Cell cycle associated protein 1a

Overview
NameCell cycle associated protein 1a
Smed IDSMED30023258
Length (bp)1587
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell cycle associated protein 1a (SMED30023258) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell cycle associated protein 1a (SMED30023258) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell cycle associated protein 1a (SMED30023258) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell cycle associated protein 1a (SMED30023258) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023258

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30023258SMESG000043092.1 dd_Smed_v4_936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023258SMESG000043092.1 dd_Smed_v4_936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023258SMESG000043092.1 dd_Smed_v4_936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023258SMESG000043092.1 dd_Smed_v4_936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023258SMESG000043092.1 dd_Smed_v4_936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023258SMESG000043092.1 dd_Smed_v4_936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023258SMESG000043092.1 dd_Smed_v4_936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023258SMESG000043092.1 dd_Smed_v4_936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023258SMESG000043092.1 dd_Smed_v4_936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell cycle associated protein 1a vs. Ensembl Human
Match: CAPRIN1 (cell cycle associated protein 1 [Source:HGNC Symbol;Acc:HGNC:6743])

HSP 1 Score: 55.4546 bits (132), Expect = 1.898e-7
Identity = 61/188 (32.45%), Postives = 103/188 (54.79%), Query Frame = 2
Query:  113 ALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQ---KVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTS 637
            A     +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D +    ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+
Sbjct:   43 ATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTT 229          
BLAST of Cell cycle associated protein 1a vs. Ensembl Human
Match: CAPRIN1 (cell cycle associated protein 1 [Source:HGNC Symbol;Acc:HGNC:6743])

HSP 1 Score: 55.4546 bits (132), Expect = 1.898e-7
Identity = 61/188 (32.45%), Postives = 103/188 (54.79%), Query Frame = 2
Query:  113 ALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQ---KVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTS 637
            A     +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D +    ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+
Sbjct:   43 ATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTT 229          
BLAST of Cell cycle associated protein 1a vs. Ensembl Human
Match: CAPRIN1 (cell cycle associated protein 1 [Source:HGNC Symbol;Acc:HGNC:6743])

HSP 1 Score: 55.0694 bits (131), Expect = 2.630e-7
Identity = 46/143 (32.17%), Postives = 76/143 (53.15%), Query Frame = 2
Query:  236 LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQ---KVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTS 637
            LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D +    ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+
Sbjct:    7 LNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTT 148          
BLAST of Cell cycle associated protein 1a vs. Ensembl Human
Match: CAPRIN1 (cell cycle associated protein 1 [Source:HGNC Symbol;Acc:HGNC:6743])

HSP 1 Score: 55.0694 bits (131), Expect = 2.753e-7
Identity = 61/188 (32.45%), Postives = 103/188 (54.79%), Query Frame = 2
Query:  113 ALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQ---KVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTS 637
            A     +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D +    ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+
Sbjct:   43 ATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTT 229          
BLAST of Cell cycle associated protein 1a vs. Ensembl Human
Match: CAPRIN1 (cell cycle associated protein 1 [Source:HGNC Symbol;Acc:HGNC:6743])

HSP 1 Score: 55.0694 bits (131), Expect = 2.753e-7
Identity = 61/188 (32.45%), Postives = 103/188 (54.79%), Query Frame = 2
Query:  113 ALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQ---KVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTS 637
            A     +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D +    ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+
Sbjct:   43 ATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTT 229          
BLAST of Cell cycle associated protein 1a vs. Ensembl Zebrafish
Match: caprin1b (cell cycle associated protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2020])

HSP 1 Score: 61.6178 bits (148), Expect = 1.635e-9
Identity = 63/200 (31.50%), Postives = 112/200 (56.00%), Query Frame = 2
Query:   92 NCLMMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQ--------SKLLSENYIEVGELDILKELFCE-----IHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSK 640
            N +  SN L   +   E +K V+++ EKK RN++K+K+KLD+Y+ ++     LN+DQ  A+SKYQEV+ NLE   EL    L   ++ +KT+KK  ++E+L+ +  E   ++ V++  + L+R+ D    Q        + LL+E+  ++  LD   +L        I ++++  +++ S+ L  L EG +KP+   T K
Sbjct:   26 NQITASNQLTGTQS--EAMKQVMVVLEKKVRNMEKKKSKLDDYQARSSKGERLNQDQLEALSKYQEVIHNLEFTRELQKSFLALGQEIQKTVKKAARREQLQREESEQKRLKRVLELQFALDRLGDESVRQELLQGDGETSLLTES--DLTSLDEFYKLVGPERDQNIRLTDQ--YQEASQHLWELLEGKDKPVAGTTYK 219          
BLAST of Cell cycle associated protein 1a vs. Ensembl Zebrafish
Match: caprin1b (cell cycle associated protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2020])

