYLESEKEVARVRQEIELENLSKQYLREVIKQECWDSMAVKGRSVMAFHTGYEVMNYPMKERTPKELEDFARVLNLKKIEAVDLKVRKEIVE-----TQPKIKADDEEEVEEESVSKSQDSSSLVGSLS----------DLYGGDTSYLYSQLILHSREEKINQIILLQDIIHNIKKAFNKDFDIACRQKEQEVTRVKERNNRIQEIMVELNLQEKLLEP--TFTDNEKPERALTVDDSEVKVERYLTPEQKAKAEKLAKEEEAKRLAEQEDNAKQRALDDMMGGVLEVKKEDILRMEVPQPGFI--ARAEAEWTDEEKKQFKEYEKKCKDLSEEKEKYSKE-----ELKIN--------------NLL---------------------FSLLIEEEINTRVAHLAHILDKKRKQKNQTAEIVKSFKTQVLAFRESYDNLVAEDKLLDRGFKKEFSDITSYQVDQLYKLYKRRPRVQRLRTQTDSAA---------PFGERPGSAKANKDSIALLMKAMDELDTPENMPEGVELPVWERFCLARRSKIEYEQQVKIKALVLAEMQAFLDKRIEEDEKIRQDTENIMQELNVLRSEKMKFQLDLTVQFLLKQGQVELEN-SDLIPSFEDAILLHRSVIEDLNSTIRGLGEQKIASMVESKDFRKGIFQLEWEHRKIRMEMEDLEQKSRDISLLHVSKDFQVFLSEQNYDKRISDQIQVLEATLNAQEKQHEKNVKTYKKSLKDL-ETNINKKRTANLDLDKDLQELLVSFSERKHI 1559          

HSP 2 Score: 248.054 bits (632), Expect = 1.835e-65
Identity = 158/608 (25.99%), Postives = 297/608 (48.85%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDG-SQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNC-DYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLP-GNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDL---TGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLG 1852
            +++ W  G + + + FI+ +TV Y  G ++ FH  +   Q ++Q  + +    +V+    + A ++  K +P IY Y +P       +K+ A LD    +FSN   YLA  S +PD  L++WN++    LC +       T  + +P+NW  + + SE  +  ++IE C +LY ++   +KLPS       +   + ++     + + + +  Y   +P SA AG+  +  + F+  +  +     + H W+ T DLY GC  G+++ +  +     ++    ++       + P+S +    L+ NIK M F +EG+Y+AG DGV+R      +E+   +E+    +  I ++ F+ +Y  L+I +  GS+ + + + N      + ++  G  +    L  GN Y  +   +G +Q+W V +   +SS+ +N  A +M   P  N   +G   G++  IDA     LR +  ++L+  PV  + F  RGN ++TGA D ++ IL    S SF+VLG     G IL L   ++ ++ +   +A+    +N+     G T+L  F +   +++ PS + +   G F +  ++K++   D P F   LG
Sbjct:    9 LEVRWVQGINKKKVTFINDHTVCYPCGNFIVFHDTNTRKQSFLQCMTGSIGAFSVNTYSEVVAFSDQ-KLHPSIYVYTFPGFVKRVELKEGAQLDYSLIAFSNAAPYLASFSSVPDHVLTIWNWQEGIPLCSQSESQTTYTTLTFNPMNWHQLCLSSETSLIVWNIEICDNLYQLKAMPVKLPS-------EDGTIGVEEENFNSSAPNGVSYYGPVMPKSAVAGLVGEEAEIFIPKEQRKHSVQPSFHCWNATSDLYVGCERGKILTISAETQKVIVLAQKDQD-------ADPLSGV--TLLEGNIKTMAFHKEGLYIAGKDGVLRSCTIKGSEL--KLEDCWSVQESIESISFSPNYKMLSIATCKGSVYLYN-HRNPGETYKVFDVYSGDLLAADFLTFGNKYCLSTDISGHVQLWSVEDGRSVSSLSLNIQATAMACCPSSNYAAVGSSTGHIYFIDAMKIEALRVVQRMRLYCVPVQHIHFDPRGNFLLTGAADRHIFILDARPSHSFEVLGYIVVCGEILTLSSLSSEDSQQTKAMALICP-VNEGKEEKGGTRLEMFSLPLQMLSSPSEYIDE-KGMFKDAMVQKISYDVDQPLFSAVLG 594          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Xenopus
Match: dok4 (docking protein 4 [Source:Xenbase;Acc:XB-GENE-948694])

HSP 1 Score: 425.246 bits (1092), Expect = 7.236e-123
Identity = 309/869 (35.56%), Postives = 486/869 (55.93%), Query Frame = 2
Query: 2915 IQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPH-LIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLEL----KTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            IQ M+ ENE L D+EK+D+QEF LD + +++++ + E E+ +V  +IE  NL+KQY+ +VIK+ECWD M VKGRS  +F T  EV N+P+++R    L+    V+  +KIE  D K RK   E     T  K K        +E      + S    +L+          D    +  +LYSQ+ L +R++KI QIILL+DII+ +K  FNK+F    ++KEQE+ R+KE+N+RI +I+ ++ +   L++P    +  EKPE+ L V+D E+KVERYLT EQ+ K E+    EE ++  E     ++R L+DMMGGVLEVK+ED L+ ++P+P F+   + + +WTDEEKK F+EY+KK K+L++E+EKY K LEAE KKL   + +   +FD++L  LF K++  +M+IYQEE+KI  + +SLL++EE+N R   L  +    +   S + QVL              +E YD +VAE+K++D+ F++EF D+     D + KLYK+RPR + L +Q              P+  R  S K  +     L  A+ +LD  ++  + VE  ++ER C +R+ +I  E ++K   L + +MQ F  KR+EE++ +  +   +   +  L + + +F ++  +Q ++KQGQVE+E  S  I  F +++LLHRS+IEDLN  I+ LG  K+  M ++KD +K             +E+E   RK                         I  E++ +EQ    + + H  K D +      + +   I +     E G++ +                      ++  + RY +I+QR+ LVDLAK QA+E+  LR+EV+RLRM+TFPAL+Q
Sbjct:  695 IQAMMRENESLPDIEKLDQQEFNLDTEEQERLYLESEKEVARV--KIELENLSKQYLREVIKQECWDSMAVKGRS--AFHTGYEVMNYPMKERTPKELEDFARVLNLKKIEAVDLKVRKEIVE-----TQPKIKADDEEEVEEESVSKSQDSSSLVGSLS----------DLYGGDTSYLYSQLILHSREEKINQIILLQDIIHNIKKAFNKDFDIACRQKEQEVTRVKERNNRIQEIMVELNLQEKLLEP--TFTDNEKPERALTVDDSEVKVERYLTPEQKAKAEKLAKEEEAKRLAE-----QQRALDDMMGGVLEVKKEDILRMEVPQPGFI--ARAEAEWTDEEKKQFKEYEKKCKDLSEEKEKYSKVLEAEMKKLQLSVIETTQSFDDVLARLFEKKVKSEMAIYQEELKINNLLFSLLIEEEINTRVAHLAHILDKKRKQKSFKTQVLAF------------RESYDNLVAEDKLLDRGFKKEFSDITSYQVDQLYKLYKRRPRVQRLRTQT---------DSAAPFGERPGSAKANKDSIALLMKAMDELDTPENMPEGVELPVWERFCLARRSKIEYEQQVKIKALVLAEMQAFLDKRIEEDEKIRQDTENIMQELNVLRSEKMKFQLDLTVQFLLKQGQVELEN-SDLIPSFEDAILLHRSVIEDLNSTIRGLGEQKIASMVESKDFRKGIFQ---------LEWE--HRK-------------------------IRMEMEDLEQKSRDISLLHVSK-DFQVIFTLLVENIHFIPLIFFVIETGVEQS---------------------TEKAAKERYVEIVQRRKLVDLAKIQAQEIIELRTEVDRLRMKTFPALVQ 1455          

HSP 2 Score: 133.265 bits (334), Expect = 2.697e-30
Identity = 146/625 (23.36%), Postives = 258/625 (41.28%), Query Frame = 2
Query:   32 YFEMDMKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDG-SQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNC-DYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAK-----SASRMISYDFE-LPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNG---SIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTP--VTKL--KFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDL---TGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLG 1852
            YF  + +  W  G + + + FI+ +TV Y  G ++ FH  +   Q ++Q  + +    +V+    + A ++  K +P IY Y +P       +K+ A LD    +FSN   YLA  S +PD  L++WN++    LC +       T  + +P+NW  + + SE  +  ++IE    +Y+ ++K   L SIY P          D  + V +     SA   +SY    +P SA AG+  +  + F+  +  +     + H W+ T DLY GC  G+                       +L IS+   K+  +  K+                DDGV+R      +E+   +E+    +  I ++ F+ +Y  L+I +       IEI+  + ++ +  ++              P +NY A                                         +G   G++  ID       +R+  I  H+T   VT L   F  RGN ++TGA D ++ IL    S SF+VLG       IL L   ++ ++ +   +A+    +N+     G T+L  F +   +++ PS + +   G F +  ++K++   D P F   LG
Sbjct:   12 YFSYNFR--WVQGINKKKVTFINDHTVCYPCGNFIVFHDTNTRKQSFLQCMTGSIGAFSVNTYSEVVAFSDQ-KLHPSIYVYTFPGFVKRVELKEGAQLDYSLIAFSNAAPYLASFSSVPDHVLTIWNWQEGIPLCSQSESQTTYTTLTFNPMNWHQLCLSSETSLIVWNIE----IYV-KSKPNNL-SIYRPVKLPSE----DGTIGVEEENFNSSAPNGVSYYGPVMPKSAVAGLVGEEAEIFIPKEQRKHSVQPSFHCWNATSDLYVGCERGK-----------------------ILTISAETQKVIVLAQKDQ---------------DDGVLRSCTIKGSEL--KLEDCWSVQESIESISFSPNYKMLSIATCKVGVLGIEILFYSFSSLKATAM-----------ACCPSSNYAA-----------------------------------------VGSSTGHIYFIDLMWHMWSQRVACISNHSTVSLVTFLSSSFDPRGNFLLTGAADRHIFILDARPSHSFEVLGYIE----ILTLSSLSSEDSQQTKAMALICP-VNEGKEEKGGTRLEMFSLPLQMLSSPSEYIDE-KGMFKDAMVQKISYDVDQPLFSAVLG 525          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Mouse
Match: Cfap43 (cilia and flagella associated protein 43 [Source:MGI Symbol;Acc:MGI:1289258])

HSP 1 Score: 466.848 bits (1200), Expect = 7.861e-136
Identity = 317/886 (35.78%), Postives = 520/886 (58.69%), Query Frame = 2
Query: 2873 KSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDY---EKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLI-QPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXX-XXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLD----QKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALI 5500
            +  I+RGIK +   I  M+EENE +  + K+D QEF LD D  +++H + E E+ K+  ++E +NLA+ Y+ ++IK+ECW+ M VKGR+L  F     V NFP+++R +  L ++  V++++K EIE  K RK   E    +T+ K+         ++ E            + T  L +Y           +   L SQ++L +R++KI QIILLKDIIY +K  FN EF   Y++KE EI R+KEKN RI +I++D+E+   + QP       EKPE+ LVVED EI  ++Y+   QR K++E     E ER ++ ++ + R+RGL DMMGGVLEVK+ED L+  IP+P F+   K    W+++E+K F+EY+KKVKELN+ER+KY+K LEAE KKL N I ++   FD+ L  LF +++  +M I QEE+KI  I +SLL+DEEL++R + L         E       IQ  +  LD  +E +D +VAE+K++D+ F++EF D+ G   D + KL+K+RPR     +Q        + T   PY  R  S K  +     L  ++ +LD   +  + ++P+++E  C +R+ ++  E+++KQ    + +M  F +KR+EE+  + +   ++   +  L++ + +F VN  +Q+++KQGQVE+E     + ++++++L++++IIEDLN  I+  G  KV  M ++K+  K    +EWE ++M ME EDL ++  +I+    +++ Q+YL   +Y+ +I  +I  MEQTI+ +   H + ++      +   KY N   +      N  +   + E  V V+ER+ I          ++    RY   L++Q L++++K QA ++++L++EVERLRM+TFPALI
Sbjct:  822 RKEIKRGIKELAQVIAMMMEENEKVDIIAKLDEQEFCLDADELERLHDECEEEVAKIRKDVEMHNLAQSYLTELIKEECWNSMAVKGRALKCFHIPYVVDNFPMKERTEEELQELSKVMQQKKTEIECLKLRKEIVEVQATTTIAKKHHEEEEEEEEDEER----------TIKTTSLPNYLLGSLSTDFGADTSLLTSQLDLHSREEKINQIILLKDIIYNIKRNFNSEFDAAYKQKEIEIARVKEKNVRIAEIISDLELEETVWQP--VFEDSEKPERALVVEDDEISFKKYIAPWQRAKIKEVVSTYEMERLQQARISDERQRGLMDMMGGVLEVKKEDILRMVIPQPPFM--AKADALWSEDERKQFKEYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQNFDDHLKRLFERRVKAEMVINQEELKINNIIFSLLLDEELSSREQFLNNYLLKKQEEKTKTAEAIQKAREDLDVFKEHHDMLVAEDKILDRSFKKEFSDILGHQVDVLYKLFKRRPRVHKQKTQ-------ADVTSLVPYGERPGSAKLNKENLAQLMKSMDELDNINNMPEGLDPSVWEHFCSTRRAKVENEYKVKQKAACLLEMTTFLRKRMEEDDVVHHEIEKVFHELIRLQDEKVRFQVNLTVQILLKQGQVELENFQ-LMLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKEVHKGIYQIEWEHKKMEMEMEDLNQRAWDIEMLFFSRDRQKYLNEPNYENVIAIQIGIMEQTISVIDKTHKKNVENCKKLLKKLGKYSNQKDV-----ANYTLSCNLREELVAVSERQDICNEIGSKLTCEKIARERYDNQLKQQKLLNISKQQAEQISILQAEVERLRMKTFPALI 1680          

HSP 2 Score: 181.415 bits (459), Expect = 4.565e-45
Identity = 148/639 (23.16%), Postives = 287/639 (44.91%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCD-YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDN---VEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERP-KSLLNIGHGSFVGIG-VLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMND--PSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPA 1936
            + + W  G+  + ++F++  T+ Y SG +V F + E   +  +Q  +     +  +    + A ++  +  P IY Y++PSL     +K   +LD     FS C  YLA  S +P+F L+LWN+     LC+K     +V+  S +P+NW  + + S + +  ++IE     +  + + +KLP       +D    L +  +    +  + + Y   LP SA AG+  +  + F    D         H W+ + DLY GC +G L+ ++T+ +           K  VL+ +      +   L N +  + + ++GI  +G DGV+     +   I D+   V+   +  G +++L F+ SY  L I +  GS+ I +     E P   LL+   G    +  + PG  Y  T+  +G +    + + N  S I++   A ++  SP      +G  +G +  ++  D  + + IH+  L  +PV  + + +RG  ++ G ++G + ++    S+SF++ G T     IL +   +   +D +V++ V    + D+ G ++L YF + P ++ +  P NF +   G   ++   K     ++      LG          ++    +   +C Y +P 
Sbjct:   35 LSVRWVQGFPSQNVHFVNDQTICYPSGNFVIFINLETKKKTVLQCINGIVGVMATNVPSEVVAFSDR-RFKPVIYIYSFPSLTRKNKLKGDILLDYTLLCFSYCGTYLASYSSLPEFELALWNWEASAILCKKSNPGMDVSQMSFNPMNWHQMCLSSSSAMSVWTIERSNQEHHFRIRSVKLPL------EDAT-FLNEPDMLFPTTLPKDLIYGPVLPLSAIAGLVGEEAETFRPKDDIYPLLHPTMHCWTPSSDLYVGCEEGHLLMINTETL-----------KVTVLQKAEEFPLPDGAPLINPLT-LVYQKDGILASGIDGVI-----YSFIIKDSKYQVKTFLEFDGPVTHLVFSPSYKMLLIQTDKGSVYIYTFG--AEMPLDKLLDACDGKVQAVSFITPGTKYFLTLTSSGEVSTVSLEDCNCTSRIFLKTQATALACSPSSPTAAVGTVDGYVYFLNILDVESPQMIHQAFLSQSPVKIVTYDQRGIFLLVGTEEGNIFVIDARPSKSFQIFGFTETGKDILQISTVSVMESD-VVEVLVLYP-LPDM-GRSRLEYFTL-PVMLPEVVPENFSDE-RGRLKDDLTHKYLYEVEHTLSSAVLGF-----TGSKIFGFCSQVPYICSYVMPV 636          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Mouse
Match: Cfap43 (cilia and flagella associated protein 43 [Source:MGI Symbol;Acc:MGI:1289258])

