nuclear factor Y complex C

Overview
Namenuclear factor Y complex C (AKG62118.1)
Smed IDSMED30023249
Length (bp)1363
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nuclear factor Y complex C (SMED30023249) t-SNE clustered cells

Violin plots show distribution of expression levels for nuclear factor Y complex C (SMED30023249) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nuclear factor Y complex C (SMED30023249) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nuclear factor Y complex C (SMED30023249) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023249

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30023249h1SMcG0016730 KU366703smed_ncbi_20240424PMID:27304889
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
X2 cellSMED30023249h1SMcG0016730 SmedASXL_001049SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30023249h1SMcG0016730 dd_Smed_v4_5610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nuclear factor Y complex C vs. Ensembl Human
Match: NFYC (nuclear transcription factor Y subunit gamma [Source:HGNC Symbol;Acc:HGNC:7806])

HSP 1 Score: 149.443 bits (376), Expect = 7.167e-43
Identity = 77/129 (59.69%), Postives = 92/129 (71.32%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPM 510
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K       R+  +  +P+
Sbjct:   19 LQSFWPRVMEEIRNLTVKD--FRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDELKPPKRQEVRQSVTPAEPV 141          
BLAST of nuclear factor Y complex C vs. Ensembl Human
Match: NFYC (nuclear transcription factor Y subunit gamma [Source:HGNC Symbol;Acc:HGNC:7806])

HSP 1 Score: 151.754 bits (382), Expect = 7.718e-42
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKP----PKRQE 130          
BLAST of nuclear factor Y complex C vs. Ensembl Human
Match: NFYC (nuclear transcription factor Y subunit gamma [Source:HGNC Symbol;Acc:HGNC:7806])

HSP 1 Score: 152.91 bits (385), Expect = 8.317e-42
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. Ensembl Human
Match: NFYC (nuclear transcription factor Y subunit gamma [Source:HGNC Symbol;Acc:HGNC:7806])

HSP 1 Score: 152.91 bits (385), Expect = 8.317e-42
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. Ensembl Human
Match: NFYC (nuclear transcription factor Y subunit gamma [Source:HGNC Symbol;Acc:HGNC:7806])

HSP 1 Score: 152.91 bits (385), Expect = 8.317e-42
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. Ensembl Celegans
Match: nfyc-1 (Nuclear transcription factor Y subunit gamma [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWV9])

HSP 1 Score: 105.145 bits (261), Expect = 3.740e-26
Identity = 48/107 (44.86%), Postives = 75/107 (70.09%), Query Frame = 1
Query:  130 NFWETAKLEISQIKTDQITFKSQDL--PLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVP 444
            +FW   K ++++I  + +  KS+++  P+AR+KKIM++D+DV+  MI+++API  A+AAEFFI E+T   W +    +RR LQ++DI  AV    +DQFDFLID +P
Sbjct:   49 DFWREKKQKMTEISEEDMLNKSKNMSVPMARVKKIMRIDDDVRNFMIASDAPIFMAQAAEFFIEEMTAMGWQYVSEARRRILQKADIASAV--QKSDQFDFLIDFLP 153          
BLAST of nuclear factor Y complex C vs. Ensembl Celegans
Match: nfyc-1 (Nuclear transcription factor Y subunit gamma [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWV9])

HSP 1 Score: 105.916 bits (263), Expect = 4.708e-26
Identity = 48/107 (44.86%), Postives = 75/107 (70.09%), Query Frame = 1
Query:  130 NFWETAKLEISQIKTDQITFKSQDL--PLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVP 444
            +FW   K ++++I  + +  KS+++  P+AR+KKIM++D+DV+  MI+++API  A+AAEFFI E+T   W +    +RR LQ++DI  AV    +DQFDFLID +P
Sbjct:   84 DFWREKKQKMTEISEEDMLNKSKNMSVPMARVKKIMRIDDDVRNFMIASDAPIFMAQAAEFFIEEMTAMGWQYVSEARRRILQKADIASAV--QKSDQFDFLIDFLP 188          
BLAST of nuclear factor Y complex C vs. Ensembl Celegans
Match: nfyc-1 (Nuclear transcription factor Y subunit gamma [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWV9])