HSP 1 Score: 61.6178 bits (148), Expect = 1.635e-9
Identity = 63/200 (31.50%), Postives = 112/200 (56.00%), Query Frame = 2
Query:   92 NCLMMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQ--------SKLLSENYIEVGELDILKELFCE-----IHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSK 640
            N +  SN L   +   E +K V+++ EKK RN++K+K+KLD+Y+ ++     LN+DQ  A+SKYQEV+ NLE   EL    L   ++ +KT+KK  ++E+L+ +  E   ++ V++  + L+R+ D    Q        + LL+E+  ++  LD   +L        I ++++  +++ S+ L  L EG +KP+   T K
Sbjct:   26 NQITASNQLTGTQS--EAMKQVMVVLEKKVRNMEKKKSKLDDYQARSSKGERLNQDQLEALSKYQEVIHNLEFTRELQKSFLALGQEIQKTVKKAARREQLQREESEQKRLKRVLELQFALDRLGDESVRQELLQGDGETSLLTES--DLTSLDEFYKLVGPERDQNIRLTDQ--YQEASQHLWELLEGKDKPVAGTTYK 219          
BLAST of Cell cycle associated protein 1a vs. Ensembl Zebrafish
Match: caprin2 (caprin family member 2 [Source:NCBI gene;Acc:407729])

HSP 1 Score: 50.8322 bits (120), Expect = 4.163e-6
Identity = 46/167 (27.54%), Postives = 78/167 (46.71%), Query Frame = 2
Query:  221 KKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERI--------FDHQKVQSKLLSENYIEVGELDILKELFC--EIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIE 691
            KK   LNEDQ  AV KY EVV NL+   EL        +D  K  +K  +QE+      E S +  +++  Y+L  +        F + +  S  +S   +E G +D+   + C  +  IS +   ++ +     L EG  KP+  G++ +H      K++L+R ++
Sbjct:   92 KKGEKLNEDQLEAVGKYDEVVHNLKFAKELQKTIGSLTQDLLKAQRKAVRQEKQMKTDEEKSRLSLMLQVQYVLHSLQREDVRKNFCNTRQYSCYMSTQDME-GLMDLASLVGCKRDYSISLEDQMRRAAIVYWELLEGNEKPV-AGSTYKHM-----KEKLLRLVD 251          
BLAST of Cell cycle associated protein 1a vs. Ensembl Mouse
Match: Caprin1 (cell cycle associated protein 1 [Source:MGI Symbol;Acc:MGI:1858234])

HSP 1 Score: 57.7658 bits (138), Expect = 2.867e-8
Identity = 64/190 (33.68%), Postives = 106/190 (55.79%), Query Frame = 2
Query:  131 IALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFD---HQKVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTSKEHALKSI 661
            +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D      ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+ + ALK I
Sbjct:   47 VQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDDVRTDLKQGLSGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTTYK-ALKEI 234          
BLAST of Cell cycle associated protein 1a vs. Ensembl Mouse
Match: Caprin1 (cell cycle associated protein 1 [Source:MGI Symbol;Acc:MGI:1858234])