HSP 1 Score: 305.834 bits (782), Expect = 6.336e-90
Identity = 198/563 (35.17%), Postives = 334/563 (59.33%), Query Frame = 2
Query: 3827 RERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLD----QKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALI 5500
            R+RGL DMMGGVLEVK+ED L+  IP+P F+   K    W+++E+K F+EY+KKVKELN+ER+KY+K LEAE KKL N I ++   FD+ L  LF +++  +M I QEE+KI  I +SLL+DEEL++R + L         E       IQ  +  LD  +E +D +VAE+K++D+ F++EF D+ G   D + KL+K+RPR     +Q        + T   PY  R  S K  +     L  ++ +LD   +  + ++P+++E  C +R+ ++  E+++KQ    + +M  F +KR+EE+  + +   ++   +  L++ + +F VN  +Q+++KQGQVE+E     + ++++++L++++IIEDLN  I+  G  KV  M ++K+  K    +EWE ++M ME EDL ++  +I+    +++ Q+YL   +Y+ +I  +I  MEQTI+ +   H + ++      +   KY N   +      N  +   + E  V V+ER+ I          ++    RY   L++Q L++++K QA ++++L++EVERLRM+TFPALI
Sbjct:   13 RQRGLMDMMGGVLEVKKEDILRMVIPQPPFM--AKADALWSEDERKQFKEYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQNFDDHLKRLFERRVKAEMVINQEELKINNIIFSLLLDEELSSREQFLNNYLLKKQEEKTKTAEAIQKAREDLDVFKEHHDMLVAEDKILDRSFKKEFSDILGHQVDVLYKLFKRRPRVHKQKTQ-------ADVTSLVPYGERPGSAKLNKENLAQLMKSMDELDNINNMPEGLDPSVWEHFCSTRRAKVENEYKVKQKAACLLEMTTFLRKRMEEDDVVHHEIEKVFHELIRLQDEKVRFQVNLTVQILLKQGQVELENFQLML-EYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKEVHKGIYQIEWEHKKMEMEMEDLNQRAWDIEMLFFSRDRQKYLNEPNYENVIAIQIGIMEQTISVIDKTHKKNVENCKKLLKKLGKYSNQKDVA-----NYTLSCNLREELVAVSERQDICNEIGSKLTCEKIARERYDNQLKQQKLLNISKQQAEQISILQAEVERLRMKTFPALI 560          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Mouse
Match: Cfap43 (cilia and flagella associated protein 43 [Source:MGI Symbol;Acc:MGI:1289258])

HSP 1 Score: 219.164 bits (557), Expect = 6.718e-62
Identity = 138/373 (37.00%), Postives = 230/373 (61.66%), Query Frame = 2
Query: 3827 RERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKV 4942
            R+RGL DMMGGVLEVK+ED L+  IP+P F+   K    W+++E+K F+EY+KKVKELN+ER+KY+K LEAE KKL N I ++   FD+ L  LF +++  +M I QEE+KI  I +SLL+DEEL++R + L         E       IQ  +  LD  +E +D +VAE+K++D+ F++EF D+ G   D + KL+K+RPR     +Q        + T   PY  R  S K  +     L  ++ +LD   +  + ++P+++E  C +R+ ++  E+++KQ    + +M  F +KR+EE+  + +   ++   +  L++ + +F VN  +Q+++KQGQVE+E     + ++++++L++++IIEDLN  I+ 
Sbjct:   13 RQRGLMDMMGGVLEVKKEDILRMVIPQPPFM--AKADALWSEDERKQFKEYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQNFDDHLKRLFERRVKAEMVINQEELKINNIIFSLLLDEELSSREQFLNNYLLKKQEEKTKTAEAIQKAREDLDVFKEHHDMLVAEDKILDRSFKKEFSDILGHQVDVLYKLFKRRPRVHKQKTQ-------ADVTSLVPYGERPGSAKLNKENLAQLMKSMDELDNINNMPEGLDPSVWEHFCSTRRAKVENEYKVKQKAACLLEMTTFLRKRMEEDDVVHHEIEKVFHELIRLQDEKVRFQVNLTVQILLKQGQVELENFQ-LMLEYSDAILINKNIIEDLNSVIRA 375          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Mouse
Match: Cfap44 (cilia and flagella associated protein 44 [Source:MGI Symbol;Acc:MGI:1277238])

HSP 1 Score: 75.485 bits (184), Expect = 8.193e-13
Identity = 50/165 (30.30%), Postives = 86/165 (52.12%), Query Frame = 2
Query:   62 NIGYD---HEFIYFIDRNTVVYISG-QYVCFHKEDGSQIYMQLPS-YAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSN-CDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSI 538
            + GYD      +  +D NT++Y++G Q V    +D +QIY+Q  S      + VHP +  FA+AE     PKI  Y YPSL+ + +++D A        F+N  + LA V   PD+T+++W ++ ++ +   K   Q+V   + +P N + +T      I F+ +
Sbjct:  126 SFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQSSSGQGIGAIGVHPKKTYFAVAEK-GSFPKIIIYEYPSLKPYRILRDGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTKAFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEM 289          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Mouse
Match: Cfap44 (cilia and flagella associated protein 44 [Source:MGI Symbol;Acc:MGI:1277238])

HSP 1 Score: 75.485 bits (184), Expect = 8.193e-13
Identity = 50/165 (30.30%), Postives = 86/165 (52.12%), Query Frame = 2
Query:   62 NIGYD---HEFIYFIDRNTVVYISG-QYVCFHKEDGSQIYMQLPS-YAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSN-CDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSI 538
            + GYD      +  +D NT++Y++G Q V    +D +QIY+Q  S      + VHP +  FA+AE     PKI  Y YPSL+ + +++D A        F+N  + LA V   PD+T+++W ++ ++ +   K   Q+V   + +P N + +T      I F+ +
Sbjct:  126 SFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQSSSGQGIGAIGVHPKKTYFAVAEK-GSFPKIIIYEYPSLKPYRILRDGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTKAFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEM 289          
BLAST of cilia- and flagella-associated protein 43 vs. UniProt/SwissProt
Match: sp|Q8NDM7|CFA43_HUMAN (Cilia- and flagella-associated protein 43 OS=Homo sapiens OX=9606 GN=CFAP43 PE=2 SV=3)

HSP 1 Score: 484.182 bits (1245), Expect = 3.907e-141
Identity = 350/1054 (33.21%), Postives = 578/1054 (54.84%), Query Frame = 2
Query: 2375 PQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKD--GIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSS----RADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLI-QPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLD---QKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            P +  LSS  G  + T    G+L + D+     +A    H     G+     S+D   I   G+D   +          H+       Y  ++    + + ++N  L +   + +   + S SE T     + ST  S       D K    W +++  +  ++E   +   +  I++GIK++  TI  M+EEN+ L ++ K+D+QEF LD++  +++H + + E+ K+I ++E +NLAK Y+ ++IK+ECW+ M VKGR+L  F     V NFP++ R    L +++ V++++KIE E  K RK   E      L KQ+        +E ++          NL  + L           +   L SQ+EL +R++KI QIILLKDIIY++K  FN EF   Y++KE EI R+KE+N RI +I+ D+E+   + QP+ E     +     VV+D EI   +++    + K       +E     +     R R L DMMGGVLEVK+ED L+  IP+PAF+   KP   WT+EE+K F++Y+KKVKELN+ER+KY+K LEAE KKL N I ++  AFDE L  LF +++  +M   QEE+KI  + +SLL+DEEL++R K L    T    E       ++ ++  LD  +E YD ++AE+KVMD+ F++EF ++ G   D + KL+K+RPR       I         T   P+     SGK  +     L  A+ +LD   +  + ++P ++   C +R+ ++  E ++KQ   ++ +M  F QKR+EEE+ ++    ++   +  L+  + +F +N  IQ+++KQGQVE+E     + ++++++L++++IIEDLN  I+  G  KV  M ++KD  K+ + +EWE ++M ME EDL +K  +IQ    +++ Q+YL   +Y+ LI+ +I  MEQTI  L   H + ++   +   +L   ++ K I     N  +   + E  V V+ERK I          ++ V+ RY+ ++Q+Q L +++K QA ++++L++EVERLRM+TFPAL+Q
Sbjct:  641 PGLLYLSS-HGLWLITIAKCGILCIRDVYTLETFAWCRSHSHQGHGIQSMRISMDGQNILVNGRDDGTLVYLKWKRFGGHLASEILDYYQKLLISLSSAMDKENHYLSTTPKVSVD--LGSDSEHTKQ---KASTDLSQDELVLTDVKKEIPWIQQKSQEAIKKEVNLFSKKRKEIKQGIKSLSKTILNMMEENDKLENIAKLDQQEFGLDLEELERLHDESQEEVAKMIKDVEMHNLAKSYLAELIKEECWNSMAVKGRALKCFHIPCVVENFPMKARTVEELKELERVLQQKKIEAECLKLRKEIVEAQSGVKLIKQRHEEDDEEEEEEDKTVKYS-----NLPNYLLGSLST--DFGVDTSLLSSQLELHSREEKINQIILLKDIIYKVKTVFNNEFDAAYKQKEFEIARVKERNVRIREIILDLELEEAVWQPEFEDCEKPERTL--VVQDEEITAHKHIKPWHKAKELIVNHEKEHWLLIQDAST-RLRALMDMMGGVLEVKKEDILRMVIPQPAFM--AKPDAVWTEEERKQFKDYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQAFDEHLKRLFERRVKAEMVTNQEELKISNLAFSLLLDEELSSREKFLNNYLTRKQHEKSQTSEAVRKSREDLDVCKEHYDNLLAEDKVMDRSFKKEFSEIPGHQVDILYKLFKRRPR-------ISKQKTHSETTSVVPFGELPGSGKLNKDAFAQLMKAMDELDNISNMPEGLDPLVWNHFCMTRRAKVENEQKVKQKAADLLEMATFLQKRVEEEEKVQQEIERVFHELILLQEEKVRFQLNLTIQILLKQGQVELENFQ-LVLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKDVHKRILQIEWEHKKMEMEREDLNQKAWDIQMLFFSRDRQKYLNEPNYEALISIQIGIMEQTIAVLDKMHKKNVENCKKLLKKLGKFSNQKDIA----NYALSCNLREELVAVSERKDICNAMGSKLTCEKIVKERYENMMQQQKLTNISKQQAEQISILQTEVERLRMKTFPALVQ 1664          

HSP 2 Score: 208.379 bits (529), Expect = 1.737e-52
Identity = 158/637 (24.80%), Postives = 289/637 (45.37%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCD-YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLR--ISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDN---VEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIG-VLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIP 1933
            + + W  G+  + ++F++ NT+ Y  G YV F + E   +  +Q  +     +  +    + A ++  K  P IY Y++P L     +K   +LD    SFS C  YLA  S +P+F L+LWN+     LC+K     +V   S +P+NW+ + + S + +  ++IE     +  + + +KLP      G   N    ++ V   +S  + + Y   LP SA AG+  K  + F    D         H W+ T DLY GC +G L+ ++ D +    +LN  E +  + R    SP++             + + +EG+  +G DG V     +   I D    +E+  + +  + ++ F+ +YT L I +  GS+ I +  +     K +L+   G F  I  + PG  Y  T+  +G + +W + +   +S IY+N  A  +   P      +G E+G++  I  YD  + + +H+  L  + V  + + ++G  ++ G  +G V I++   S SF+++G T     IL +   +    D IV++ V +       G ++L  F + PT++   S  + +  G   +E I K     ++      LG      +S  +Y    +   +C Y +P
Sbjct:   19 LSVRWVQGFPKQNVHFVNDNTICYPCGNYVIFINIETKKKTVLQCSNGIVGVMATNIPCEVVAFSDR-KLKPLIYVYSFPGLTRRTKLKGNILLDYTLLSFSYCGTYLASYSSLPEFELALWNWESSIILCKKSQPGMDVNQMSFNPMNWRQLCLSSPSTVSVWTIERSNQEHCFRARSVKLP---LEDGSFFN----ETDVVFPQSLPKDLIYGPVLPLSAIAGLVGKEAETFRPKDDLYPLLHPTMHCWTPTSDLYIGCEEGHLLMINGDTLQV-TVLNKIEEESPLDRRNFISPVT-------------LVYQKEGVLASGIDGFV-----YSFIIKDRSYMIEDFLEIERPVEHMTFSPNYTVLLIQTDKGSVYIYTFGKEPTLNK-VLDACDGKFQAIDFITPGTQYFMTLTYSGEICVWWLEDCACVSKIYLNTLATVLACCPSSLSAAVGTEDGSVYFISVYDKESPQVVHKAFLSESSVQHVVYDQQGIFLLVGTAEGKVFIINANSSSSFQIIGFTEVAKDILQISTVSLLETD-IVEVMVLSSLPE--AGRSRLEMFTL-PTLLPQVSTTFADERGRLKDEIIHKYLYELEHALSSAVLGF-----QSNQIYGFCSQVPYICSYLLP 618          
BLAST of cilia- and flagella-associated protein 43 vs. UniProt/SwissProt
Match: sp|E9Q7R9|CFA43_MOUSE (Cilia- and flagella-associated protein 43 OS=Mus musculus OX=10090 GN=Cfap43 PE=1 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 5.499e-135
Identity = 317/886 (35.78%), Postives = 520/886 (58.69%), Query Frame = 2
Query: 2873 KSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDY---EKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLI-QPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXX-XXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLD----QKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALI 5500
            +  I+RGIK +   I  M+EENE +  + K+D QEF LD D  +++H + E E+ K+  ++E +NLA+ Y+ ++IK+ECW+ M VKGR+L  F     V NFP+++R +  L ++  V++++K EIE  K RK   E    +T+ K+         ++ E            + T  L +Y           +   L SQ++L +R++KI QIILLKDIIY +K  FN EF   Y++KE EI R+KEKN RI +I++D+E+   + QP       EKPE+ LVVED EI  ++Y+   QR K++E     E ER ++ ++ + R+RGL DMMGGVLEVK+ED L+  IP+P F+   K    W+++E+K F+EY+KKVKELN+ER+KY+K LEAE KKL N I ++   FD+ L  LF +++  +M I QEE+KI  I +SLL+DEEL++R + L         E       IQ  +  LD  +E +D +VAE+K++D+ F++EF D+ G   D + KL+K+RPR     +Q        + T   PY  R  S K  +     L  ++ +LD   +  + ++P+++E  C +R+ ++  E+++KQ    + +M  F +KR+EE+  + +   ++   +  L++ + +F VN  +Q+++KQGQVE+E     + ++++++L++++IIEDLN  I+  G  KV  M ++K+  K    +EWE ++M ME EDL ++  +I+    +++ Q+YL   +Y+ +I  +I  MEQTI+ +   H + ++      +   KY N   +      N  +   + E  V V+ER+ I          ++    RY   L++Q L++++K QA ++++L++EVERLRM+TFPALI
Sbjct:  822 RKEIKRGIKELAQVIAMMMEENEKVDIIAKLDEQEFCLDADELERLHDECEEEVAKIRKDVEMHNLAQSYLTELIKEECWNSMAVKGRALKCFHIPYVVDNFPMKERTEEELQELSKVMQQKKTEIECLKLRKEIVEVQATTTIAKKHHEEEEEEEEDEER----------TIKTTSLPNYLLGSLSTDFGADTSLLTSQLDLHSREEKINQIILLKDIIYNIKRNFNSEFDAAYKQKEIEIARVKEKNVRIAEIISDLELEETVWQP--VFEDSEKPERALVVEDDEISFKKYIAPWQRAKIKEVVSTYEMERLQQARISDERQRGLMDMMGGVLEVKKEDILRMVIPQPPFM--AKADALWSEDERKQFKEYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQNFDDHLKRLFERRVKAEMVINQEELKINNIIFSLLLDEELSSREQFLNNYLLKKQEEKTKTAEAIQKAREDLDVFKEHHDMLVAEDKILDRSFKKEFSDILGHQVDVLYKLFKRRPRVHKQKTQ-------ADVTSLVPYGERPGSAKLNKENLAQLMKSMDELDNINNMPEGLDPSVWEHFCSTRRAKVENEYKVKQKAACLLEMTTFLRKRMEEDDVVHHEIEKVFHELIRLQDEKVRFQVNLTVQILLKQGQVELENFQ-LMLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKEVHKGIYQIEWEHKKMEMEMEDLNQRAWDIEMLFFSRDRQKYLNEPNYENVIAIQIGIMEQTISVIDKTHKKNVENCKKLLKKLGKYSNQKDV-----ANYTLSCNLREELVAVSERQDICNEIGSKLTCEKIARERYDNQLKQQKLLNISKQQAEQISILQAEVERLRMKTFPALI 1680          