HSP 1 Score: 105.916 bits (263), Expect = 4.708e-26
Identity = 48/107 (44.86%), Postives = 75/107 (70.09%), Query Frame = 1
Query:  130 NFWETAKLEISQIKTDQITFKSQDL--PLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVP 444
            +FW   K ++++I  + +  KS+++  P+AR+KKIM++D+DV+  MI+++API  A+AAEFFI E+T   W +    +RR LQ++DI  AV    +DQFDFLID +P
Sbjct:   84 DFWREKKQKMTEISEEDMLNKSKNMSVPMARVKKIMRIDDDVRNFMIASDAPIFMAQAAEFFIEEMTAMGWQYVSEARRRILQKADIASAV--QKSDQFDFLIDFLP 188          
BLAST of nuclear factor Y complex C vs. Ensembl Celegans
Match: pole-4 (pep chromosome:WBcel235:II:14968633:14969354:-1 gene:WBGene00013150.1 transcript:Y53F4B.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pole-4)

HSP 1 Score: 50.0618 bits (118), Expect = 4.653e-7
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLID 435
            LPL R+KK+++++ DV+  M++ EA  L AKAAE FI+E++  A  +    KR+T+Q  DI  A+    T  F FL D
Sbjct:   36 LPLGRVKKVVRMNPDVE--MLNNEALQLMAKAAELFIKELSNAANQNAALEKRKTVQTKDIDKAI--KKTWAFAFLED 109          
BLAST of nuclear factor Y complex C vs. Ensembl Fly
Match: Nf-YC (gene:FBgn0029905 transcript:FBtr0070974)

HSP 1 Score: 144.821 bits (364), Expect = 2.052e-37
Identity = 69/112 (61.61%), Postives = 86/112 (76.79%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIK 459
            ++NFW     E+  I   Q+  K Q LPLARIKKIMKLDE+ K  MI+ EAP+LFAKA E+FI+E+T+ AW+HTE ++RRTLQRSDI  A+A  + DQFDFLIDIVPR+EIK
Sbjct:  130 IDNFWPNIVSEVHSI--GQVDAKHQVLPLARIKKIMKLDENAK--MIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIA--NYDQFDFLIDIVPREEIK 235          
BLAST of nuclear factor Y complex C vs. Ensembl Fly
Match: Mes4 (gene:FBgn0034726 transcript:FBtr0071827)

HSP 1 Score: 59.6918 bits (143), Expect = 2.215e-10
Identity = 28/70 (40.00%), Postives = 48/70 (68.57%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDT 411
            LPLARI+ IMKLD D+   M + EA  + AKA E FI  ++  ++ +T ++K++T+Q+ D+ +A++  D+
Sbjct:   78 LPLARIRNIMKLDPDLH--MANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDS 145          
BLAST of nuclear factor Y complex C vs. Ensembl Fly
Match: Mes4 (gene:FBgn0034726 transcript:FBtr0301243)

HSP 1 Score: 59.6918 bits (143), Expect = 2.215e-10
Identity = 28/70 (40.00%), Postives = 48/70 (68.57%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDT 411
            LPLARI+ IMKLD D+   M + EA  + AKA E FI  ++  ++ +T ++K++T+Q+ D+ +A++  D+
Sbjct:   78 LPLARIRNIMKLDPDLH--MANNEAVFIVAKAVELFIASLSRESYTYTAQSKKKTIQKRDVDMAISAVDS 145          
BLAST of nuclear factor Y complex C vs. Ensembl Zebrafish
Match: nfyc (nuclear transcription factor Y, gamma [Source:ZFIN;Acc:ZDB-GENE-030131-2165])

HSP 1 Score: 154.836 bits (390), Expect = 1.455e-42
Identity = 78/122 (63.93%), Postives = 91/122 (74.59%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +  D   F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   17 LQSFWPRVMEEIRNLTVD---FRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 127          
BLAST of nuclear factor Y complex C vs. Ensembl Zebrafish
Match: nfyc (nuclear transcription factor Y, gamma [Source:ZFIN;Acc:ZDB-GENE-030131-2165])

HSP 1 Score: 150.984 bits (380), Expect = 2.164e-41
Identity = 77/122 (63.11%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   17 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 128          
BLAST of nuclear factor Y complex C vs. Ensembl Zebrafish
Match: nfyc (nuclear transcription factor Y, gamma [Source:ZFIN;Acc:ZDB-GENE-030131-2165])

HSP 1 Score: 151.754 bits (382), Expect = 2.288e-41
Identity = 77/122 (63.11%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   17 LQSFWPRVMEEIRNLTVKD--FRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 128          
BLAST of nuclear factor Y complex C vs. Ensembl Zebrafish
Match: nfyc (nuclear transcription factor Y, gamma [Source:ZFIN;Acc:ZDB-GENE-030131-2165])