HSP 1 Score: 57.7658 bits (138), Expect = 2.867e-8
Identity = 64/190 (33.68%), Postives = 106/190 (55.79%), Query Frame = 2
Query:  131 IALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFD---HQKVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTSKEHALKSI 661
            +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D      ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+ + ALK I
Sbjct:   47 VQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDDVRTDLKQGLSGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTTYK-ALKEI 234          
BLAST of Cell cycle associated protein 1a vs. UniProt/SwissProt
Match: sp|Q60865|CAPR1_MOUSE (Caprin-1 OS=Mus musculus OX=10090 GN=Caprin1 PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 2.005e-7
Identity = 64/190 (33.68%), Postives = 106/190 (55.79%), Query Frame = 2
Query:  131 IALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFD---HQKVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTSKEHALKSI 661
            +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D      ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+ + ALK I
Sbjct:   47 VQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDDVRTDLKQGLSGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTTYK-ALKEI 234          
BLAST of Cell cycle associated protein 1a vs. UniProt/SwissProt
Match: sp|Q5M9G3|CAPR1_RAT (Caprin-1 OS=Rattus norvegicus OX=10116 GN=Caprin1 PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 2.023e-7
Identity = 64/190 (33.68%), Postives = 106/190 (55.79%), Query Frame = 2
Query:  131 IALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFD---HQKVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTSKEHALKSI 661
            +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D      ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+ + ALK I
Sbjct:   47 VQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDDVRTDLKQGLSGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTTYK-ALKEI 234          
BLAST of Cell cycle associated protein 1a vs. UniProt/SwissProt
Match: sp|Q1LZB6|CAPR1_BOVIN (Caprin-1 OS=Bos taurus OX=9913 GN=CAPRIN1 PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 2.265e-7
Identity = 64/190 (33.68%), Postives = 107/190 (56.32%), Query Frame = 2
Query:  131 IALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQ---KVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTSKEHALKSI 661
            +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D +    ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+ + ALK I
Sbjct:   47 VQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLADPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTTYK-ALKEI 234          
BLAST of Cell cycle associated protein 1a vs. UniProt/SwissProt
Match: sp|Q14444|CAPR1_HUMAN (Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 1.322e-6
Identity = 61/188 (32.45%), Postives = 103/188 (54.79%), Query Frame = 2
Query:  113 ALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQ---KVQSKLLSENYIEVGELDILKELF----CEIHISEKGN--WKKCSEQLQSLFEGGNKPLDLGTS 637
            A     +  E +K +L + +KK RNL+K+K KLD+Y+++ +    LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  Y+L+++ D +    ++  L     +   EL +L E +     E  +S + N  ++  S  L  L EG  KP+  GT+
Sbjct:   43 ATGTGAVQTEAMKQILGVIDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPV-CGTT 229          
BLAST of Cell cycle associated protein 1a vs. TrEMBL
Match: A0A3Q2YSU2 (Cell cycle associated protein 1a OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.987e-7
Identity = 64/197 (32.49%), Postives = 117/197 (59.39%), Query Frame = 2
Query:  140 ERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQ---------SKLLSENYIEVGELDILKELF-----CEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDEL 676
            + +K VL + +KK RN++K+K+KLD+Y+ K +    LN+DQ  A+SKYQE+++N+E   EL  + L   ++ +KTLKK  ++++L+ +  E   ++ V++  +LL+++ DH   Q         S LL++   ++  LD   +L      C++ ++E+  +++ S  L  L EG +K +  GTS + ALK I ++ L
Sbjct:   25 DAMKQVLGVLDKKVRNMEKKKSKLDDYQAKKNKGESLNQDQLEALSKYQEILTNIEFARELQKIFLTLGQEIQKTLKKTARRQQLQREEMEQRRLKTVLELQFLLDQLGDHNVRQDLTRPDASGSSLLTD--ADLASLDEFYKLVGPDRNCDVRLTEQ--YEEASLHLWELLEGRDKAV-AGTSYK-ALKDIMENLL 215          
BLAST of Cell cycle associated protein 1a vs. TrEMBL
Match: A0A3M7R8J9 (Caprin-1 isoform X1 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_051493 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 9.372e-7
Identity = 80/207 (38.65%), Postives = 111/207 (53.62%), Query Frame = 2
Query:  140 ERLKNVLIIFEXXXXXXXXXXXXXXEYK-KKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIEVG----ELDILKELFCEIHISEKG-NWKKCSEQLQS--LF--EGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDW 730
            E +K  LII EKK RNL+KR++KLDEYK  K  LNEDQ +AVSKY+EVV  LEL  EL    +    DA K  K+  K+E+LE +      ++   K   LLE  F  + V++  L+E+   +     EL +L E    I  SE G N +K S +     LF  EG NKP+    ++E   + ++ ++L +  EKI     L  N W
Sbjct:   58 EFIKQSLIIIEKKVRNLEKRRSKLDEYKASKTPLNEDQLLAVSKYEEVVRTLELARELEKQFISLSNDAMKQQKRQAKKEQLEREEIIKERLKEAHKINSLLE-TFGDENVRNNFLTESSGAIKLTEQELSMLDEFHKLIEPSEIGDNLEKSSTEAADHMLFTIEGRNKPI-TSFNQESTGQQVTYNDLKKLFEKI-----LTCNYW 257          
BLAST of Cell cycle associated protein 1a vs. TrEMBL
Match: A0A452GL87 (Cell cycle associated protein 1 OS=Gopherus agassizii OX=38772 GN=CAPRIN1 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.589e-6
Identity = 66/191 (34.55%), Postives = 108/191 (56.54%), Query Frame = 2
Query:  131 IALERLKNVLIIFEXXXXXXXXXXXXXXEYK----KKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKL-LSENYIEV---GELDILKELFCEIHISEKGN------WKKCSEQLQSLFEGGNKPLDLGTSKEHALKSI 661
            +  E +K +L + +KK RNL+K+K KLD+Y+    K   LN+DQ  AVSKYQEV +NLE   EL    +   +D +KT+KK  ++E+L  +  E   ++ V++  ++L+++ DH+ V+S L    N + V    EL +L E +  +      N      +++ S  L  L EG +KP+  GT+ + ALK +
Sbjct:   45 VQTEAMKQILGVIDKKLRNLEKKKGKLDDYQDRMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREEAEQKRLKTVLELQFILDKLGDHE-VRSDLKQGSNGVPVLTEEELTMLDEFYKLVDPERDMNMRLNEQYEQASIHLWDLLEGKDKPV-CGTTYK-ALKDV 232          
BLAST of Cell cycle associated protein 1a vs. TrEMBL
Match: A0A3N0XE15 (Caprin-1 OS=Anabarilius grahami OX=495550 GN=DPX16_15492 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.650e-6
Identity = 64/197 (32.49%), Postives = 108/197 (54.82%), Query Frame = 2
Query:   92 NCLMMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLL----SENYIEVGELDILKELFCEIHISEKGN------WKKCSEQLQSLFEGGNKPLDLGTSK 640
            N +  SN L   +   E +K VL++ EKK RN++K+K+KLD+Y+ +N     LN+DQ  A+SKYQEV+ NLE   EL+   L   ++ +KT+KK  ++E+L  +  E   ++ V++  +LL+R+ D + V+ +LL      + +   +L  L E +  +      N      +++ S+ L  L  G  KP+   T K
Sbjct:   26 NQITASNQLTGTQS--EAMKQVLVVLEKKVRNMEKKKSKLDDYQARNSKGERLNQDQLEALSKYQEVIHNLEFARELHKSFLALGQEIQKTVKKAARREQLHREEVEHKRLKRVLELQFLLDRLGD-ESVRQELLQGAGGPSLLTESDLTSLDEFYKLVGPERDQNIRLTDQYQEASQHLWELLAGKEKPVAGTTYK 219          
BLAST of Cell cycle associated protein 1a vs. TrEMBL
Match: Q802U4 (Cell cycle associated protein 1 OS=Danio rerio OX=7955 GN=caprin1b PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.476e-6
Identity = 62/197 (31.47%), Postives = 110/197 (55.84%), Query Frame = 2
Query:   92 NCLMMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKND----LNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLS----ENYIEVGELDILKELFCEIHISEKGN------WKKCSEQLQSLFEGGNKPLDLGTSK 640
            N +  SN L   +   E +K V+++ EKK RN++K+K+KLD+Y+ ++     LN+DQ  A+SKYQEV+ +LE   EL    L   ++ +KT+KK  ++E+L+ +  E   ++ V++  + L+R+ D + V+ +LL      + +  G+L  L E +  +      N      +++ S+ L  L EG +KP+   T K
Sbjct:   26 NQITASNQLTGTQS--EAMKQVMVVLEKKVRNMEKKKSKLDDYQARSSKGERLNQDQLEALSKYQEVIHSLEFTRELQKSFLALGQEIQKTVKKAARREQLQREESEQKRLKRVLELQFALDRLGD-ESVRQELLQGDGETSLLTEGDLTSLDEFYKLVGPERDQNIRLTDQYQEASQHLWELLEGKDKPVAGTTYK 219          
BLAST of Cell cycle associated protein 1a vs. Ensembl Cavefish
Match: caprin1b (caprin-1-like [Source:NCBI gene;Acc:103035197])