HSP 2 Score: 181.415 bits (459), Expect = 3.193e-44
Identity = 148/639 (23.16%), Postives = 287/639 (44.91%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCD-YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDN---VEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERP-KSLLNIGHGSFVGIG-VLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMND--PSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPA 1936
            + + W  G+  + ++F++  T+ Y SG +V F + E   +  +Q  +     +  +    + A ++  +  P IY Y++PSL     +K   +LD     FS C  YLA  S +P+F L+LWN+     LC+K     +V+  S +P+NW  + + S + +  ++IE     +  + + +KLP       +D    L +  +    +  + + Y   LP SA AG+  +  + F    D         H W+ + DLY GC +G L+ ++T+ +           K  VL+ +      +   L N +  + + ++GI  +G DGV+     +   I D+   V+   +  G +++L F+ SY  L I +  GS+ I +     E P   LL+   G    +  + PG  Y  T+  +G +    + + N  S I++   A ++  SP      +G  +G +  ++  D  + + IH+  L  +PV  + + +RG  ++ G ++G + ++    S+SF++ G T     IL +   +   +D +V++ V    + D+ G ++L YF + P ++ +  P NF +   G   ++   K     ++      LG          ++    +   +C Y +P 
Sbjct:   35 LSVRWVQGFPSQNVHFVNDQTICYPSGNFVIFINLETKKKTVLQCINGIVGVMATNVPSEVVAFSDR-RFKPVIYIYSFPSLTRKNKLKGDILLDYTLLCFSYCGTYLASYSSLPEFELALWNWEASAILCKKSNPGMDVSQMSFNPMNWHQMCLSSSSAMSVWTIERSNQEHHFRIRSVKLPL------EDAT-FLNEPDMLFPTTLPKDLIYGPVLPLSAIAGLVGEEAETFRPKDDIYPLLHPTMHCWTPSSDLYVGCEEGHLLMINTETL-----------KVTVLQKAEEFPLPDGAPLINPLT-LVYQKDGILASGIDGVI-----YSFIIKDSKYQVKTFLEFDGPVTHLVFSPSYKMLLIQTDKGSVYIYTFG--AEMPLDKLLDACDGKVQAVSFITPGTKYFLTLTSSGEVSTVSLEDCNCTSRIFLKTQATALACSPSSPTAAVGTVDGYVYFLNILDVESPQMIHQAFLSQSPVKIVTYDQRGIFLLVGTEEGNIFVIDARPSKSFQIFGFTETGKDILQISTVSVMESD-VVEVLVLYP-LPDM-GRSRLEYFTL-PVMLPEVVPENFSDE-RGRLKDDLTHKYLYEVEHTLSSAVLGF-----TGSKIFGFCSQVPYICSYVMPV 636          
BLAST of cilia- and flagella-associated protein 43 vs. UniProt/SwissProt
Match: sp|A8JAF2|CFA43_CHLRE (Cilia- and flagella-associated protein 43 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP43 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 7.064e-14
Identity = 65/249 (26.10%), Postives = 122/249 (49.00%), Query Frame = 2
Query: 4766 LMETLENYRYQFHV---NKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            LM ++   R +  V   + E+QL +  GQVE         D +++ LL R ++E LN  +   G  KV+ +T  KD K+     +WE +   M  +DL  K +++Q    T+++Q  L   + D     E   +E  +   +  HA+ L+ K+ RL+ +  + +     +N E+ + +  L   + E++ + AG    N        R + ++  + L ++A +Q  E+  LR ++E+LR+RT+P  I+
Sbjct: 1442 LMGSITALRSERKVAAYDNEVQLRLLAGQVEAMPPRPASADMSDARLLGRGVVESLNSVVLGKGTKKVELLTAMKDFKRGIYAAQWEAQAADMRLDDLRAKIRDLQLLHVTRDMQTVLKDGE-DRSSALEAANLEALMKQRERLHAKALEDKRRRLRKLA-ADVSSRSAQNQEVAVHLVTLGKVLEEQQRLQAGMQSAN---DQATRRMRSLVTHKKLKEIALAQQNELGELRQQLEKLRLRTYPTFIE 1685          

HSP 2 Score: 70.8626 bits (172), Expect = 1.458e-10
Identity = 84/336 (25.00%), Postives = 145/336 (43.15%), Query Frame = 2
Query: 3485 QKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXX-----------XXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVK--REDELKK-DIPKPAFLIAGKPQEDW------TDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREF--LDVHGSMFDHITKLYKKR 4426
            +K  Q+ LLK  +  ++  FN +F  V   K+ + +RI + N+R+   L D+       P   L           +       +L+V + E+  ERY++  +R K E  + A+E+  ++   DN  ER L  MMGG L  +    DE     +PKPA+L+A   + D       T+E+ +  +E+  K K L +ER K    LE E +        AK A +E+      + +  ++   +E               EL+ RR  L EL++  +                          + A+E++MD+ F++EF   D+H    + + +LY+ R
Sbjct:  920 RKALQVQLLKQKMRDVQAGFNTDFNKVAAAKKADCDRIADLNARLDDTLKDLRKLGAGPPAGLLDERFSLSAQQDTRDNIAATVLMVREEEVGAERYVSPAERAKQEAARKADEDAAKRSAKDNAGERALRQMMGGTLAARGGGHDESNPFSLPKPAWLVALGVEPDAVNPKLITEEQNRELKEWQAKEKSLQEERAKRITVLEMELRT-------AKAAVEELTSEAVERGLLARLGAAKEAHG--------RAASELSERRAALAELESRQA-------------------------QLGADERLMDRNFKKEFAEADIH---LNRLLQLYRAR 1212          
BLAST of cilia- and flagella-associated protein 43 vs. UniProt/SwissProt
Match: sp|E9Q5M6|CFA44_MOUSE (Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.731e-12
Identity = 50/165 (30.30%), Postives = 86/165 (52.12%), Query Frame = 2
Query:   62 NIGYD---HEFIYFIDRNTVVYISG-QYVCFHKEDGSQIYMQLPS-YAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSN-CDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSI 538
            + GYD      +  +D NT++Y++G Q V    +D +QIY+Q  S      + VHP +  FA+AE     PKI  Y YPSL+ + +++D A        F+N  + LA V   PD+T+++W ++ ++ +   K   Q+V   + +P N + +T      I F+ +
Sbjct:  126 SFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQSSSGQGIGAIGVHPKKTYFAVAEK-GSFPKIIIYEYPSLKPYRILRDGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTKAFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEM 289          
BLAST of cilia- and flagella-associated protein 43 vs. UniProt/SwissProt
Match: sp|Q96MT7|CFA44_HUMAN (Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 1.240e-8
Identity = 56/213 (26.29%), Postives = 96/213 (45.07%), Query Frame = 2
Query:   68 GYD---HEFIYFIDRNTVVYISG-QYVCFHKEDGSQIYMQLPSYAATK-LTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKD-----FAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNK--------------YMKLPSIYTPSGQDCNAVLL 634
            GYD      +  +D +  +YI+G Q +  + +   QIY++  S      + VHP +  F +AE     P I  Y YPSL  + V++D     +A +D   F++S  + LA V   PD+TL++WN++ ++ +   K   Q V   + +P   + +T      I F+ +    +   +Q                YM+LP     SG +   +LL
Sbjct:  140 GYDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGVHPHKTYFTVAEK-GSFPDIIIYEYPSLRPYRVLRDGTEKGYAYVD---FNYSG-NLLASVGSNPDYTLTIWNWKEEQPILRTKAFSQEVFKVTFNPDKEEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTITTDIEGYMELPDGKVLSGSEWGNMLL 347          
BLAST of cilia- and flagella-associated protein 43 vs. TrEMBL
Match: A0A267EGY7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002168g2 PE=4 SV=1)

HSP 1 Score: 880.552 bits (2274), Expect = 0.000e+0
Identity = 608/1863 (32.64%), Postives = 986/1863 (52.93%), Query Frame = 2
Query:   53 IEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDG-SQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGV-IKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSG--QDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNES---RCISASHVWSGTG-DLYFGCVDGQLIKLDTDKMHFKMILNP----SENKREVLRISSPISKIENMNLKN------------NIKHMCFAREGIYMAGDD-GVVRLAQQFENEISDNVEEIHQT-KGRISNLKFNYSYTELAIVSSNGSIEIISANENTER----PKSLLNIGHGSFVGIGVLPGNN--YIATMRRNGRLQIWDVNNRNEI-SSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLH-NTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDW-VAMNKVKAKLNQYDSLPEKLQQQLKVIDKLEELNKAGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSD-LEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDK---QFRREFLDVHGSMFDHITKLYKKR-PRNRL---LGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLD-KQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHK 5509
            + W  GYD   ++F+  N V +  G  V FH E   + +  +       +L       +FA+AE+    P+I  Y+YP ++  G  ++  A L++   +FS+ +YL   +G+PDF+L LW++   + L    +    +    +SP+NW+   ++  +K+  + +E C  L+ + +   +LP      G  Q+C+     SRV    S +       +LP SA AG+  ++  EF E +D  +   R    S  WS    D Y GC +G L++ D D+   +++  P    S + R+   I+      E++                +   +  +  G+Y AGD   +V  A    +     VE++     G + +L  N  + +LAI SS G I +++ +++        + L     G FVG   LPG +   +A++R NG +Q+WD N+   + SS+ ++  AAS   +P  N++ +G  +G++  +D   P   R +   +LH   PV K+     G + VT A DG   +     S+SF +LG  S  G + D+ V      D  +Q+   A+ +        + +FEIS  +M +P+ FY    G F++ A+++     D   +GCTL       + P  Y +   +R L  Y +P +   +    + E                      S  ++TPE+ ++  S     S  ++ ++ + ++                      W ++M  V   L Q  ++ E + Q+    +  E+   + N A+         +V  ED ++ +   +S   +  YG +G + VVD++      +V  H  + GGV+ AA SLD   + + G DG   +  V +P+ +  +   D+    S      +   +E  + +    Q   E      +     G+   +S A    N TW   +  +   EED++Y D K+ +R  +  +RS I+ M+++N   SD LE++D  EFELD+D + K   + ++E+  V   I   NLAK+++ +VIK+ECW++M VKGRS+ +F   +EV+N+PLR + +   D++D V KRR IEI++ KDR+     LL S  K Q+         E  + E +E ++  +  T      E+F  +       YSQ EL +R+QKI QI+LL+D I  +K  FNK F +VY+KK+QE+++I+E+N R+ KI++D+ +P  +  DP   ++EKPE L  V D E+ VE+YLT EQ++KL E++ AEE+R R+E+LDNWRERGL+ MMGGVLEV +EDELKKDIPKPAF+I  K + +W +EE+K  E+Y+++V+EL +EREKY+KQLEAE KKL  + +D   +FD+ L  LF+ ++  Q ++  EE+KI R++ +LL++EEL+ R +EL    T     ++ L  +I  ++ ++    E+     ++ + M+K    F++EF ++  +M D + K+YKK+ P+ ++   LG               NPY  R ++  +++  R  L   +++ D ++     ++  +++R C+ R+ +  KE  I  M L + + Q F  KR  E   ++++   L  L E L N R QF  N E+QL+VKQGQVEVE    FI DF +S+LL R ++EDLN +IK LG  KV+ M +AKDSKK F  LEWELR M M+ EDL  K ++I  FK T+E+QRYL+T DYDGLIN+EIQ+++Q I  +K HHA+ ++ KQ RLK +++ K  ++   N  +  ++ E+NV VNER HI              + RY++ILQRQ LVDLAK+QA+EVAVLR+EVERLRMRTFPAL+  K
Sbjct:   21 LSWCQGYDGGKVWFVADNVVCHACGNNVKFHTEGATAAVDFRHELRNLGQLATQQQNRLFAIAESGVLKPRIQVYSYPDMKCVGPPLEGSAELEITALAFSSSEYLYAATGLPDFSLCLWDYGKGRLLARVAMPQVTLVQLLVSPMNWRLAAMLHGSKVTVFEVERCQELFQINSVTHRLPPADAEVGTVQECDPAGAKSRVPTRSSTAGRQRGLVDLPESAVAGLDPEYAAEFEEYRDLATCPERMSGRSLAWSELDRDFYVGCTEGCLVRYDDDRRVIRVLHRPAAGASASPRQPDMIAEEAEDSEDLVAAEPAAPAAAPADPVSFDQLSLSTRGLYAAGDSLHLVTFAPGGGDFYVRGVEQLDSAGSGPVCSLSANIRHAKLAIGSSEGGICLLNVDDSASSSSAATQPLYRCRSGGFVGAASLPGGSGGLVASVRDNGLVQVWDSNSGGALLSSLELDVEAASFAGNPTANVVLVGGRDGSVSAVDLGKPREPRLLCRRQLHQGCPVAKVVVDPTGRLFVTAAADGRAFVGWARPSKSFDILGGVSVPGQVQDMSVCGVGVEDGAIQVLALAK-LPGQNDPGHVTFFEISDELMKNPAQFYGPNRGLFEDSAVKRQAYRLDASGYGCTLF----GGERPRFYTIGKSTRQLLLYPLPTNQKGQQPQQHFE----------------------SQRSVTPESEVAFTSRGPKSSVDLTASLPQRQQLQ-------------GRQGTALWRLSMASVSRHLAQQRAIEEAVNQRPDEDEVPEDQILSANVAAS-------PEVFAEDSEMQLKIHLSKLALLVYGCDGHVTVVDLEKNAIAVKVRAHSYTNGGVLSAALSLDGKSLLTTGYDGSLCRFSVRLPDELS-AKFTDWELAFSSDRMSAITAENEASAGMPTWTQ-PTERPERRVSECDDDGAASGTSSARRVSNSTWLHDQEREALAEEDRKYADKKTELRDRLSEMRSHIKAMVDKNAAESDELERLDPHEFELDLDEQAKFGQETDSEVASVRKRIGLENLAKKFLAEVIKRECWEEMEVKGRSIVTFGAPLEVSNYPLRPQTKEEQDRLDQVAKRRVIEIQEAKDRR----ELLDSHSKDQQ--------AEGADEETQEQQEEQDSITLQGSAAERFGILK---SMFYSQFELHSREQKINQIVLLQDSIRHIKTGFNKAFNEVYKKKDQEMSKIRERNLRVKKIVSDLGLPTAVS-DPNFVAVEKPELLFTVSDSEVTVEKYLTPEQQKKLVEERQAEEDRLRRERLDNWRERGLDKMMGGVLEVHKEDELKKDIPKPAFMI-NKQETEWNEEERKAAEDYERRVRELQEEREKYRKQLEAELKKLQGLTEDNMTSFDQELRQLFSLKVKTQSAVVHEELKIYRLRLALLIEEELSVREQELASQLTKRRAALEDLGPLIDRSRKLVKTQDEQIQYAKSDNEYMEKNFSAFKKEFPEISAAMADTLHKMYKKKLPQLKIKAGLGEAPF-----------NPYGNRPTTASRQEGARQALGQVLREQDDERHMPSGLDAHVWQRFCQLRRAKREKELLIGDMTLALSEFQAFVTKRESEYNQMQSDAENLKLLQEQLANQRAQFANNLEVQLLVKQGQVEVEPRDDFIIDFADSLLLSRGVVEDLNSKIKTLGEAKVRFMEEAKDSKKTFRRLEWELRGMRMDAEDLINKLRDINSFKITREIQRYLSTEDYDGLINSEIQKLDQAIELMKKHHAKMIEMKQARLKELSEVKSGQLAKRNERLDAELEEMNVGVNERVHIEETNAEKRDESHAAKKRYEQILQRQRLVDLAKAQAKEVAVLRAEVERLRMRTFPALVHTK 1806          
BLAST of cilia- and flagella-associated protein 43 vs. TrEMBL
Match: A0A4S2LDV3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007951 PE=4 SV=1)