HSP 1 Score: 151.754 bits (382), Expect = 2.288e-41
Identity = 77/122 (63.11%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   17 LQSFWPRVMEEIRNLTVKD--FRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 128          
BLAST of nuclear factor Y complex C vs. Ensembl Zebrafish
Match: nfyc (nuclear transcription factor Y, gamma [Source:ZFIN;Acc:ZDB-GENE-030131-2165])

HSP 1 Score: 151.754 bits (382), Expect = 2.288e-41
Identity = 77/122 (63.11%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   17 LQSFWPRVMEEIRNLTVKD--FRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 128          
BLAST of nuclear factor Y complex C vs. Ensembl Xenopus
Match: inpp5j (inositol polyphosphate-5-phosphatase J [Source:Xenbase;Acc:XB-GENE-984978])

HSP 1 Score: 154.836 bits (390), Expect = 1.622e-42
Identity = 79/122 (64.75%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ QDLPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   18 LQSFWPRVMEEIRNLTVK--DFRVQDLPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 129          
BLAST of nuclear factor Y complex C vs. Ensembl Xenopus
Match: inpp5j (inositol polyphosphate-5-phosphatase J [Source:Xenbase;Acc:XB-GENE-984978])

HSP 1 Score: 154.836 bits (390), Expect = 1.991e-42
Identity = 79/122 (64.75%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ QDLPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   18 LQSFWPRVMEEIRNLTVK--DFRVQDLPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 129          
BLAST of nuclear factor Y complex C vs. Ensembl Xenopus
Match: inpp5j (inositol polyphosphate-5-phosphatase J [Source:Xenbase;Acc:XB-GENE-984978])

HSP 1 Score: 149.828 bits (377), Expect = 9.467e-41
Identity = 74/101 (73.27%), Postives = 83/101 (82.18%), Query Frame = 1
Query:  187 FKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            F+ QDLPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   42 FRVQDLPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKP----PKRQE 134          
BLAST of nuclear factor Y complex C vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:NCBI gene;Acc:549359])

HSP 1 Score: 56.9954 bits (136), Expect = 1.195e-9
Identity = 31/76 (40.79%), Postives = 47/76 (61.84%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFL 429
            LPL+RIK +MK D D+   + S E+  + +KA E FI  I   A+++ ++ KR+TLQR D+  A+     D+F FL
Sbjct:   37 LPLSRIKALMKADPDLS--LASQESVFVISKATELFIETIAKDAYLYAQQGKRKTLQRKDLDNAI--DAIDEFAFL 108          
BLAST of nuclear factor Y complex C vs. Ensembl Xenopus
Match: pole4 (polymerase (DNA-directed), epsilon 4, accessory subunit [Source:NCBI gene;Acc:549359])

HSP 1 Score: 56.9954 bits (136), Expect = 1.429e-9
Identity = 32/87 (36.78%), Postives = 50/87 (57.47%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDF----LIDIVPRD 450
            LPL+RIK +MK D D+   + S E+  + +KA E FI  I   A+++ ++ KR+TLQR D+ + +A+      +F    LI   P D
Sbjct:   37 LPLSRIKALMKADPDLS--LASQESVFVISKATELFIETIAKDAYLYAQQGKRKTLQRKDLGMYIAEDPFSLCEFCGHSLIAPPPDD 121          
BLAST of nuclear factor Y complex C vs. Ensembl Mouse
Match: Nfyc (nuclear transcription factor-Y gamma [Source:MGI Symbol;Acc:MGI:107901])

HSP 1 Score: 152.525 bits (384), Expect = 6.138e-42
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. Ensembl Mouse
Match: Nfyc (nuclear transcription factor-Y gamma [Source:MGI Symbol;Acc:MGI:107901])

HSP 1 Score: 152.525 bits (384), Expect = 6.138e-42
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. Ensembl Mouse
Match: Nfyc (nuclear transcription factor-Y gamma [Source:MGI Symbol;Acc:MGI:107901])

HSP 1 Score: 152.525 bits (384), Expect = 6.138e-42
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. Ensembl Mouse
Match: Nfyc (nuclear transcription factor-Y gamma [Source:MGI Symbol;Acc:MGI:107901])

HSP 1 Score: 152.525 bits (384), Expect = 6.138e-42
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. Ensembl Mouse
Match: Nfyc (nuclear transcription factor-Y gamma [Source:MGI Symbol;Acc:MGI:107901])