HSP 1 Score: 61.6178 bits (148), Expect = 1.472e-9
Identity = 63/201 (31.34%), Postives = 110/201 (54.73%), Query Frame = 2
Query:  140 ERLKNVLIIFEXXXXXXXXXXXXXXEYK----KKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQ--------SKLLSENYIEVGELDILKELFC---EIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKI 697
            E +K VL + EKK RN++K+K+KLD+Y+    K   LN DQ  A+SKYQEV  NLE   EL+   L   +D +K +KK  ++E+L+ +  + + +  +++  +LL+R+ D    Q          LL+E+  E+  LD   +L     + +I     +++ S+    L EG +KP+ +GT+ +H  + + +     C E++
Sbjct:   40 EAMKQVLGVIEKKVRNMEKKKSKLDDYQARINKGERLNHDQLDALSKYQEVSHNLEFARELHKSFLALNQDIQKAVKKAARREQLQREEVDQARLRKLLEVQFLLDRLGDEAMRQELLRSAGRPALLTES--ELAALDDFYKLVGPERDQNIRLTDQYQEASQHFWDLLEGKDKPV-VGTTYKHLKEMLERVLQSGCFERV 237          
BLAST of Cell cycle associated protein 1a vs. Ensembl Cavefish
Match: caprin1b (caprin-1-like [Source:NCBI gene;Acc:103035197])