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 619/1946 (31.81%), Postives = 1001/1946 (51.44%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYM-QLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNP--SENKREVLRISSPISK-----IENMNLKNNIKH-----------------MCFAREGIYMAGDDGVVRL--------------------------AQQFENEISDN------VEEIHQTKGR----ISNLKFNYSYTELAIVSSNGSIEIISAN------ENTERPKSLLNIGHGSFVGIGVL-PGNNYIA-TMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIM-NDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKS--PALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTI--PGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLEELNKAGNKASRLKPTKVFKDVIHEDPQISMLS-SMSGRLVATYGSEGVLRVVDIKDERNWAQ--VPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGI-----PNHV-KISNE------QDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTT-----PITLRGSTRFS---------SRADS-------------KDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIE-----DTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQP--DXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELL-ELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRP-RNRLLGSQIIPNSQMPN------YTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEP---AIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXS-LMETLENYRYQFHVNKEIQLVVKQGQVEVEAASG-FIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLR 5476
            M   W  G     + F+D N +   SG  V F   +  +  + +L S A + L VHPSE  FA++E  K NP+++ Y+YP ++   +++    L++ + +FS+  YL  VSGIPDF LSLW+F     LC+  L    +   S  P+NW+ I        YF+ +E C  + L++ KYM+LP    P G   ++V     +T          +D  LP SA +GV      EF +  DN       S  WS T  ++ GC +G+L+ +D + M  K++LNP  +E+ ++    S+P ++      E M     I+H                 + + + G+  AG DG++R+                          AQ    EI+            H+ +G+    I+ L  + S+  L + S +G I +++ +      E +  P+  L   + SFVG+G+L P    +  T RR+G +  WD      + S+ V E    + VSP+  +  +G  +G L ++D  +PTTLR +  IKL + P+  L+   RG++I+  ADD Y   LSG     F+ LG     G +  L V  +      V +      ++    +T+  ++E++  I+ N P +  ++  G    + IR M L F+ PT    L  P  + +S  P L+AV+   + L  Y +P  P      S++ A    + S  V+   P  +  V   N   T     ++    D       +N      +S      R++ P  +V   +    +  V     Q               D  E+  +   +AS L P  +   ++    ++ +     +  L+A YG +GV+ ++++       +  + +H+  + GV  A F  D   + +CG DG+ ++  + +     P  V K+++E      QD + +++K  T + +Q    K   A E+ GQ +   +++      P+  R ST  S         S A S              +  TW E    +    EDQ Y + +  +R  +  I+  I  M EENE L ++++I RQEFELD+D +  I  D E  IK+   EI+ ++LA Q+   VIK  CWD+M VKGR L +F + +EV NFPLR R +  LD+++ V  RR I+++        +  +YG    +  L   +   +  + ++              +    L      D   P  +  Y Q++L TR+QKIYQI+L++D I+Q+K  FNK F +VYQKK  ++++I+ +  RI KIL DI+ P+  +   DP  S  E+PE LL V D EI  ERYL+  +  +LE  ++AEE+R+R+E  DNWRERGLE+MMGGVLEV++EDELKKD+PKPAFLI GKP   WT ++++++ EY++KV+ELN+EREKY+K LE E K L   ID+ K  FDE ++ LFN  I VQ+++  EE+KI R++W LLV+EEL     EL  +L+     E+++++ I+++ K VL++ +E YD + AE+K+++K FR+EF DVHG  +D+I + +++RP R   + S  I +    N       T  NPYS R +  +     +  L+   ++LD   A +   P   A++ERLCK R+++  KE E+K   L++ D+  F Q+R EE   +  +   L S L  +L++Y ++   + E+QL+VKQGQVEV+   G  + D+++S+L+ R  +E+LN  I   G  KV H+ + K+ KK+F HLEWELRRMLM+YED++ K  +I+ FK T+EVQ+YL TNDYDG+INA++  +E T+N ++  HA+ ++QK+ RL+   + +  K+K EN ++   + ELNV ++E K I+         +     RY+ ++Q+Q L+ LA  QA+E+  LR ++ +LR
Sbjct:    1 MTCRWAQGAKGFELGFLDNNVLCVRSGPTVRFQDAETKKCTLFRLCSNAPSSLVVHPSEPFFAVSELYKTNPRVFVYHYPDMQE-TILRGGGKLELKQTAFSHSCYLVTVSGIPDFLLSLWDFEQGLLLCQVPLNGIYLNTISFCPLNWRWIVATDARCFYFWQVESCNQITLLRCKYMRLPEQSVPLGLYEDSV--QKGITCPDQVPDRTRFDPILPTSAVSGVGEAKQMEFEDYLDNADHVFCVSQTWSNTDLVFIGCKNGELLLVDPNSMTMKVLLNPLTNESLKKNHADSTPETQSIPVTAEAMQSTEAIEHSENEIDSLAIPSGAFQFLLYTKFGLLCAGRDGLLRILRVNSRMIKTPVHIKRTDSSPVSNNYAQLIRTEITSCKILYKFSNPFHENRGQSPPSITGLCVSPSFGRLLLGSRSGQIALLNISCDLGSLEGSLNPEYELLTSNDSFVGLGILGPERTKVCVTARRSGVVNTWDCETGKLLGSLAVGEQCCGVTVSPIIPVAAVGTRSGVLLMVDCSEPTTLRVVESIKLFHNPLIHLEVDARGDLIIAAADDEYSVALSGRPKNKFEPLGFVPITGKVNGLTVMRHGPKKIFVLVTTG---VSTAAAATEFYFYELTLAILYNSPHSVVDSCLG-LRADTIRLMQLHFNIPTISVCLWPPRDDSESAPPTLFAVDSHGKQLLTYILPEEP------SSRPAQALSVHSRAVSAGRPAGSTNVYLGN---TGSGTFAISGRHD---HSGHVNTSSLHHNS------RKTKPTSAVTLRLTPGPIQTVSTADGQ---------------DNTEDNTQHSQRASGLSPLTI-SAILRGTGRVKLTRVGETNSLLALYG-DGVVELLEVSANEVVVKQTIGIHESDHIGVSGAEFCGDFRSLITCGCDGLLARAEITLDSDSQPEPVYKVTSEMFERASQD-SMLLAKLPTHLPKQ----KVLSANELDGQDQVTGQTSGHNVDRPLFYRSSTVMSMAEHSMIVSSSAQSNSEPVEVFPVLSEPNRSTWLETCEKETHALEDQIYDEARQQVRSELTEIKQLINAMAEENEELPEIQRIGRQEFELDVDEQAAILEDTEKAIKQTRQEIQLSDLANQFTWHVIKNRCWDEMRVKGRILRAFGSQLEVCNFPLRSRSREELDRLNAVRTRRTIQVQLAGMFSRMNESVYGASDTRPMLPAGQNEETDEDEEQEV------------VVNRVLAGSIAMDWGGPG-ELCYGQLDLYTREQKIYQIVLVEDNIFQIKEAFNKRFDEVYQKKVSDLHKIRTRLERIRKILVDIQQPNAAKSVIDPSFSPEEQPEMLLTVTDSEITAERYLSPAEVAELEARRVAEEDRRRREMSDNWRERGLEEMMGGVLEVRKEDELKKDVPKPAFLITGKPLVHWTADDRRLYAEYERKVQELNEEREKYRKFLEGEMKTLYAAIDEEKLKFDEQIVALFNDWIRVQIAVVHEELKIWRLKWMLLVEEELFVYENELRQQLEKIGQEEVRIIR-ILESAKEVLEQEKERYDLLCAEDKLLEKNFRKEFADVHGPFYDYIARAFRRRPKRVGPMSSTYIESDAAENSEAILCTTVYNPYSERVAHKRILGQNKKDLEECFRELDNDPAREGQPPLDNAVWERLCKYRRRKFEKEMEVKNNALKLADINAFVQRREEELHAVRTHRETLTSDLDSSLKDY-HRNQTDLELQLLVKQGQVEVDLVEGNLVRDYSDSLLITREQVEELNAHIMKFGEYKVAHLIRNKEFKKRFYHLEWELRRMLMQYEDVQTKLNDIRKFKITREVQKYLQTNDYDGMINAQVITLEHTMNLMRQTHAKAMEQKRRRLRRYQEVQGEKLKAENEKLKTDLNELNVGLHETKFIHDQNRCVGTKRPTGPPRYKLLVQQQRLMQLANEQAKEIKALRKQLAQLR 1884          
BLAST of cilia- and flagella-associated protein 43 vs. TrEMBL
Match: A0A075A1T5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_12647 PE=4 SV=1)

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 615/1962 (31.35%), Postives = 1014/1962 (51.68%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHK-EDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSC--KHFK----------EFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKR------------EVLRISSPISK-----------IENMNLKNNIKH-MCFAREGIYMAGDDGVVRL----AQQFENEI----------SDNVEEI------------------HQTKGR----ISNLKFNYSYTELAIVSSNGSIEIIS------ANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIM-NDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKS----PALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSAL--TPEANMSVESDQD----VMSSRMSLNVEESKKDSIRSGGRRQSNPRL----SVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLEELNKAGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQ--VPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGI-----PNHV-KISNEQ-DYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTT-----PITLRGST---------RFSSRADS-------------KDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXN-----LTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQP--DXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELL-ELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPR------NRLLGSQIIPNSQMPNYTK-NNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEP---AIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNK---EIQLVVKQGQVEVEAASG-FIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLR 5476
            M   W  G     + F+D N +   SG  V F   E       +L S A + L VHPSE   A++E  K NP+++ Y+YP ++   +++    L++ + +FS+  YL  VSGIPDF LSLW+F     LC+  L    +T  S  P+NW+ I        YF+ +E C  + L++ KYM+LP    P G   ++V     +T          +D  LP SA +G+ C  +H            EF +  D+       S  WS T  ++ GC +G+L+ +D + M  K++LNP  NK              ++ +++  ++           I+++ + +   H + + + G+  AG DG++R+    ++  E  I          S+N  ++                  H+ +G+    I+ L  + S+  L + S +G I +++      A E +  P+  L   + SFVG+G+L G     T RR+G +  WD  +   + S+ V E   S+ VS +  +  +G  +G L ++D  +PTTLR +  IKL + P++ L+F  RG++++  ADD Y  +L+G     F+ LG     G + DL +  +      V + +    ++  + +T+L ++E++  ++ N P +  ++  G    + IR M L F+ PT    L   PP + S    P L+AV+   + L  Y +P      +E S + A    + S  V+    ++ V  SN+ L  +     ++    D    V +S +  N   S+K  + +G   +  P L    S  D  D   +++  + LN     P  +   L+                R+K T+V +               +  L+A YG +GV+ ++++       +  + +H+  + GV  A F  D   + +CG DG+ +   + +     P  V K++ E  + A+  SK  T++     + K   A E+ GQ +   +++      P+  R ST           SS A S              +  TW E    +    EDQ Y + +  +R  +  I+  I  M EENE L ++++I RQEFELD+D +  I  D E  +K+   EI+ ++LA Q+   V+K  CWD+M VKGR L +F + +EV NFPLR R +  LD+++ V  RR I+I             L     +  E+    +         +  +   +     +    L      D   P  +  YSQ++L TR+QKIYQI+L++D I+Q+K  FNK F +VYQKK+  + +I+ +  RI KIL DI+ P+  +   DP  S  E+PE LL V D EIK ERYL+  +  +LE  +LAEEER+R++ LDNWRERGLE+MMGGVLEV++EDELKKD+PKPAFLI  KP   WT ++++++ EY++KV+ELN+EREKY+K LE E K L   ID+ K  FDE L+ LFN  I VQ+++  EE+KI R++W LLV+EEL     EL  +L+  +  E  ++++ +++ K VL++ +E YD + AE+K+++K FR+EF DVHG ++D+I++ +++RP+      +  + S    NS     T   NPYS + +  +   + +  L+   ++LD   A +   P   A++ERLCK R+++  KE ++K   L++ D+  F       E+ L     + ++L+  L +    +H N+   E+QL+VKQGQVEV+   G  + D+++++L++R  +E+LN  I   G  KV H+ + K+ K++F HLEWELRRMLM+YED++ K  +I+ FK T+EVQ+YL TNDYDG+INA++  +E T+N ++  HA+ ++QK+ RL+   + +  K+K EN  +   + ELNV+++E K I+         +     RY+ ++Q+Q L+ LA  QA+E+  LR ++ +L+
Sbjct:    1 MTYRWAQGAKGFELGFVDNNVLCVRSGPTVRFQDVETKKSTLFRLCSNAPSSLVVHPSEPYLAVSELYKTNPRVFVYHYPDMQE-TILRGGGKLELKQTAFSHSFYLVTVSGIPDFLLSLWDFEQGLLLCQVPLNGIYLTTISFCPLNWRWIVATDARCFYFWQVESCNQITLLRCKYMRLPEQSAPLGVYEDSV--QKGITCPSQVPDHTRFDPNLPTSAISGMLCSLRHVTCSGVGEAKQMEFEDYLDDADHVFCVSQTWSNTDLVFIGCKNGELLLVDPNSMTMKVLLNPLTNKSLKKNHTDSPPETRIIPVTAEATQSSEVTEHSENEIDSLAIPSGAFHFLLYTKFGLLCAGRDGLLRILRVNSRMIEMPIHTKRTDSAPVSNNCSQLLRTGITSCKILYKFPNPFHENRGQSTPSITRLCVSPSFGRLLLGSRSGQIVLLNISCDLLAIEGSINPECELLTSNDSFVGLGIL-GPEKTKTARRSGVINTWDCESGRLLGSLAVGEQCFSVTVSSVIPVAAVGTRSGVLLMLDCSEPTTLRVVESIKLFHNPLSHLEFDARGDLLIAAADDEYSVVLAGRPKNKFEPLGFVPITGKVNDLTIMRHGPKKIFVLVTMG---LSTSSAATELYFYELTLAMLFNSPHSVVDSCLG-LRADTIRLMQLHFNIPTISVCLW--PPRDDSVSAPPTLFAVDSRGKQLLTYVLP------EEPSARPAQTLSIHSRAVSS---SRPVGSSNAHLGHSGSGTFAISGRHDHSGHVGTSLLRYN---SRKTKLTTGLTLRLTPALIQTISTADGQDNTELSQKASDLN-----PLTVSAILR-------------GTGRVKLTRVGE---------------TNCLLALYG-DGVVELLEVSANEVVVKQTIGIHESDHIGVSGAEFCGDFRSLITCGCDGLLACTEITLDSDSQPEPVYKVTTEMLERASQDSKLLTELPTHVPKQKVLSANELDGQNQVPGQTSGHNADRPLFYRSSTVMSMAEPSMTLSSSAQSNSEPVEVFPVLSEPNRSTWLETCEKETHALEDQIYDEARQQVRSELAEIKQLINAMAEENEELPEIQRIGRQEFELDVDEQAAIVEDTEKAVKQTRQEIQLSDLANQFTWHVLKNRCWDEMRVKGRILRAFGSQLEVCNFPLRSRSREDLDRLNAVRTRRTIQIH------------LAGMFSRMNESAFGASDTPLMLPAGQNEEPDEDDEQEVVVNRVLAGSIAMDWGGPG-ELCYSQLDLYTREQKIYQIVLVEDNIFQIKETFNKRFDEVYQKKDSGLQKIRTRLERIRKILVDIQQPNAAKSVIDPAFSPEEQPELLLTVTDSEIKAERYLSPAEIAELETRRLAEEERRRRDMLDNWRERGLEEMMGGVLEVRKEDELKKDVPKPAFLITRKPLVHWTADDRRLYAEYERKVQELNEEREKYRKFLEGEMKTLYAAIDEEKLKFDEQLVALFNDWIRVQIAVVHEELKIWRLKWMLLVEEELFVHENELRQQLEKIDQEEAGIIRT-LESAKEVLEQEKEGYDLLCAEDKLLEKNFRKEFADVHGPLYDYISRAFRRRPKRIGPVSSTHIESDTGENSDAILCTNVYNPYSEKAAHKRILGYTKKDLEECFRELDNDPAREGQPPLDNAVWERLCKYRRRKFEKEMQVKNNALKLADINAFV---QRREEELRAVRARRETLINNLNSSLKDYHRNQTDLELQLLVKQGQVEVDLVEGNLVRDYSDALLINRDQVEELNAHIIKFGEYKVAHLIRNKEFKRRFYHLEWELRRMLMQYEDVQTKLNDIRKFKITREVQKYLQTNDYDGMINAQVVTLEHTMNLMRQTHAKAMEQKRRRLRRYQEVQGEKLKAENENLKTDLKELNVELHETKFIHDQNRCVGTKRPTGPPRYKLLVQQQRLMQLANEQAKEIKTLRKQLAQLQ 1889          
BLAST of cilia- and flagella-associated protein 43 vs. TrEMBL
Match: A0A1S3HJT7 (cilia- and flagella-associated protein 43 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106155816 PE=4 SV=1)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 433/1077 (40.20%), Postives = 660/1077 (61.28%), Query Frame = 2
Query: 2366 HEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQH--HVGIPNHVKISNEQDYANVISKFDTKILQ-QNSELKSFLAIEIQGQVESISES------------------TTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQ------KETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNY--TKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQ-DAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQ-GFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            H+ P   ++ S   + VA+YG +G + +  + D  +  Q+  H   +GGV    FS DS  +Y+ G DGI + +   +      K  +  + A  I   + +  Q +++ L+S        +   ++ +                  TTP  + G            + TW + +     +EED++Y + K  +R  IK +R TIQ+M++ENEGL D EK+ R EF+LDID +  +  + + E+ ++ +EIE  +LAK+Y+  +IK ECWD+M VKGRS+ +F ++ EV+NFP++ R +  LD++D V  RR +EI + + R+   E   K+    Q       ET      +  E  + E      + TT  L       K     K LYSQ EL TR+QK  QIILL+D+I+++K+ FNKEF + YQKKEQE+ +I+++N RI KIL+D++M   +  D  +S LEKPE+LLVVED E+KVE+Y T +QR+KLEE+   EEER+ +EK DN RER L+ MMGGVLE+K+EDELKKD+P PAF I  KP++DWT+EE+KI +EY+KKVKEL +EREK++KQLE E KKL  +  D +  FDE L  LF +++   M IYQEE+KILR+Q+SLL++EEL  R KEL  L     +   +    +   +  +DE +E+YD +VAE+KV+DK F+REF DV     D + KL+++RPR    G   + + + P Y     NP++ R S+ +Q    + ++++A+Q+LDK+ +  + V+  ++ERLC+ R+++I  E  +KQ  L + +M+ GF ++RL+E++ L+ +  ++   +E L+    QF+ N E QLV+KQGQVEV+  + FIHDF +S+L+HRS++E+LN +IK LG  K+  M  +KD +K  I LEWE ++ +M+ EDL+RK ++I   K T+++Q +L   D++     E   +EQTI   K HH + +++ +  +K +  + + + + EN  +   + ELNV VNER HIN     D  G    + RYQ+I+QR+ LVDLAK+QA+EVAVLR+EVERLRMRTFPAL+Q
Sbjct:  656 HQLPGGRLIMSPHNKWVASYGPDGKIYIRTVGDMDHPLQLSPHDYRHGGVRHMTFSGDSQMLYTVGYDGIMACYKWRLTQSGQAKAKSAIESARAIRTNNMQTQQTEDAMLQSMKEWSPSSESRPVTTAPKEETEQLEKEQSTEEVYTTPTPVPGH-----------DSTWLQAQELMSIKEEDKEYAEVKKQLRLEIKDMRKTIQKMMQENEGLPDTEKLGRHEFDLDIDEQIHLQQEADNEVARIREEIEFEDLAKRYVTHIIKTECWDEMVVKGRSIEAFISSYEVSNFPMKKRSKRELDELDKVTARRAVEIAEVQSRRELTEVSQKTATFSQMLKESANETAQGTEDELNETDDVEAQSKDDSATTGSLSA-----KYGGGSKMLYSQFELHTREQKQAQIILLQDVIHRIKLAFNKEFDETYQKKEQEVAKIRDRNKRIRKILDDLDMVETVT-DFSMSILEKPERLLVVEDSEVKVEKYYTPQQRKKLEEEARIEEERRAREKGDNARERALDMMMGGVLEIKKEDELKKDVPIPAF-IQTKPEDDWTEEEQKIAKEYEKKVKELQEEREKFRKQLEMELKKLQTLNQDTEENFDEALKQLFVRRVKTDMVIYQEELKILRLQYSLLIEEELETRDKELCRLLEHKKMLKTLSAQTVAEARKHVDEFREKYDILVAEDKVIDKVFKREFNDVPAVQLDQLYKLFRRRPRG---GRVNLKDRETPIYDPKSGNPFADRPSTARQNAMNKVSMESALQELDKESNMPEGVQLYVWERLCRYRRQKIDSEQLVKQKALVLAEMENGFLRRRLDEDEQLKRDIEEITIAIEKLKEDVIQFNTNLEAQLVLKQGQVEVDPGN-FIHDFRDSILIHRSVVEELNGKIKQLGEGKIASMVDSKDFRKGIIQLEWEHKKNIMQIEDLQRKMRDINMMKVTRQIQSFLNEEDHEAKRAQEAAVLEQTIMMQKKHHEKNVEEHKKIVKDLKKA-IQQREEENKSLERDLEELNVSVNERSHIN-DVNADKTGDGGRDRRYQEIVQRRKLVDLAKAQAQEVAVLRAEVERLRMRTFPALVQ 1708          