HSP 1 Score: 63.5438 bits (153), Expect = 3.908e-12
Identity = 46/122 (37.70%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK                                        R+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVKD--FRVQELPLARIKKIMKLDEDVK----------------------------------------RNDIAMAIT--KFDQFDFLIDIVPRDELK----PPKRQE 92          
BLAST of nuclear factor Y complex C vs. UniProt/SwissProt
Match: sp|Q5E9X1|NFYC_BOVIN (Nuclear transcription factor Y subunit gamma OS=Bos taurus OX=9913 GN=NFYC PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 3.832e-41
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. UniProt/SwissProt
Match: sp|Q5RA23|NFYC_PONAB (Nuclear transcription factor Y subunit gamma OS=Pongo abelii OX=9601 GN=NFYC PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 4.120e-41
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. UniProt/SwissProt
Match: sp|Q62725|NFYC_RAT (Nuclear transcription factor Y subunit gamma OS=Rattus norvegicus OX=10116 GN=Nfyc PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 4.294e-41
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. UniProt/SwissProt
Match: sp|P70353|NFYC_MOUSE (Nuclear transcription factor Y subunit gamma OS=Mus musculus OX=10090 GN=Nfyc PE=1 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 4.294e-41
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVK--DFRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELKPP----KRQE 130          
BLAST of nuclear factor Y complex C vs. UniProt/SwissProt
Match: sp|Q13952|NFYC_HUMAN (Nuclear transcription factor Y subunit gamma OS=Homo sapiens OX=9606 GN=NFYC PE=1 SV=3)