HSP 1 Score: 61.6178 bits (148), Expect = 1.472e-9
Identity = 63/201 (31.34%), Postives = 110/201 (54.73%), Query Frame = 2
Query:  140 ERLKNVLIIFEXXXXXXXXXXXXXXEYK----KKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQ--------SKLLSENYIEVGELDILKELFC---EIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKI 697
            E +K VL + EKK RN++K+K+KLD+Y+    K   LN DQ  A+SKYQEV  NLE   EL+   L   +D +K +KK  ++E+L+ +  + + +  +++  +LL+R+ D    Q          LL+E+  E+  LD   +L     + +I     +++ S+    L EG +KP+ +GT+ +H  + + +     C E++
Sbjct:   40 EAMKQVLGVIEKKVRNMEKKKSKLDDYQARINKGERLNHDQLDALSKYQEVSHNLEFARELHKSFLALNQDIQKAVKKAARREQLQREEVDQARLRKLLEVQFLLDRLGDEAMRQELLRSAGRPALLTES--ELAALDDFYKLVGPERDQNIRLTDQYQEASQHFWDLLEGKDKPV-VGTTYKHLKEMLERVLQSGCFERV 237          
BLAST of Cell cycle associated protein 1a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005425.1 (pep scaffold:Pmarinus_7.0:GL476588:421313:428337:1 gene:ENSPMAG00000004905.1 transcript:ENSPMAT00000005425.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.364e-7
Identity = 51/158 (32.28%), Postives = 80/158 (50.63%), Query Frame = 2
Query:  215 EYKKK-ND---LNEDQQMAVSKYQEVVSNLELV-DELNTLA-LQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLS----ENYIEVGELDILKELFCEIH------ISEKGNWKKCSEQLQSLFEGGNKPLDLGTSK 640
            +YK K ND   LN+DQQ AV+KY EVVS+LE   D L T A L Q  D +K  KK  ++E L  +  E   +  V++  Y+L+ + D +  +   L+       +   E+  L +L+  ++       S +   ++ S+ L  L EG +KP+   T K
Sbjct:    7 DYKAKLNDGHALNQDQQEAVAKYMEVVSSLEFARDLLKTFASLNQ--DVQKVQKKAARREHLLREEAEQKRLRLVLEVQYILDSLGDGEAARLDFLAGQNGAALLLTQEMAYLDDLYKLVNPERVETTSFETQMEQASQHLWDLVEGKDKPVAGTTYK 162          
BLAST of Cell cycle associated protein 1a vs. Ensembl Medaka
Match: caprin1b (cell cycle associated protein 1 [Source:NCBI gene;Acc:101158019])

HSP 1 Score: 53.1434 bits (126), Expect = 4.942e-7
Identity = 51/124 (41.13%), Postives = 77/124 (62.10%), Query Frame = 2
Query:   98 LMMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYK-KKN---DLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFD 457
            LM S A   Q    E LK VL I +KK RN++K+K+KLD+Y  KKN    LN+DQ  A+SKYQEV++NLE   EL    +   +D +K +KK  ++E+L  +  E   ++ V++  ++L+R+ D
Sbjct:   24 LMGSFAQGGQS---EVLKQVLCIIDKKVRNMEKKKSKLDDYSVKKNKGEGLNQDQLEALSKYQEVMNNLEFARELQKTFITLGQDIQKVVKKSARREQLVREEAEQRRLKTVLEVQFILDRLGD 144          
BLAST of Cell cycle associated protein 1a vs. Ensembl Medaka
Match: caprin1b (cell cycle associated protein 1 [Source:NCBI gene;Acc:101158019])

HSP 1 Score: 53.1434 bits (126), Expect = 5.068e-7
Identity = 51/124 (41.13%), Postives = 77/124 (62.10%), Query Frame = 2
Query:   98 LMMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYK-KKN---DLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFD 457
            LM S A   Q    E LK VL I +KK RN++K+K+KLD+Y  KKN    LN+DQ  A+SKYQEV++NLE   EL    +   +D +K +KK  ++E+L  +  E   ++ V++  ++L+R+ D
Sbjct:   24 LMGSFAQGGQS---EVLKQVLCIIDKKVRNMEKKKSKLDDYSVKKNKGEGLNQDQLEALSKYQEVMNNLEFARELQKTFITLGQDIQKVVKKSARREQLVREEAEQRRLKTVLEVQFILDRLGD 144          
BLAST of Cell cycle associated protein 1a vs. Ensembl Medaka
Match: caprin1b (cell cycle associated protein 1 [Source:NCBI gene;Acc:101158019])

HSP 1 Score: 53.1434 bits (126), Expect = 5.385e-7
Identity = 51/124 (41.13%), Postives = 77/124 (62.10%), Query Frame = 2
Query:   98 LMMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYK-KKN---DLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFD 457
            LM S A   Q    E LK VL I +KK RN++K+K+KLD+Y  KKN    LN+DQ  A+SKYQEV++NLE   EL    +   +D +K +KK  ++E+L  +  E   ++ V++  ++L+R+ D
Sbjct:   24 LMGSFAQGGQS---EVLKQVLCIIDKKVRNMEKKKSKLDDYSVKKNKGEGLNQDQLEALSKYQEVMNNLEFARELQKTFITLGQDIQKVVKKSARREQLVREEAEQRRLKTVLEVQFILDRLGD 144          
BLAST of Cell cycle associated protein 1a vs. Ensembl Medaka
Match: orla-b2m (caprin family member 2 [Source:NCBI gene;Acc:101161935])