HSP 2 Score: 325.479 bits (833), Expect = 3.274e-86
Identity = 184/655 (28.09%), Postives = 329/655 (50.23%), Query Frame = 2
Query:   53 IEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPS---------ENKREVLRISSPISKIENMNLKNNI---------KHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGR--ISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDE 1957
            + W  GYD    +FID++T+ +  G  V F KE+G ++    P      L VH    +FA ++ +   PK++ Y++P LE   V++  A L+    +FS  DYLA VSG+P+F L++W++    KLC   L     T  SI+P  W+ I + ++N +  Y +E     YLM+     LP       +D  A + +      ++++R+     ELP +A AG+  +  + + + QD+  R +  SH W+  GDLY GC  GQL+K+D +    K++  P          E  +  L+++  +S + +M+L + +         + M   + G++  G DG +R   + E +  DNV+ +  T     IS++ F+ ++ +LA+ SS G++ +    EN    K + +I HG+FV +  L G ++  ++R +G LQ+W V+       I + + A S+  SPL ++  +G E G L  ID  D    R +++ ++H  PV  + F K G  I T +DDG V ++    S++F+V+G T+  G +  + +F++  + +I  +  S    +   G+T  V F+I+  +  D    + ++   F ++AI KM LT   P++G  +           +Y +   ++ + K  +P   P +DE
Sbjct:    9 LSWAKGYDGNNTHFIDKSTICFACGHNVTFVKENGEEMVFPSPGEGVGTLAVHSVNKVFAFSD-LSLPPKVFVYSFPGLEQKAVLQGGAQLEYSAIAFSASDYLATVSGLPEFELAVWDYIKGNKLCTVSLPHITPTGVSINPAKWRQICVTTDNALTLYHVEQSDEHYLMKPSKTNLPV------EDSMATIEEEGRMPTRASTRLTKMTVELPKAAVAGLVGEMAERWDDLQDHRPRVVPKSHCWTPVGDLYVGCEGGQLLKVDGETHVAKVMYTPGPKAAAPPSREPSQSSLKLTKKVS-MADMDLNSAMMNIVPEGAFRTMALHKTGLFAGGLDGTLR---KLEVK-GDNVKVVETTPVGLPISSMSFSSTFNKLALGSSRGALHVYDL-ENPGSTKEIFDIHHGNFVAVDSLAGCDHCVSVREDGELQVWRVDTSQMEGFIPIGQMATSLACSPLLHMAVVGTELGYLFFIDLNDTKNPRPVYQYRIHTGPVNHIVFDKNGRFIFTASDDGNVFVIDSRASKNFEVVGHTAVAGDVQSISMFSSEGSRDIKVVVTSNNTGHKRLGATIAVVFDITDKLTRDFKLAHASLKKNFRDDAINKMVLTLTVPSYGAAI------TNGGVMYTISQTNKMIHKMILPEERPPRDE 644          
BLAST of cilia- and flagella-associated protein 43 vs. TrEMBL
Match: A0A1S3HML2 (cilia- and flagella-associated protein 43 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106155816 PE=4 SV=1)

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 429/1071 (40.06%), Postives = 658/1071 (61.44%), Query Frame = 2
Query: 2366 HEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQH--HVGIPNHVKISNEQDYANVISKFDTKILQ-QNSELKSFLAIEIQGQVESISES------------------TTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNY--TKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQ-DAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQ-GFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQ 5503
            H+ P   ++ S   + VA+YG +G + +  + D  +  Q+  H   +GGV    FS DS  +Y+ G DGI + +   +      K  +  + A  I   + +  Q +++ L+S        +   ++ +                  TTP  + G            + TW + +     +EED++Y + K  +R  IK +R TIQ+M++ENEGL D EK+ R EF+LDID +  +  + + E+ ++ +EIE  +LAK+Y+  +IK ECWD+M VKGRS+ +F ++ EV+NFP++ R +  LD++D V  RR +EI + + R+          L +  +  +    +  E  + E      + TT  L       K     K LYSQ EL TR+QK  QIILL+D+I+++K+ FNKEF + YQKKEQE+ +I+++N RI KIL+D++M   +  D  +S LEKPE+LLVVED E+KVE+Y T +QR+KLEE+   EEER+ +EK DN RER L+ MMGGVLE+K+EDELKKD+P PAF I  KP++DWT+EE+KI +EY+KKVKEL +EREK++KQLE E KKL  +  D +  FDE L  LF +++   M IYQEE+KILR+Q+SLL++EEL  R KEL  L     +   +    +   +  +DE +E+YD +VAE+KV+DK F+REF DV     D + KL+++RPR    G   + + + P Y     NP++ R S+ +Q    + ++++A+Q+LDK+ +  + V+  ++ERLC+ R+++I  E  +KQ  L + +M+ GF ++RL+E++ L+ +  ++   +E L+    QF+ N E QLV+KQGQVEV+  + FIHDF +S+L+HRS++E+LN +IK LG  K+  M  +KD +K  I LEWE ++ +M+ EDL+RK ++I   K T+++Q +L   D++     E   +EQTI   K HH + +++ +  +K +  + + + + EN  +   + ELNV VNER HIN     D  G    + RYQ+I+QR+ LVDLAK+QA+EVAVLR+EVERLRMRTFPAL+Q
Sbjct:  656 HQLPGGRLIMSPHNKWVASYGPDGKIYIRTVGDMDHPLQLSPHDYRHGGVRHMTFSGDSQMLYTVGYDGIMACYKWRLTQSGQAKAKSAIESARAIRTNNMQTQQTEDAMLQSMKEWSPSSESRPVTTAPKEETEQLEKEQSTEEVYTTPTPVPGH-----------DSTWLQAQELMSIKEEDKEYAEVKKQLRLEIKDMRKTIQKMMQENEGLPDTEKLGRHEFDLDIDEQIHLQQEADNEVARIREEIEFEDLAKRYVTHIIKTECWDEMVVKGRSIEAFISSYEVSNFPMKKRSKRELDELDKVTARRAVEIAEVQSRR---------ELTEVSQKTAGTEDELNETDDVEAQSKDDSATTGSLSA-----KYGGGSKMLYSQFELHTREQKQAQIILLQDVIHRIKLAFNKEFDETYQKKEQEVAKIRDRNKRIRKILDDLDMVETVT-DFSMSILEKPERLLVVEDSEVKVEKYYTPQQRKKLEEEARIEEERRAREKGDNARERALDMMMGGVLEIKKEDELKKDVPIPAF-IQTKPEDDWTEEEQKIAKEYEKKVKELQEEREKFRKQLEMELKKLQTLNQDTEENFDEALKQLFVRRVKTDMVIYQEELKILRLQYSLLIEEELETRDKELCRLLEHKKMLKTLSAQTVAEARKHVDEFREKYDILVAEDKVIDKVFKREFNDVPAVQLDQLYKLFRRRPRG---GRVNLKDRETPIYDPKSGNPFADRPSTARQNAMNKVSMESALQELDKESNMPEGVQLYVWERLCRYRRQKIDSEQLVKQKALVLAEMENGFLRRRLDEDEQLKRDIEEITIAIEKLKEDVIQFNTNLEAQLVLKQGQVEVDPGN-FIHDFRDSILIHRSVVEELNGKIKQLGEGKIASMVDSKDFRKGIIQLEWEHKKNIMQIEDLQRKMRDINMMKVTRQIQSFLNEEDHEAKRAQEAAVLEQTIMMQKKHHEKNVEEHKKIVKDLKKA-IQQREEENKSLERDLEELNVSVNERSHIN-DVNADKTGDGGRDRRYQEIVQRRKLVDLAKAQAQEVAVLRAEVERLRMRTFPALVQ 1693          

HSP 2 Score: 325.094 bits (832), Expect = 4.232e-86
Identity = 184/655 (28.09%), Postives = 329/655 (50.23%), Query Frame = 2
Query:   53 IEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPS---------ENKREVLRISSPISKIENMNLKNNI---------KHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGR--ISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDE 1957
            + W  GYD    +FID++T+ +  G  V F KE+G ++    P      L VH    +FA ++ +   PK++ Y++P LE   V++  A L+    +FS  DYLA VSG+P+F L++W++    KLC   L     T  SI+P  W+ I + ++N +  Y +E     YLM+     LP       +D  A + +      ++++R+     ELP +A AG+  +  + + + QD+  R +  SH W+  GDLY GC  GQL+K+D +    K++  P          E  +  L+++  +S + +M+L + +         + M   + G++  G DG +R   + E +  DNV+ +  T     IS++ F+ ++ +LA+ SS G++ +    EN    K + +I HG+FV +  L G ++  ++R +G LQ+W V+       I + + A S+  SPL ++  +G E G L  ID  D    R +++ ++H  PV  + F K G  I T +DDG V ++    S++F+V+G T+  G +  + +F++  + +I  +  S    +   G+T  V F+I+  +  D    + ++   F ++AI KM LT   P++G  +           +Y +   ++ + K  +P   P +DE
Sbjct:    9 LSWAKGYDGNNTHFIDKSTICFACGHNVTFVKENGEEMVFPSPGEGVGTLAVHSVNKVFAFSD-LSLPPKVFVYSFPGLEQKAVLQGGAQLEYSAIAFSASDYLATVSGLPEFELAVWDYIKGNKLCTVSLPHITPTGVSINPAKWRQICVTTDNALTLYHVEQSDEHYLMKPSKTNLPV------EDSMATIEEEGRMPTRASTRLTKMTVELPKAAVAGLVGEMAERWDDLQDHRPRVVPKSHCWTPVGDLYVGCEGGQLLKVDGETHVAKVMYTPGPKAAAPPSREPSQSSLKLTKKVS-MADMDLNSAMMNIVPEGAFRTMALHKTGLFAGGLDGTLR---KLEVK-GDNVKVVETTPVGLPISSMSFSSTFNKLALGSSRGALHVYDL-ENPGSTKEIFDIHHGNFVAVDSLAGCDHCVSVREDGELQVWRVDTSQMEGFIPIGQMATSLACSPLLHMAVVGTELGYLFFIDLNDTKNPRPVYQYRIHTGPVNHIVFDKNGRFIFTASDDGNVFVIDSRASKNFEVVGHTAVAGDVQSISMFSSEGSRDIKVVVTSNNTGHKRLGATIAVVFDITDKLTRDFKLAHASLKKNFRDDAINKMVLTLTVPSYGAAI------TNGGVMYTISQTNKMIHKMILPEERPPRDE 644          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Cavefish
Match: cfap43 (cilia and flagella associated protein 43 [Source:ZFIN;Acc:ZDB-GENE-080815-3])