HSP 1 Score: 51.2174 bits (121), Expect = 2.299e-6
Identity = 45/164 (27.44%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  233 DLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSEN----YIEVGELDILKELFCEIHISEKGNWKKCSEQLQ-------SLFEGGNKPLDLGTSKEHALKSISKDELMRCIE 691
            +LN+DQ+ AV K++EV+ NL+   EL+       ++  K  KKV K++++E    E   +  V+K +YLL  +   + +Q  L++ N    +I   +L  L +L   + + ++ N     EQ+Q        L EG ++P+   T K      + K+E+ R ++
Sbjct:   89 ELNKDQKAAVEKFEEVLHNLDFARELHKTLDGLTQNLLKAQKKVVKKDQVERVEAERRRLAMVLKIHYLLGNM-QQEHIQKDLMTGNNQAPHIPSQKLHSLNQLAAMLGV-QRDNGLSLDEQMQKAALVYMDLLEGKDQPVAGSTYK------LLKEEITRLMD 244          
BLAST of Cell cycle associated protein 1a vs. Planmine SMEST
Match: SMESG000043092.1 (SMESG000043092.1)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 420/437 (96.11%), Postives = 421/437 (96.34%), Query Frame = 2
Query:   77 MNCVNNCLMMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIEVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQXXXXXXXXXXXXXXXXXXXVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKXXXXXXXXXXXXXXXXXAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFXXXXXXXXXXXXXXXXXXX---DNRQADELLTSMQ 1378
            MNCVNNCLMMSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYI+VGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQ AGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSR SR              DNRQADELLTSMQ
Sbjct:    1 MNCVNNCLMMSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIDVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQAAGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSRYSRPSRGRGRGRGNGRPDNRQADELLTSMQ 437          
BLAST of Cell cycle associated protein 1a vs. Planmine SMEST
Match: SMESG000043092.1 (SMESG000043092.1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 424/426 (99.53%), Postives = 425/426 (99.77%), Query Frame = 2
Query:  101 MMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIEVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQXXXXXXXXXXXXXXXXXXXVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKXXXXXXXXXXXXXXXXXAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFXXXXXXXXXXXXXXXXXXXDNRQADELLTSMQ 1378
            MMSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYI+VGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQ AGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSRPSRGRGRGRGNGRPDNRQADELLTSMQ
Sbjct:    1 MMSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIDVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQAAGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSRPSRGRGRGRGNGRPDNRQADELLTSMQ 426          
BLAST of Cell cycle associated protein 1a vs. Planmine SMEST
Match: SMESG000043092.1 (SMESG000043092.1)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 423/425 (99.53%), Postives = 424/425 (99.76%), Query Frame = 2
Query:  104 MSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIEVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQXXXXXXXXXXXXXXXXXXXVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKXXXXXXXXXXXXXXXXXAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFXXXXXXXXXXXXXXXXXXXDNRQADELLTSMQ 1378
            MSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYI+VGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQ AGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSRPSRGRGRGRGNGRPDNRQADELLTSMQ
Sbjct:    1 MSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIDVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQAAGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSRPSRGRGRGRGNGRPDNRQADELLTSMQ 425          
BLAST of Cell cycle associated protein 1a vs. Planmine SMEST
Match: SMESG000043092.1 (SMESG000043092.1)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 412/429 (96.04%), Postives = 413/429 (96.27%), Query Frame = 2
Query:  101 MMSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIEVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQXXXXXXXXXXXXXXXXXXXVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKXXXXXXXXXXXXXXXXXAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFXXXXXXXXXXXXXXXXXXX---DNRQADELLTSMQ 1378
            MMSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYI+VGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQ AGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSR SR              DNRQADELLTSMQ
Sbjct:    1 MMSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIDVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQAAGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSRYSRPSRGRGRGRGNGRPDNRQADELLTSMQ 429          
BLAST of Cell cycle associated protein 1a vs. Planmine SMEST
Match: SMESG000043092.1 (SMESG000043092.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 411/428 (96.03%), Postives = 412/428 (96.26%), Query Frame = 2
Query:  104 MSNALDAQEIALERLKNVLIIFEXXXXXXXXXXXXXXEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIEVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQXXXXXXXXXXXXXXXXXXXVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKXXXXXXXXXXXXXXXXXAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFXXXXXXXXXXXXXXXXXXX---DNRQADELLTSMQ 1378
            MSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYI+VGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQ AGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSR SR              DNRQADELLTSMQ
Sbjct:    1 MSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKKKNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQERLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIDVGELDILKELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDELMRCIEKISIVDWLASNDWKDNLNKEVEHEVQAAGDEDNEEENACEDIIEIVEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGYDSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSEFMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRGTFNSNSRYSRPSRGRGRGRGNGRPDNRQADELLTSMQ 428          
The following BLAST results are available for this feature:
BLAST of Cell cycle associated protein 1a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPRIN11.898e-732.45cell cycle associated protein 1 [Source:HGNC Symbo... [more]
CAPRIN11.898e-732.45cell cycle associated protein 1 [Source:HGNC Symbo... [more]
CAPRIN12.630e-732.17cell cycle associated protein 1 [Source:HGNC Symbo... [more]
CAPRIN12.753e-732.45cell cycle associated protein 1 [Source:HGNC Symbo... [more]
CAPRIN12.753e-732.45cell cycle associated protein 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
caprin1b1.635e-931.50cell cycle associated protein 1b [Source:ZFIN;Acc:... [more]
caprin1b1.635e-931.50cell cycle associated protein 1b [Source:ZFIN;Acc:... [more]
caprin24.163e-627.54caprin family member 2 [Source:NCBI gene;Acc:40772... [more]
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Caprin12.867e-833.68cell cycle associated protein 1 [Source:MGI Symbol... [more]
Caprin12.867e-833.68cell cycle associated protein 1 [Source:MGI Symbol... [more]
back to top
BLAST of Cell cycle associated protein 1a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q60865|CAPR1_MOUSE2.005e-733.68Caprin-1 OS=Mus musculus OX=10090 GN=Caprin1 PE=1 ... [more]
sp|Q5M9G3|CAPR1_RAT2.023e-733.68Caprin-1 OS=Rattus norvegicus OX=10116 GN=Caprin1 ... [more]
sp|Q1LZB6|CAPR1_BOVIN2.265e-733.68Caprin-1 OS=Bos taurus OX=9913 GN=CAPRIN1 PE=2 SV=... [more]
sp|Q14444|CAPR1_HUMAN1.322e-632.45Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 S... [more]
back to top
BLAST of Cell cycle associated protein 1a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2YSU23.987e-732.49Cell cycle associated protein 1a OS=Hippocampus co... [more]
A0A3M7R8J99.372e-738.65Caprin-1 isoform X1 OS=Brachionus plicatilis OX=10... [more]
A0A452GL871.589e-634.55Cell cycle associated protein 1 OS=Gopherus agassi... [more]
A0A3N0XE151.650e-632.49Caprin-1 OS=Anabarilius grahami OX=495550 GN=DPX16... [more]
Q802U42.476e-631.47Cell cycle associated protein 1 OS=Danio rerio OX=... [more]
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
caprin1b1.472e-931.34caprin-1-like [Source:NCBI gene;Acc:103035197][more]
caprin1b1.472e-931.34caprin-1-like [Source:NCBI gene;Acc:103035197][more]
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005425.11.364e-732.28pep scaffold:Pmarinus_7.0:GL476588:421313:428337:1... [more]
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell cycle associated protein 1a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
caprin1b4.942e-741.13cell cycle associated protein 1 [Source:NCBI gene;... [more]
caprin1b5.068e-741.13cell cycle associated protein 1 [Source:NCBI gene;... [more]
caprin1b5.385e-741.13cell cycle associated protein 1 [Source:NCBI gene;... [more]
orla-b2m2.299e-627.44caprin family member 2 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Cell cycle associated protein 1a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043092.10.000e+096.11SMESG000043092.1[more]
SMESG000043092.10.000e+099.53SMESG000043092.1[more]
SMESG000043092.10.000e+099.53SMESG000043092.1[more]
SMESG000043092.10.000e+096.04SMESG000043092.1[more]
SMESG000043092.10.000e+096.03SMESG000043092.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023258 ID=SMED30023258|Name=Cell cycle associated protein 1a|organism=Schmidtea mediterranea sexual|type=transcript|length=1587bp
CATTAAATATGTCTATTAATTTAAAATTATTCTGAAGTTTGTTCAAATTA
ACTCACCTCATTACATTTATTTTTGAATGAACTGTGTAAATAACTGCCTT
ATGATGTCGAATGCATTAGATGCCCAAGAGATTGCCTTAGAAAGACTTAA
AAATGTTTTGATTATCTTTGAGAAGAAGAAAAGGAATCTTGATAAGCGAA
AAAACAAATTAGATGAATATAAGAAAAAAAACGATTTAAATGAAGATCAA
CAAATGGCTGTTTCCAAATACCAGGAAGTTGTTTCAAATTTGGAATTGGT
TGATGAACTAAATACCTTAGCGCTTCAACAAATAAAGGATGCTGAGAAAA
CTTTAAAGAAGGTTAAGAAACAAGAAAGATTAGAAAATAAGAGACATGAA
GCCTCGTTGATTGAATTTGTAATGAAAACATATTATTTGTTAGAACGTAT
TTTCGATCATCAAAAAGTTCAATCCAAATTACTTTCAGAAAATTACATTG
AGGTTGGCGAATTGGATATTTTGAAAGAGCTATTTTGTGAAATTCATATA
AGTGAAAAGGGGAATTGGAAAAAATGTTCTGAGCAGCTTCAATCACTTTT
TGAGGGAGGCAATAAACCTTTAGATTTAGGTACATCTAAAGAGCATGCTT
TAAAATCAATTTCTAAGGATGAGTTAATGAGGTGCATAGAAAAAATTTCT
ATAGTTGATTGGTTAGCTTCAAATGACTGGAAAGACAATCTAAATAAAGA
AGTAGAACATGAGGTCCAGGAAGCTGGTGATGAAGATAATGAAGAAGAAA
ATGCATGTGAAGATATTATTGAAATTGTAGAACCACAACAACTTAGTCCT
AAAGAAATGGAAGCTCCAGTAGAAAAACATTCAGCGCAACCTGAAAATCC
AAAATTAAGTTTTGTATTTTTACACGAATCGTTAGTCCAAGAAGATGGAT
TTTCGAAAAACACTGAAAATGGTTATGATAGTACTGGTTACAATGACGAA
CATGTGCCAAGATCCAATTCACAATTGTCTGGAAAAAGTACTGGTAATTC
CAATCCAAATAATACTTGGAATACCGAAACTGAAAATGCTGTGGATGACG
TATTTAGTAGTGCAACGCAATCGGAATTTATGCATTCAGAAAATTCTAGG
AATTTGAAAACTCGTGGTCAACGTCAACCAACAAATGGAAGATTCAGAGG
ACGTGGTGCTCCTCAAGCGGCTTTTCCAAGTAGAGATGCACCTTCTGAAA
ACTATTGGACAAAGACTAATAGAGGCACTTTTAATTCCAATTCTCGACCT
AGTCGAGGGAGAGGACGTGGAAGAGGAAACGGACGCCCAGATAATAGACA
AGCGGATGAATTACTAACATCAATGCAGTAACTGCTCAAATCGATTTTAT
CCTGGCAGTGGATTTATTAAATTGGCATAACTGTGGAATGTTTCCTTGTT
TTGTTTTTGCAGCTGTGTAAAAATGCCTTTGGCAATGTTAGTAATAAATT
GAGATCCCAAAGGAATGTGCATTTTATAATTAAATAAATATATTTGTCAA
CTAATTGTCTTCGTGGTTAACTCATGAAATAATACCG
back to top