HSP 1 Score: 540.421 bits (1391), Expect = 2.006e-165
Identity = 368/1055 (34.88%), Postives = 623/1055 (59.05%), Query Frame = 2
Query: 2375 PQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCG-KDG--IFSQHHVGIPNHVKISNEQDY-ANVISKFDTKILQQNSELKSFLAIEIQG----QVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEI-QVLKS----IIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDK-QDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPAL 5497
            P I  LS     L A+ G +G+LR+ D+     + Q   H    GGV   +F+ DS  + + G +DG  + S+  +    + K +    Y  +++  F+  IL +N  L     +E+Q         +SES+  +T +  +  S  + S  + TW +++++   +EE QQ+   + SIR G+K +R TIQ M++ENE L D+EK++  EF LD++ +K++ A+ E E+ +V  EIE  NLAK+Y  +V+KKE WDQM VKG+++ +F +  EV N+P+++R    L+++  V   R+ E+ ++  ++   E   K  ++ +++  +  ++ +              LT         F+       +LYSQ+ ++TR+QK+ QI LL+D+IY++K  FN+EF  VY++KEQEI+R++++N RI  I+ ++E+  ++  +P L+  E+PE+ L V D EIKVE+YLT EQ  + E+ +  EE+R+   K DN R+R L  MM GVLE+K+ED L+ ++P+P F+   KP+  WT+EE++ ++EY+KK KEL +E+EKY+K LEAE KKL   I DA   FD  L  LF K++   M+++QEE+KI  + +SL+++EE+  R K L     +  LE+ ++LK+     ++  +  ++E Q+ YD  VA++K++DK FR+EF DV   + D + KLYK+RPR +   +Q    S         P S R   G+        +  A+++LD  +   + ++  ++ER C +R+ ++  E ++K   L + +MQ F Q R +E++NL+     L++ +  L   R +F  +  +Q+V+KQGQVE+E+   FI D++++VLLHRS++E+LN  I+ LG  K+  M + K+ +K  I  EWE +RM M+ EDL  K K+IQ     +E+Q YL+ +DYD  ++ ++  +E+T    +  + +K++  +  +K +N   ++K K +   + +Q+  + V V ER+ I      +   +  V+ RYQ IL+R+ L++LA++Q  E+A LR+EVERLR +TFPAL
Sbjct:  234 PAIVNLSPHQDWL-ASVGRDGLLRICDVSSLEIYVQHQCHSSWLGGVCSVSFTPDSQTVITTGLRDGSLVCSKLRLKTSGNSKANTATQYRLSMVESFEELILSENPVLSRMTDLELQAPHTPHTAEVSESSH-VTNKDESNMSQPSASSSHFTWLDEKLDAVLKEESQQFAGNRESIRNGLKELRETIQAMMQENESLPDMEKLELHEFNLDVEEQKRLQAEGEQEVDRVRKEIELENLAKRYQREVLKKEFWDQMKVKGKAIKAFHSEHEVQNYPMKERTAKELEELHRVETIRQTELSESNLQQETSEEKSKPPVEGEEKDEAEGDAAQSLA-----------LTGSLSPQCGGFNP------YLYSQISIQTREQKLNQITLLQDVIYKVKTAFNEEFEAVYKQKEQEISRVRDRNKRITDIMTELEVQEVLW-EPTLTDNERPERALTVSDSEIKVEKYLTPEQMEREEQQRKEEEQRQLATKGDNIRDRALVYMMDGVLELKKEDILRMEVPQPEFMT--KPEVQWTEEERRSYKEYEKKTKELREEQEKYRKILEAEIKKLQTSIKDATQGFDGTLSKLFEKKVKSDMAVHQEELKIANLAYSLMIEEEILNREKHL-----TYKLEMARILKNDMGDGLKRHREDVEEFQKIYDIAVADDKLLDKGFRKEFADVPRYLVDQLYKLYKRRPRVQRFRTQTDSTS---------PSSIRPLLGQAAAEGSLDMMKAMEELDAPEHMPEDLDLPVWERFCLARRAKVESEQQVKMKALTLAEMQAFLQNRTDEDENLQMEIKTLNNELNGLREERMRFCRDPMVQIVIKQGQVELESGD-FIADYSDAVLLHRSVVEELNSVIRALGEQKIAGMIERKEIRKGIIQQEWEHKRMTMQMEDLSNKAKDIQRLHLNQEIQEYLSESDYDNRMSKQVSALEKTSTLQEKTYQKKIENCKKLIKQLNRQAVLK-KEKCAALDLQVVSMEVAVAERRKIYEATATEESQEDEVKQRYQDILRRKKLLNLAEAQTEELAALRAEVERLRRKTFPAL 1250          

HSP 2 Score: 58.9214 bits (141), Expect = 6.596e-8
Identity = 24/92 (26.09%), Postives = 49/92 (53.26%), Query Frame = 2
Query: 1349 ASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDL 1624
             S+   P+   + +G   G++  ++       R +H + L+  PV+ L F + GN+++TGA + ++ +L    S++F+V+G T   G  + L
Sbjct:   15 TSLACCPIAQYVAVGTVTGHVLFVELTRKEEPRLVHSVHLYQVPVSHLVFDQGGNVLITGASEPHIFVLDARPSKAFEVIGYTVTIGATVSL 106          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Cavefish
Match: ENSAMXT00000056978.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:9634292:9640142:1 gene:ENSAMXG00000040500.1 transcript:ENSAMXT00000056978.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.151e-16
Identity = 42/168 (25.00%), Postives = 90/168 (53.57%), Query Frame = 2
Query:  359 YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKM 862
            YLA  S +PD+T+++WN+  +  +C   L  ++++  + +PVNW+ I   +   +  ++IE    +++M+   + LP+       D +AV+ +  ++   S  ++  Y  ++P SA AG+S    + F+     +SR   ++  WS +  LY G  +G L+ ++++ +
Sbjct:   10 YLACCSSLPDYTITVWNWESEAPVCTHPLTEEDISTLAFNPVNWQQICAANSRSVTVWNIEKSNDVHIMKPSVVDLPA------ADGSAVVRE-VISSHGSNGKLTYYGPQMPTSAIAGLSGDRAENFVPQGQVKSRLCPSAICWSASSQLYVGTREGFLLLINSETL 170          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Cavefish
Match: ENSAMXT00000015124.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:22307665:22331761:1 gene:ENSAMXG00000014682.2 transcript:ENSAMXT00000015124.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 1.453e-8
Identity = 45/174 (25.86%), Postives = 83/174 (47.70%), Query Frame = 2
Query:   47 MKIEWNIGYD---HEFIYFIDRNTVVYISG-QYVCFHKEDGSQIYMQLPSYAATKLTV-HPSENIFALAETVKQNPKIYFYNYPSLENFGVIKD-----FAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSI 538
            +++  + GYD      +  +D +T+ +++G   V        Q Y++  S     + + HPS+   A+AE  +Q P I  Y YPSL  + +++      ++ LD  +    +   LA V   PD+ L+LW++R ++ +   K   Q+V   S SP N + +T      I F+ +
Sbjct:   36 LQLSHSFGYDCKRRANLQLLDESTLAFVAGNMLVLLDIHTKEQRYIRSCSGGGIGIIMSHPSKKYVAVAEKGEQ-PNIIIYEYPSLRPYRILRGGTGQAYSYLDFNR----DGTLLASVGSAPDYLLTLWDWRQEQVMLRSKAFSQDVYRVSFSPDNPEQLTTSGSGHIRFWKM 204          

HSP 2 Score: 54.6842 bits (130), Expect = 1.209e-6
Identity = 49/216 (22.69%), Postives = 98/216 (45.37%), Query Frame = 2
Query: 1178 NTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSP-----LWNIIGIGLENGNLEIIDAYDPTTLRRI--------------HEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEI-SPTIMNDPSNFY 1765
             T+ P+ L +   GS  G+ V   ++ +AT   +  ++I+D  ++ E+++        S+  +P       +++ +G E+G + +++ Y+P +L  I                +K H+ PVT + + + G I+ TG+ D   T+    V E ++ +G  +  G +   C+   P + E   + V+ Q     TG   +V  E   P   N+ S F+
Sbjct:  345 QTQDPECLFSFHAGSIEGMDVSGSSHLMATTALDRTVRIYDFLSKEELTTTRFTMGGTSLTWAPHVVSSSESVLVVGFEDGVVRLLELYNPHSLHSIAGRTLSGNAELRLQQALKPHSAPVTAISYERSGTIMATGSVD--CTVFFFAVGEKYEPIGFINVPGPV--QCLQWAPQSHERNTLLVACQ-----TGH--VVEVEAPGPEAQNESSTFH 549          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Nematostella
Match: EDO42783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0R4])

HSP 1 Score: 160.229 bits (404), Expect = 4.536e-42
Identity = 109/421 (25.89%), Postives = 197/421 (46.79%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSL-ENFGVIKDFAVLDVLKFSFS-NCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPS----ENKREVLRISSPISKIENMNLKNNIKHM-----------CFA--REGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPG 1249
            +++ W  GYD     +I+++TV ++ G  + F + +D S+ ++  P      L  +P  +++A  E  K +P+I+ Y +P   E   ++K  A L     +F+ N   LA  SG+PDF L++WN+  Q  LC   +  Q  T+ S +P+NW+ +  I    +  ++IE     Y   +  M+LP      G   +    +   ++++      S  F L  +A  G+     KEF E  +   RC+  SH W+  G ++ GC  GQL+ +DT+    ++I  P+    + + E L     +  ++     +N   +           C A  ++G+Y  G DG++R      +E++  V E   T   I++L ++  Y+ LAI SS GS+++    +   +   L ++     VGI  L G
Sbjct:    7 LELRWAQGYDGGSATYINKHTVCFVCGNSIKFINTKDNSEAFLPSPGDGIVHLVTNPGYDLYAFTER-KSDPRIFVYMFPDFSEPRAILKGGAQLSYSSIAFAHNSTVLAAFSGLPDFQLTVWNWTDQVPLCSISVVHQTCTNMSFNPLNWRQLCTIGPEMLTVWNIEQLNEKYKFTSNQMRLPPA---DGSPDSGEFENLEHSISRMGRTFTSEGFLLTKAAIGGIVGGDAKEF-EPGEKTIRCVPVSHCWTPQGKVFCGCSGGQLLSVDTEVNMVRVIATPAPFLQKGRTETLSQLPTMESLQEEPEDDNDAAVLGNKLTPGGTDCLALHKKGLYAGGQDGILRCLDMTGSEVT--VTEKVDTGATITSLCWSTDYSTLAIGSSKGSMKLYEPGKELSQ---LFDVCTSELVGIDCLLG 417          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Medaka
Match: cfap43 (cilia and flagella associated protein 43 [Source:NCBI gene;Acc:101172269])

HSP 1 Score: 291.582 bits (745), Expect = 3.786e-79
Identity = 289/1087 (26.59%), Postives = 544/1087 (50.05%), Query Frame = 2
Query: 2330 RLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCG-KDGIFSQHHV-------GIPNHV---KISNEQDYANVISKFDTKILQQNS--ELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEM-PHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDE-------ELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGD-TVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLL--HRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQ---RYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHK 5509
            R+KP +  +   H     S+L S     +A+ G +G+L V          ++  H  + GG    +FS D   + + G +DG      +          N V   + S  Q   N++   +T +L   +  +   +L  E++G      E++  ++ R     S +  S    TW E R  +  +EE+ QY   K  ++  +K +   +Q++++ENE L +      +EF L +  +K++   +E E+  V   IE + + K Y+ DV+K+ECWD + ++  ++ +F + + V NFPLR+R     + +  V   RK+E              + S  +++ E   + +         +    + +L       Y++F               L++ +Q+I QIILL+D+IY +K  FN EF  + ++K  E+ R+++ N+ I +I+  ++    L +P   L+  E+PE +L V+D EIK E + T +++ + EE K   E  + +E++DN R+R +++++ GV EVK+ D LK +IP P F++  K     ++EEKK +EEY+K VK+L+ ++EKY+  LE+E +KL+    +    FD+ L  L  K++   ++I QEE+K+  +  S+L DE       EL ++R+E+L  K     E++  +  +Q         QE YD++V E+K +DK FR+ F +V  ++ D + KL+K+RPR    G ++   SQ P+                     N +  A+ +LD+ +     + P++++R C  R+ ++  E ++K   L + +MQ F QKR +E+   +     L   +E L   R    ++  +Q+++KQGQVE    +    D  ++ LL  H++  E+L + I+ L   K+  M + K  +K+ I L+WE + +  + ED+  K ++++  + ++E Q   RY + ++    I+ +   +E+ +  +   H + + Q    ++ +     +K K + + + +Q+ ++ V V + +H++    G    Q   + R+ ++  + +L  L K+QA E+ VL +EVERL  + F ++ Q K
Sbjct:  628 RIKPMQEVEG--HPLGPASLLLSPDCLWLASVGQDGLLYVRQTDSTEKVTELQCHPCNSGGTQRVSFSTDGLTLLTTGFRDGCLVCTELRTKSLDANTENEVMRRRQSTRQSIKNMLGTENTILLNFTACDQEAPWLTYEVRG------ETSLDVSKRDEGE-SCQKSSSSPPTWLENRQKEVVQEENTQYFLEKKKLKETVKQLTEAMQKLIDENESLPE------EEFSLTLKEQKRLETMVEQEVALVRARIEQDIVEKSYLCDVLKRECWDSLMIRRTAIKAFYSELAVQNFPLRERTAEECEDLRRVQSIRKVE---------KAASTIISLAEREDEKQEAQSCALTGSFSAQLGFSNPHL-------YDQFS--------------LQSTEQRISQIILLQDVIYGIKAAFNAEFAALQRQKLLELQRVRDNNACIREIMLKLDRNQELWEP--CLTDAEQPENVLTVDDSEIKAEMFFTPKKKEEEEERKTLGEGNQLEEQVDNGRKRAIDEII-GVFEVKKLDILKMEIPPPEFVLT-KADTQLSEEEKKAYEEYEKNVKDLSQKKEKYRNSLESEVRKLMKSTKEGTEGFDQALCELLKKRVKCTIAIKQEELKMAYLVDSVLEDEAMRNRELELMSKREEMLAHKVETGEEVKTHQDEVQRF-------QEMYDSLVTEDKDLDKDFRKNFCNVPNNLVDQLYKLFKRRPR----GQRVKTPSQTPDVL-------------------NQMLKAMDELDEPEKMPFGLNPSVWQRFCLVRRSKVESEQKVKTQALILAEMQAFLQKRRDEDNAFQEEINSLSEAIENLRRNRNCHLMDTTVQIILKQGQVE-PPITELTSDPADTHLLLYHKNKPENLRRIIRTLAEQKIAVMEQWKGVRKRIIQLDWEHKVVKKKMEDVSDKCRDVKMLRLSEEQQDMTRY-SESEQGTRISQKASMLEKNLAFMTEAHQQCIQQCVKEIEQLYKQADVKSK-KTSTLELQLPDIRVDVAQLRHVSEA-AGPEQEQAKAKERHLELAVKSNLKALVKAQAEELTVLLAEVERLTKKNFTSVYQLK 1631          

HSP 2 Score: 163.31 bits (412), Expect = 1.115e-39
Identity = 129/609 (21.18%), Postives = 272/609 (44.66%), Query Frame = 2
Query:   59 WNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCD-YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHV-WSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANEN-TERPKSLLNIGHGSFVGIGVLPGN-NYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPS-----NFYENINGTFDEEAIRKMTLTFDYPTFGCTLGI 1855
            W  G+ ++ I FI+  T+ +  G ++ F + +   +  +Q P    + LT   S +IFA AE  K +P I+ Y++P L+    +K  A L+    + S+   +L   S +PD+TL++WN+   + +C+     +++   + +P NW  +  +    +  + IE    +  ++ + +KLP          +    +     + + +    +  + PP               E+    S  ++ S V W+ T D+Y GCV+G L+++D + +   ++ NP        +++  + ++   + +     +   + G+  +G +  V    +   ++S  + +  + +  +  +K +     + ++S+ G  EI   N   +++   +L+I  G+F+    L  + N   +++ +G LQ+W  +  + + S+ +     S+   P+     +G  +GN+  ID       R +H + L++T V    F + G+ + T   D ++ +L    S  F V+G T   G IL L   +     E VQ+ V     +D +G   L+      T+++ PS     + Y + +G     A+R +T    +P   C+LG+
Sbjct:   38 WIQGFTNKKIEFINYETICFTCGNHISFLNLKTKKRCLLQSPGRGVSALTADGSSSIFAFAEQ-KLSPSIFVYSFPELKLKNELKGTARLEYTSLTLSDSGPFLGCYSSLPDYTLTVWNWEKAEPICKHAGAGRDIISLAFNPWNWLQLCTLGPTSVIVWHIEKSDCITALKPRVVKLPQT--------DGSFAERPSYTSYTVTCQQGFGRDPPP-------------ITETTPLTSSTVTPSAVCWTPTSDIYVGCVEGFLLQVDPENLSVSILYNP--------KVADAVPELTKFSFQG----LTLTKNGLLTSGQNNEVH-CLEVGGQVS--ITQTWELEKPVDAVKLSPDNDTVLLLSNTG--EIYKLNPMLSDKIVKVLDIFSGNFLAAEFLNTDRNICVSLKDSGELQLWS-SEGSCLGSLSLQAEVTSLACCPVALYAAVGTASGNVLFIDLNVHEKPRVVHHVHLYHTAVLHAVFDQGGHYLFTSGSDSHIYVLEAKPSRKFSVIGYTDVCGRILSL---STRCLKEEVQVLVLCAGQDDGSGGGSLL------TVLSLPSRDLAGSDYVDRHGCLSAHALRVLTYEVPHPLLSCSLGV 597          
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Medaka
Match: cfap43 (cilia and flagella associated protein 43 [Source:NCBI gene;Acc:101172269])