protein sequence of SMED30023258-orf-1

>SMED30023258-orf-1 ID=SMED30023258-orf-1|Name=SMED30023258-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=435bp
MNCVNNCLMMSNALDAQEIALERLKNVLIIFEKKKRNLDKRKNKLDEYKK
KNDLNEDQQMAVSKYQEVVSNLELVDELNTLALQQIKDAEKTLKKVKKQE
RLENKRHEASLIEFVMKTYYLLERIFDHQKVQSKLLSENYIEVGELDILK
ELFCEIHISEKGNWKKCSEQLQSLFEGGNKPLDLGTSKEHALKSISKDEL
MRCIEKISIVDWLASNDWKDNLNKEVEHEVQEAGDEDNEEENACEDIIEI
VEPQQLSPKEMEAPVEKHSAQPENPKLSFVFLHESLVQEDGFSKNTENGY
DSTGYNDEHVPRSNSQLSGKSTGNSNPNNTWNTETENAVDDVFSSATQSE
FMHSENSRNLKTRGQRQPTNGRFRGRGAPQAAFPSRDAPSENYWTKTNRG
TFNSNSRPSRGRGRGRGNGRPDNRQADELLTSMQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0042802identical protein binding
GO:0003723RNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR028816Caprin
Vocabulary: cellular component
TermDefinition
GO:0000932P-body
GO:0005737cytoplasm
GO:0005829cytosol
GO:0010494cytoplasmic stress granule
GO:0030425dendrite
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0017148negative regulation of translation
GO:0030154cell differentiation
GO:0050775positive regulation of dendrite morphogenesis
GO:0061003positive regulation of dendritic spine morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 14..58
NoneNo IPR availableCOILSCoilCoilcoord: 79..106
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 343..434
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 302..327
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 390..411
NoneNo IPR availablePANTHERPTHR22922:SF3CAPRIN-1coord: 14..256
IPR028816CaprinPANTHERPTHR22922GPI-ANCHORED PROTEIN P137coord: 14..256