HSP 1 Score: 290.426 bits (742), Expect = 7.736e-79
Identity = 289/1087 (26.59%), Postives = 544/1087 (50.05%), Query Frame = 2
Query: 2330 RLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCG-KDGIFSQHHV-------GIPNHV---KISNEQDYANVISKFDTKILQQNS--ELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEM-PHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDE-------ELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGD-TVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLL--HRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQ---RYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHK 5509
            R+KP +  +   H     S+L S     +A+ G +G+L V          ++  H  + GG    +FS D   + + G +DG      +          N V   + S  Q   N++   +T +L   +  +   +L  E++G      E++  ++ R     S +  S    TW E R  +  +EE+ QY   K  ++  +K +   +Q++++ENE L +      +EF L +  +K++   +E E+  V   IE + + K Y+ DV+K+ECWD + ++  ++ +F + + V NFPLR+R     + +  V   RK+E              + S  +++ E   + +         +    + +L       Y++F               L++ +Q+I QIILL+D+IY +K  FN EF  + ++K  E+ R+++ N+ I +I+  ++    L +P   L+  E+PE +L V+D EIK E + T +++ + EE K   E  + +E++DN R+R +++++ GV EVK+ D LK +IP P F++  K     ++EEKK +EEY+K VK+L+ ++EKY+  LE+E +KL+    +    FD+ L  L  K++   ++I QEE+K+  +  S+L DE       EL ++R+E+L  K     E++  +  +Q         QE YD++V E+K +DK FR+ F +V  ++ D + KL+K+RPR    G ++   SQ P+                     N +  A+ +LD+ +     + P++++R C  R+ ++  E ++K   L + +MQ F QKR +E+   +     L   +E L   R    ++  +Q+++KQGQVE    +    D  ++ LL  H++  E+L + I+ L   K+  M + K  +K+ I L+WE + +  + ED+  K ++++  + ++E Q   RY + ++    I+ +   +E+ +  +   H + + Q    ++ +     +K K + + + +Q+ ++ V V + +H++    G    Q   + R+ ++  + +L  L K+QA E+ VL +EVERL  + F ++ Q K
Sbjct:  601 RIKPMQEVEG--HPLGPASLLLSPDCLWLASVGQDGLLYVRQTDSTEKVTELQCHPCNSGGTQRVSFSTDGLTLLTTGFRDGCLVCTELRTKSLDANTENEVMRRRQSTRQSIKNMLGTENTILLNFTACDQEAPWLTYEVRG------ETSLDVSKRDEGE-SCQKSSSSPPTWLENRQKEVVQEENTQYFLEKKKLKETVKQLTEAMQKLIDENESLPE------EEFSLTLKEQKRLETMVEQEVALVRARIEQDIVEKSYLCDVLKRECWDSLMIRRTAIKAFYSELAVQNFPLRERTAEECEDLRRVQSIRKVE---------KAASTIISLAEREDEKQEAQSCALTGSFSAQLGFSNPHL-------YDQFS--------------LQSTEQRISQIILLQDVIYGIKAAFNAEFAALQRQKLLELQRVRDNNACIREIMLKLDRNQELWEP--CLTDAEQPENVLTVDDSEIKAEMFFTPKKKEEEEERKTLGEGNQLEEQVDNGRKRAIDEII-GVFEVKKLDILKMEIPPPEFVLT-KADTQLSEEEKKAYEEYEKNVKDLSQKKEKYRNSLESEVRKLMKSTKEGTEGFDQALCELLKKRVKCTIAIKQEELKMAYLVDSVLEDEAMRNRELELMSKREEMLAHKVETGEEVKTHQDEVQRF-------QEMYDSLVTEDKDLDKDFRKNFCNVPNNLVDQLYKLFKRRPR----GQRVKTPSQTPDVL-------------------NQMLKAMDELDEPEKMPFGLNPSVWQRFCLVRRSKVESEQKVKTQALILAEMQAFLQKRRDEDNAFQEEINSLSEAIENLRRNRNCHLMDTTVQIILKQGQVE-PPITELTSDPADTHLLLYHKNKPENLRRIIRTLAEQKIAVMEQWKGVRKRIIQLDWEHKVVKKKMEDVSDKCRDVKMLRLSEEQQDMTRY-SESEQGTRISQKASMLEKNLAFMTEAHQQCIQQCVKEIEQLYKQADVKSK-KTSTLELQLPDIRVDVAQLRHVSEA-AGPEQEQAKAKERHLELAVKSNLKALVKAQAEELTVLLAEVERLTKKNFTSVYQLK 1604          

HSP 2 Score: 164.851 bits (416), Expect = 3.224e-40
Identity = 129/613 (21.04%), Postives = 274/613 (44.70%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCF-HKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCD-YLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHV-WSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANEN-TERPKSLLNIGHGSFVGIGVLPGN-NYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPS-----NFYENINGTFDEEAIRKMTLTFDYPTFGCTLGI 1855
            + + W  G+ ++ I FI+  T+ +  G ++ F + +   +  +Q P    + LT   S +IFA AE  K +P I+ Y++P L+    +K  A L+    + S+   +L   S +PD+TL++WN+   + +C+     +++   + +P NW  +  +    +  + IE    +  ++ + +KLP          +    +     + + +    +  + PP               E+    S  ++ S V W+ T D+Y GCV+G L+++D + +   ++ NP        +++  + ++   + +     +   + G+  +G +  V    +   ++S  + +  + +  +  +K +     + ++S+ G  EI   N   +++   +L+I  G+F+    L  + N   +++ +G LQ+W  +  + + S+ +     S+   P+     +G  +GN+  ID       R +H + L++T V    F + G+ + T   D ++ +L    S  F V+G T   G IL L   +     E VQ+ V     +D +G   L+      T+++ PS     + Y + +G     A+R +T    +P   C+LG+
Sbjct:    7 LDVRWIQGFTNKKIEFINYETICFTCGNHISFLNLKTKKRCLLQSPGRGVSALTADGSSSIFAFAEQ-KLSPSIFVYSFPELKLKNELKGTARLEYTSLTLSDSGPFLGCYSSLPDYTLTVWNWEKAEPICKHAGAGRDIISLAFNPWNWLQLCTLGPTSVIVWHIEKSDCITALKPRVVKLPQT--------DGSFAERPSYTSYTVTCQQGFGRDPPP-------------ITETTPLTSSTVTPSAVCWTPTSDIYVGCVEGFLLQVDPENLSVSILYNP--------KVADAVPELTKFSFQG----LTLTKNGLLTSGQNNEVHCL-EVGGQVS--ITQTWELEKPVDAVKLSPDNDTVLLLSNTG--EIYKLNPMLSDKIVKVLDIFSGNFLAAEFLNTDRNICVSLKDSGELQLWS-SEGSCLGSLSLQAEVTSLACCPVALYAAVGTASGNVLFIDLNVHEKPRVVHHVHLYHTAVLHAVFDQGGHYLFTSGSDSHIYVLEAKPSRKFSVIGYTDVCGRILSL---STRCLKEEVQVLVLCAGQDDGSGGGSLL------TVLSLPSRDLAGSDYVDRHGCLSAHALRVLTYEVPHPLLSCSLGV 570          
BLAST of cilia- and flagella-associated protein 43 vs. Planmine SMEST
Match: SMESG000000491.1 (SMESG000000491.1)

HSP 1 Score: 3557.69 bits (9224), Expect = 0.000e+0
Identity = 1820/1824 (99.78%), Postives = 1820/1824 (99.78%), Query Frame = 2
Query:   41 MDMKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLEELNKAGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 5512
            MDMKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE    AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETISSINSDEFEEIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG
Sbjct:    1 MDMKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE----AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETISSINSDEFEEIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 1820          
BLAST of cilia- and flagella-associated protein 43 vs. Planmine SMEST
Match: SMESG000000491.1 (SMESG000000491.1)

HSP 1 Score: 3551.53 bits (9208), Expect = 0.000e+0
Identity = 1818/1822 (99.78%), Postives = 1818/1822 (99.78%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLEELNKAGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 5512
            MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE    AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETISSINSDEFEEIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG
Sbjct:    1 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE----AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETISSINSDEFEEIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 1818          
BLAST of cilia- and flagella-associated protein 43 vs. Planmine SMEST
Match: SMESG000000491.1 (SMESG000000491.1)

HSP 1 Score: 3550.76 bits (9206), Expect = 0.000e+0
Identity = 1820/1838 (99.02%), Postives = 1820/1838 (99.02%), Query Frame = 2
Query:   41 MDMKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLEELNKAGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTL--------------KKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 5512
            MDMKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE    AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTL              KKQKETISSINSDEFEEIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG
Sbjct:    1 MDMKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE----AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLTLEDLIRAKFNLQVKKQKETISSINSDEFEEIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 1834          
BLAST of cilia- and flagella-associated protein 43 vs. Planmine SMEST
Match: SMESG000000491.1 (SMESG000000491.1)

HSP 1 Score: 3544.98 bits (9191), Expect = 0.000e+0
Identity = 1818/1836 (99.02%), Postives = 1818/1836 (99.02%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLEELNKAGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTL--------------KKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 5512
            MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE    AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTL              KKQKETISSINSDEFEEIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG
Sbjct:    1 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE----AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLTLEDLIRAKFNLQVKKQKETISSINSDEFEEIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 1832          
BLAST of cilia- and flagella-associated protein 43 vs. Planmine SMEST
Match: SMESG000000491.1 (SMESG000000491.1)

HSP 1 Score: 3538.04 bits (9173), Expect = 0.000e+0
Identity = 1802/1822 (98.90%), Postives = 1803/1822 (98.96%), Query Frame = 2
Query:   47 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLEELNKAGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNXXXXXXXXXXXXTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETXXXXXXXXXXXXXXXXXXXXXNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDXXXXXXXXXXXXXVVEDHEIKVERYLTDEQXXXXXXXXXXXXXXXXXXXXDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYXXXXXXXXXXXXXXXXXXSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 5512
            MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE    AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTL   +            EIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG
Sbjct:    1 MKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYAATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKFSFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNWKNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDSRVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHVWSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIENMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGRISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGVLPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGIGLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDGYVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCINDLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFGCTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKILQSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKDSIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVIDKLE----AGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGVLRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHHVGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISESTTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRRGIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKKVIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRDRPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLNSDEFE----------EIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQKIYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDIEMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAEEERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQEDWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFDEMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTSNSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGSMFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQRNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMGDMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQGQVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSKKKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLINAEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQMTELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQAREVAVLRSEVERLRMRTFPALIQHKG 1808          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP438.135e-14233.21cilia and flagella associated protein 43 [Source:H... [more]
CFAP431.100e-13632.83cilia and flagella associated protein 43 [Source:H... [more]
CFAP432.835e-8335.88cilia and flagella associated protein 43 [Source:H... [more]
CFAP437.784e-5124.49cilia and flagella associated protein 43 [Source:H... [more]
CFAP435.376e-4224.90cilia and flagella associated protein 43 [Source:H... [more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG176871.716e-1925.51gene:FBgn0036348 transcript:FBtr0075838[more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap433.983e-15934.80cilia and flagella associated protein 43 [Source:Z... [more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dok45.043e-16835.39docking protein 4 [Source:Xenbase;Acc:XB-GENE-9486... [more]
dok45.114e-12632.97docking protein 4 [Source:Xenbase;Acc:XB-GENE-9486... [more]
dok47.236e-12335.56docking protein 4 [Source:Xenbase;Acc:XB-GENE-9486... [more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap437.861e-13635.78cilia and flagella associated protein 43 [Source:M... [more]
Cfap436.336e-9035.17cilia and flagella associated protein 43 [Source:M... [more]
Cfap436.718e-6237.00cilia and flagella associated protein 43 [Source:M... [more]
Cfap448.193e-1330.30cilia and flagella associated protein 44 [Source:M... [more]
Cfap448.193e-1330.30cilia and flagella associated protein 44 [Source:M... [more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NDM7|CFA43_HUMAN3.907e-14133.21Cilia- and flagella-associated protein 43 OS=Homo ... [more]
sp|E9Q7R9|CFA43_MOUSE5.499e-13535.78Cilia- and flagella-associated protein 43 OS=Mus m... [more]
sp|A8JAF2|CFA43_CHLRE7.064e-1426.10Cilia- and flagella-associated protein 43 OS=Chlam... [more]
sp|E9Q5M6|CFA44_MOUSE5.731e-1230.30Cilia- and flagella-associated protein 44 OS=Mus m... [more]
sp|Q96MT7|CFA44_HUMAN1.240e-826.29Cilia- and flagella-associated protein 44 OS=Homo ... [more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EGY70.000e+032.64Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A4S2LDV30.000e+031.81Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A1T50.000e+031.35Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S3HJT73.274e-8640.20cilia- and flagella-associated protein 43 isoform ... [more]
A0A1S3HML24.232e-8640.06cilia- and flagella-associated protein 43 isoform ... [more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfap432.006e-16534.88cilia and flagella associated protein 43 [Source:Z... [more]
ENSAMXT00000056978.11.151e-1625.00pep primary_assembly:Astyanax_mexicanus-2.0:25:963... [more]
ENSAMXT00000015124.21.453e-825.86pep primary_assembly:Astyanax_mexicanus-2.0:3:2230... [more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO427834.536e-4225.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap433.786e-7926.59cilia and flagella associated protein 43 [Source:N... [more]
cfap437.736e-7926.59cilia and flagella associated protein 43 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 43 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000491.10.000e+099.78SMESG000000491.1[more]
SMESG000000491.10.000e+099.78SMESG000000491.1[more]
SMESG000000491.10.000e+099.02SMESG000000491.1[more]
SMESG000000491.10.000e+099.02SMESG000000491.1[more]
SMESG000000491.10.000e+098.90SMESG000000491.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023266 ID=SMED30023266|Name=cilia- and flagella-associated protein 43|organism=Schmidtea mediterranea sexual|type=transcript|length=5578bp
GTAATTCTGTTAAAAATTTAAGAGATAGAAATATTTCGAAATGGATATGA
AAATTGAGTGGAATATTGGCTACGATCACGAGTTTATATATTTTATTGAT
AGAAATACAGTGGTATATATAAGTGGACAATATGTATGTTTTCACAAAGA
AGATGGTTCACAAATATATATGCAATTACCATCTTACGCAGCGACAAAAT
TAACAGTCCATCCTTCTGAAAACATATTTGCATTAGCAGAAACTGTAAAA
CAAAATCCGAAGATTTATTTCTACAATTATCCATCTTTAGAAAATTTCGG
CGTTATAAAAGATTTTGCCGTTTTGGATGTTTTGAAATTTTCATTTTCCA
ATTGTGATTATTTAGCAATCGTGTCGGGAATTCCGGATTTTACTCTCTCA
TTATGGAATTTCAGAATACAAAAGAAATTATGTGAAAAGAAATTGGAATT
TCAAAATGTGACTGACTGTTCAATTTCTCCCGTTAACTGGAAAAACATCA
CAATAATAAGTGAAAACAAAATTTACTTTTATTCTATCGAACATTGCGGC
TCTCTTTATTTAATGCAGAACAAATATATGAAACTACCTTCCATTTATAC
ACCTTCGGGACAAGATTGCAATGCAGTCTTACTGGACTCTAGAGTGACAG
TTGCCAAATCTGCCTCAAGGATGATATCCTACGATTTTGAACTGCCACCA
AGTGCAAAAGCTGGTGTGTCTTGTAAACATTTTAAAGAATTTTTGGAATC
TCAGGATAACGAATCGAGATGTATTTCTGCTTCACATGTCTGGAGTGGAA
CTGGAGATTTGTATTTTGGATGTGTAGATGGCCAGTTAATCAAACTCGAC
ACGGATAAAATGCATTTCAAAATGATTTTAAATCCTTCGGAGAACAAAAG
GGAAGTTCTAAGAATCAGTTCACCAATCTCAAAAATAGAAAATATGAATT
TAAAGAATAACATCAAGCATATGTGTTTTGCAAGAGAAGGAATATATATG
GCTGGAGATGATGGAGTCGTTAGATTGGCCCAGCAGTTTGAGAATGAGAT
TTCTGATAATGTTGAGGAAATCCATCAAACTAAAGGTCGGATTTCCAATT
TAAAATTCAACTATAGTTATACGGAATTGGCTATTGTTTCTTCGAATGGC
TCAATCGAAATTATATCAGCCAATGAAAACACTGAGCGTCCAAAGTCATT
GCTGAACATTGGACATGGGTCTTTTGTTGGAATTGGTGTACTTCCAGGCA
ACAATTATATAGCTACAATGAGAAGAAATGGACGGTTACAGATTTGGGAT
GTGAATAACCGAAATGAAATTTCTTCAATTTATGTTAACGAAGCAGCGGC
ATCAATGGACGTGTCACCACTTTGGAACATAATAGGAATCGGACTGGAAA
ATGGAAACTTAGAAATTATTGATGCTTATGATCCAACAACCCTTAGAAGA
ATTCATGAAATTAAACTTCACAATACTCCAGTGACAAAATTGAAATTTGG
TAAACGGGGTAATATAATAGTAACGGGGGCCGATGATGGTTATGTTACAA
TTCTATCCGGATTGGTGTCAGAAAGTTTTAAAGTTTTGGGAATTACTTCT
TACGAAGGAATGATATTGGATTTATGTGTTTTCAACAATCCAAATGCAGA
TGAAATAGTTCAAATCGCTGTGAGTGCCCAATGTATTAATGACCTAACCG
GATCCACTAAACTCGTGTATTTTGAGATTTCTCCAACAATTATGAATGAT
CCGAGTAATTTTTACGAGAACATCAACGGCACATTTGATGAAGAAGCAAT
CAGAAAAATGACTCTCACCTTTGATTATCCTACTTTCGGTTGCACTCTTG
GTATTCCACCGCCTGAGGAAAAATCCCCTGCGTTGTATGCTGTAGAAATA
GAATCAAGATGCTTATGCAAATACCAAATACCTGCATCTCCTCCAAAAAA
AGATGAAGATAGTAATAAAGAAGCCATGTTGAAAATCCTCCAATCTAGTC
GTGTAACCATTCCTGGTATTACTAAAACTGTAGTTGACTCGAATTCCGCA
TTAACTCCCGAAGCTAATATGTCCGTCGAATCCGATCAGGATGTCATGAG
TAGTAGAATGTCATTAAATGTTGAAGAATCTAAGAAAGATAGCATCCGAT
CTGGCGGCAGGCGCCAAAGTAATCCCCGATTGTCTGTAGTGGACAACATA
GATTGGGTAGCCATGAATAAAGTGAAGGCGAAATTGAATCAGTATGACTC
GCTGCCTGAAAAATTGCAGCAACAGCTAAAAGTCATAGACAAACTGGAGG
AATTGAACAAGGCTGGAAATAAAGCATCTCGATTAAAACCTACAAAAGTG
TTTAAAGATGTTATTCATGAGGATCCACAAATTTCTATGTTATCATCAAT
GAGCGGTAGATTGGTGGCTACCTATGGTAGTGAAGGTGTTCTCCGAGTCG
TTGACATTAAAGATGAAAGAAATTGGGCGCAAGTGCCAGTTCACCAGTTA
TCTTATGGTGGTGTTATTGAAGCGGCTTTCAGTTTGGACTCAAATTTCAT
TTATTCCTGTGGCAAAGATGGGATATTTTCTCAACACCACGTTGGAATAC
CGAACCATGTTAAAATTTCTAATGAACAAGATTATGCTAATGTTATTTCA
AAATTTGACACAAAAATTCTTCAACAAAATAGTGAATTGAAATCTTTTTT
GGCTATCGAAATCCAGGGACAAGTTGAATCAATAAGTGAGTCCACTACAC
CAATAACTTTAAGAGGGTCCACTAGATTCAGTTCAAGAGCAGATAGCAAA
GATAATAAAACATGGAGTGAAAAGCGAGTAAATGATCATCAAGAAGAGGA
AGATCAACAATATCAAGATACAAAAAGTTCTATTCGAAGAGGAATTAAAG
CAATACGTTCTACAATACAGCAAATGTTAGAAGAAAATGAAGGGTTGAGC
GATCTTGAGAAAATTGACAGGCAGGAATTTGAACTGGACATAGATATGAA
GAAAAAGATTCACGCTGATATTGAAACAGAGATTAAAAAGGTAATTGATG
AAATAGAAAACAACAATTTAGCGAAACAATACATATTGGATGTCATTAAA
AAAGAATGCTGGGATCAAATGACAGTAAAAGGAAGATCATTGTGCTCATT
TACCACCAATATGGAAGTCACAAATTTCCCATTGAGAGATCGTCCACAGT
TAATGCTGGATCAAATCGACATGGTGGTAAAGCGCCGTAAAATCGAAATT
GAAGATACAAAAGATCGTAAACTTTATGGTGAACACTTGTTGAAAAGCAC
TCTGAAAAAACAAAAAGAAACGATTTCATCAATTAATTCTGATGAATTTG
AAGAAATTGAGGATGAAGAAAGCAAAGATTCTTCAAATCTTACTACGCAT
GATTTAAAAGATTATGAAAAATTTGATAAGATTGCTCCTAACATCAAGTT
TTTGTATTCGCAAATGGAATTAGAAACAAGAGATCAAAAGATCTATCAAA
TTATATTATTAAAGGACATTATTTATCAGATGAAAGTGCAATTTAATAAA
GAATTTACTGATGTTTATCAGAAAAAAGAACAAGAAATTAATCGTATTAA
AGAAAAGAATTCTAGAATTGTGAAAATTTTGAACGACATTGAGATGCCAC
ACTTGATCCAACCAGATCCTGAACTTTCCAGTTTAGAAAAACCAGAAAAG
CTTCTTGTGGTTGAAGATCATGAAATCAAAGTTGAAAGATATCTTACCGA
TGAGCAAAGACGAAAACTGGAAGAAGATAAATTGGCTGAGGAAGAACGAA
AAAGAAAGGAAAAATTGGATAATTGGAGAGAAAGAGGACTAGAAGACATG
ATGGGGGGAGTGTTAGAAGTCAAACGAGAAGATGAATTAAAAAAAGACAT
CCCAAAACCCGCTTTTTTAATAGCTGGCAAACCTCAAGAAGACTGGACAG
ATGAAGAGAAAAAGATATTTGAAGAATACGACAAAAAAGTGAAAGAATTA
AACGATGAGAGAGAAAAATATAAAAAGCAACTGGAAGCCGAGTATAAGAA
ACTGATTAACATCATTGATGATGCTAAAAATGCCTTTGATGAAATGCTTT
TGAATTTATTCAACAAGCAAATATCTGTTCAAATGTCCATATACCAAGAA
GAAGTAAAAATTCTGAGAATTCAGTGGTCGTTATTAGTCGACGAAGAATT
GAACGCCAGAAGAAAAGAATTGCTCGAATTAAAGACTTCGAATAGCTTAG
AAATTCAAGTGTTGAAAAGTATAATTCAAAATACTAAAGCCGTTCTTGAT
GAAAATCAGGAGGAATATGACACAATGGTAGCCGAGGAAAAGGTTATGGA
CAAACAATTTAGAAGAGAATTCCTTGATGTACATGGCTCAATGTTTGATC
ATATTACTAAGCTTTATAAGAAGCGTCCAAGAAATCGACTGCTCGGTAGT
CAAATCATTCCAAATAGCCAAATGCCTAATTACACTAAAAATAACCCATA
TTCCGGGAGGACTTCCTCTGGAAAACAGCGGCAATTCCAGCGAAATACAT
TGAAAAATGCCATTCAGGATTTGGACAAACAAGATGCCGGCGATACCGTA
GAGCCCGCGATTTATGAGCGATTGTGCAAGTCTCGCAAAAAGCGAATCAT
GAAAGAGTTTGAAATAAAACAAATGTTATTAGAGATGGGAGACATGCAAG
GCTTTTATCAAAAAAGATTAGAAGAAGAAAAGAACTTGGAGAATAATGAT
CTTCAATTGGATAGTTTGATGGAAACGTTAGAAAATTATCGCTATCAATT
CCATGTGAATAAAGAAATTCAACTGGTTGTCAAGCAAGGTCAAGTCGAAG
TCGAAGCTGCTTCCGGTTTCATTCACGATTTCACAGAATCTGTTCTCCTT
CACCGCTCCATTATTGAAGATCTCAATAAGGAAATTAAAGTGCTTGGCCA
TAATAAAGTTAAACATATGACCAAGGCTAAAGATTCCAAGAAAAAATTTA
TTCATTTAGAATGGGAATTAAGGCGAATGTTAATGGAATACGAGGATTTG
GAACGGAAGAAAAAAGAAATTCAATGCTTTAAAAGTACTAAAGAAGTTCA
AAGATATTTAGCGACCAATGATTATGATGGACTAATTAATGCAGAAATAC
AGCAAATGGAACAAACTATCAATCATTTAAAAATGCACCACGCAAGGAAA
TTGGATCAAAAGCAAACCAGATTAAAATACATTAATGATAGTAAATTAAT
CAAAATAAAAAATGAAAACAACGAAATGGGAATTCAGATGACGGAATTGA
ATGTCCAAGTTAATGAGCGCAAGCATATTAACGCGGGGTTCCCTGGTGAT
AATGTTGGTCAGCGGAATGTCGAAATGCGTTATCAAAAGATTCTACAGCG
TCAGCATTTAGTAGATTTAGCCAAATCCCAAGCGAGAGAAGTGGCCGTGC
TGCGTTCTGAAGTGGAAAGGCTGCGGATGAGAACATTTCCAGCTCTCATA
CAGCACAAAGGATAAAGTTGATTGCTGCTAGGAATTGCTGAAAATTTATG
AATACAATTAAGCTTTTTGATTAAAGAA
back to top

protein sequence of SMED30023266-orf-1

>SMED30023266-orf-1 ID=SMED30023266-orf-1|Name=SMED30023266-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1825bp
MDMKIEWNIGYDHEFIYFIDRNTVVYISGQYVCFHKEDGSQIYMQLPSYA
ATKLTVHPSENIFALAETVKQNPKIYFYNYPSLENFGVIKDFAVLDVLKF
SFSNCDYLAIVSGIPDFTLSLWNFRIQKKLCEKKLEFQNVTDCSISPVNW
KNITIISENKIYFYSIEHCGSLYLMQNKYMKLPSIYTPSGQDCNAVLLDS
RVTVAKSASRMISYDFELPPSAKAGVSCKHFKEFLESQDNESRCISASHV
WSGTGDLYFGCVDGQLIKLDTDKMHFKMILNPSENKREVLRISSPISKIE
NMNLKNNIKHMCFAREGIYMAGDDGVVRLAQQFENEISDNVEEIHQTKGR
ISNLKFNYSYTELAIVSSNGSIEIISANENTERPKSLLNIGHGSFVGIGV
LPGNNYIATMRRNGRLQIWDVNNRNEISSIYVNEAAASMDVSPLWNIIGI
GLENGNLEIIDAYDPTTLRRIHEIKLHNTPVTKLKFGKRGNIIVTGADDG
YVTILSGLVSESFKVLGITSYEGMILDLCVFNNPNADEIVQIAVSAQCIN
DLTGSTKLVYFEISPTIMNDPSNFYENINGTFDEEAIRKMTLTFDYPTFG
CTLGIPPPEEKSPALYAVEIESRCLCKYQIPASPPKKDEDSNKEAMLKIL
QSSRVTIPGITKTVVDSNSALTPEANMSVESDQDVMSSRMSLNVEESKKD
SIRSGGRRQSNPRLSVVDNIDWVAMNKVKAKLNQYDSLPEKLQQQLKVID
KLEELNKAGNKASRLKPTKVFKDVIHEDPQISMLSSMSGRLVATYGSEGV
LRVVDIKDERNWAQVPVHQLSYGGVIEAAFSLDSNFIYSCGKDGIFSQHH
VGIPNHVKISNEQDYANVISKFDTKILQQNSELKSFLAIEIQGQVESISE
STTPITLRGSTRFSSRADSKDNKTWSEKRVNDHQEEEDQQYQDTKSSIRR
GIKAIRSTIQQMLEENEGLSDLEKIDRQEFELDIDMKKKIHADIETEIKK
VIDEIENNNLAKQYILDVIKKECWDQMTVKGRSLCSFTTNMEVTNFPLRD
RPQLMLDQIDMVVKRRKIEIEDTKDRKLYGEHLLKSTLKKQKETISSINS
DEFEEIEDEESKDSSNLTTHDLKDYEKFDKIAPNIKFLYSQMELETRDQK
IYQIILLKDIIYQMKVQFNKEFTDVYQKKEQEINRIKEKNSRIVKILNDI
EMPHLIQPDPELSSLEKPEKLLVVEDHEIKVERYLTDEQRRKLEEDKLAE
EERKRKEKLDNWRERGLEDMMGGVLEVKREDELKKDIPKPAFLIAGKPQE
DWTDEEKKIFEEYDKKVKELNDEREKYKKQLEAEYKKLINIIDDAKNAFD
EMLLNLFNKQISVQMSIYQEEVKILRIQWSLLVDEELNARRKELLELKTS
NSLEIQVLKSIIQNTKAVLDENQEEYDTMVAEEKVMDKQFRREFLDVHGS
MFDHITKLYKKRPRNRLLGSQIIPNSQMPNYTKNNPYSGRTSSGKQRQFQ
RNTLKNAIQDLDKQDAGDTVEPAIYERLCKSRKKRIMKEFEIKQMLLEMG
DMQGFYQKRLEEEKNLENNDLQLDSLMETLENYRYQFHVNKEIQLVVKQG
QVEVEAASGFIHDFTESVLLHRSIIEDLNKEIKVLGHNKVKHMTKAKDSK
KKFIHLEWELRRMLMEYEDLERKKKEIQCFKSTKEVQRYLATNDYDGLIN
AEIQQMEQTINHLKMHHARKLDQKQTRLKYINDSKLIKIKNENNEMGIQM
TELNVQVNERKHINAGFPGDNVGQRNVEMRYQKILQRQHLVDLAKSQARE
VAVLRSEVERLRMRTFPALIQHKG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039692CFAP43
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1794..1814
NoneNo IPR availableCOILSCoilCoilcoord: 1169..1189
NoneNo IPR availableCOILSCoilCoilcoord: 1653..1673
NoneNo IPR availableCOILSCoilCoilcoord: 1240..1261
NoneNo IPR availableCOILSCoilCoilcoord: 1405..1432
NoneNo IPR availableCOILSCoilCoilcoord: 1303..1348
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 909..945
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 914..944
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 674..710
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 674..692
NoneNo IPR availablePANTHERPTHR14885UNCHARACTERIZEDcoord: 1..1821
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 764..805
e-value: 27.0
score: 7.9
coord: 338..376
e-value: 66.0
score: 5.5
coord: 813..850
e-value: 19.0
score: 8.9
coord: 85..123
e-value: 270.0
score: 1.7
coord: 381..420
e-value: 54.0
score: 6.1
coord: 467..506
e-value: 0.016
score: 24.4
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 246..394
e-value: 5.2E-18
score: 66.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 395..506
e-value: 5.2E-18
score: 66.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 12..215
e-value: 2.4E-15
score: 58.4
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 697..877
e-value: 3.8E-5
score: 25.2
IPR039692Cilia- and flagella-associated protein 43PANTHERPTHR14885:SF1CILIA- AND FLAGELLA-ASSOCIATED PROTEIN 43coord: 1..1821
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 407..421
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 29..329
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 305..847