HSP 1 Score: 154.066 bits (388), Expect = 1.522e-40
Identity = 78/122 (63.93%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRDE+K      KR+E
Sbjct:   19 LQSFWPRVMEEIRNLTVKD--FRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAIT--KFDQFDFLIDIVPRDELK----PPKRQE 130          
BLAST of nuclear factor Y complex C vs. TrEMBL
Match: A0A182BAE6 (Nuclear factor-Y subunit C OS=Schmidtea mediterranea OX=79327 GN=NF-YC PE=2 SV=1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 346/346 (100.00%), Postives = 346/346 (100.00%), Query Frame = 1
Query:   88 MDMFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNXXXXXXXXXXXXXXXVLNGQQQSHIFAIGGNQTNQQTAXXXXXXXXXXXXXXXXXXXXXXXSLDPQQXXXXXXXXXXXXXXDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI 1125
            MDMFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNSSDNQTATTMTTSSTVLNGQQQSHIFAIGGNQTNQQTATVVLQPGLLTGTTGTSIYSTTPLSLDPQQTSIATVATTASVTTDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI
Sbjct:    1 MDMFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNSSDNQTATTMTTSSTVLNGQQQSHIFAIGGNQTNQQTATVVLQPGLLTGTTGTSIYSTTPLSLDPQQTSIATVATTASVTTDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI 346          
BLAST of nuclear factor Y complex C vs. TrEMBL
Match: A0A0F7GWV4 (Nuclear factor Y complex C (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 2.773e-148
Identity = 277/278 (99.64%), Postives = 277/278 (99.64%), Query Frame = 1
Query:  292 KAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNXXXXXXXXXXXXXXXVLNGQQQSHIFAIGGNQTNQQTAXXXXXXXXXXXXXXXXXXXXXXXSLDPQQXXXXXXXXXXXXXXDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI 1125
            KAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNSSDNQTATTMTTSSTVLNGQQQSHIFAIGGNQTNQQTATVVLQPGLLTGTTGTSIYSTTPLSLDPQQTSIATVATTASVTT GDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI
Sbjct:   11 KAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNSSDNQTATTMTTSSTVLNGQQQSHIFAIGGNQTNQQTATVVLQPGLLTGTTGTSIYSTTPLSLDPQQTSIATVATTASVTTXGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI 288          
BLAST of nuclear factor Y complex C vs. TrEMBL
Match: A0A448XRZ0 (CBFD_NFYB_HMF domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS36933 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 4.649e-63
Identity = 126/253 (49.80%), Postives = 155/253 (61.26%), Query Frame = 1
Query:  100 ENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGN------LNLFGGNTIQLNT-QALSSGQLGLVDSNGLSVGANIIQAQGNQS---------------NVQNQSH--------GAVQYVLQLPIGSNNSLSGGQTIQIQMLPQ 768
            E +ES  +  +FWE AKLEI ++K D   FK+QDLPLARIKKIMKLD+DVK MMISAEAPILFAKAAE FIRE+TLRAW+HTERN+RRTLQR+D+ +AV+D DTDQFDFLIDIVPR+E + H     R  TS  Q +T V+ N            N   LNT Q L    + +  +NG+S  A+ I      S                  N  H        G +QYVLQLP  S  + + GQ+ Q+Q+LPQ
Sbjct:    6 EPSESHAQTASFWELAKLEIDEMKQDHNAFKTQDLPLARIKKIMKLDDDVKAMMISAEAPILFAKAAELFIRELTLRAWLHTERNRRRTLQRNDVAMAVSDSDTDQFDFLIDIVPREEARGH-----RRSTSTQQSVTTVSPNNSAAAATATIINNVPSLNTGQKLDYKTVTIPATNGVSATADGIVVSPTPSATAAAMQQSAAAVIGQANNPLHSAAGTIATGPIQYVLQLP-ASAAAAAPGQSFQLQVLPQ 252          
BLAST of nuclear factor Y complex C vs. TrEMBL
Match: A0A0R3WMJ4 (CBFD_NFYB_HMF domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1969 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 7.063e-63
Identity = 119/240 (49.58%), Postives = 153/240 (63.75%), Query Frame = 1
Query:  103 NTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLF-------------GGNTIQLNTQALSSGQLGLVD-SNG----LSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQ 768
            + +S   + NFWE AK E   +K +Q +FK+QDLPLARIKKIMKLD+DVKTMMISAEAPILFAKAAE FIRE+TLRAW+HT+RN+RRTLQR+DI++AV+ GDTDQFDFLIDIVPRDE + H    +R +  H Q   Q     +L              GG+ + + T+        LV  ++G    ++ G   +Q     +     S   +QYV+QLP  + +S S GQ  QIQMLPQ
Sbjct:    8 SCDSQTHIANFWEMAKQEAEGLKPEQNSFKTQDLPLARIKKIMKLDDDVKTMMISAEAPILFAKAAELFIRELTLRAWLHTDRNRRRTLQRNDISMAVSYGDTDQFDFLIDIVPRDEGRGH----RRSQQQHTQSALQHMAGSSLVQQTQVQVVQQQQAGGDDVSIKTETAGPTTATLVAGADGTLTTVAAGQPTVQFATVPAAAATTSGQQIQYVIQLP--ATSSASNGQPFQIQMLPQ 241          
BLAST of nuclear factor Y complex C vs. TrEMBL
Match: A0A564YCS7 (CBFD_NFYB_HMF domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5184 PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.351e-62
Identity = 120/251 (47.81%), Postives = 154/251 (61.35%), Query Frame = 1
Query:   82 FKMDMFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNL------------FGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQ----------NQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQ 768
            F  D+  N+++   + +FWE AK E   +K +Q +FK+QDLPLARIKKIMKLD+DVK MMISAEAPILFAKAAE FIRE+TLRAW+HT+RN+RRTLQR+DI++AV+ GDTDQFDFLIDIVPR+E ++H    +R +  H Q   Q     +L             GG  + + ++A       LV     +    +    G Q  VQ          N S   +QYV+QLP  S  + S GQ  QIQMLPQ
Sbjct:    3 FATDL--NSDAAAHIADFWEKAKQEAECLKPEQNSFKTQDLPLARIKKIMKLDDDVKNMMISAEAPILFAKAAELFIRELTLRAWLHTDRNRRRTLQRNDISMAVSLGDTDQFDFLIDIVPREEGRAH----RRSQQQHTQSALQQMAGSSLVQQAQVHVVQQHAGGEDVSIKSEAAGQATATLV----ANADGTLTTVTGGQPTVQFTTVPTATATNVSGQQIQYVIQLP-ASAATASNGQPFQIQMLPQ 242          
BLAST of nuclear factor Y complex C vs. Ensembl Cavefish
Match: nfyc (nuclear transcription factor Y subunit gamma [Source:NCBI gene;Acc:103023800])

HSP 1 Score: 151.369 bits (381), Expect = 2.355e-41
Identity = 77/122 (63.11%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   17 LQSFWPRVMEEIRNLTVKD--FRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 128          
BLAST of nuclear factor Y complex C vs. Ensembl Cavefish
Match: nfyc (nuclear transcription factor Y subunit gamma [Source:NCBI gene;Acc:103023800])

HSP 1 Score: 114.39 bits (285), Expect = 2.857e-28
Identity = 55/88 (62.50%), Postives = 70/88 (79.55%), Query Frame = 1
Query:  232 KLDEDVK--TMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            ++ E+++  T+MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   23 RVMEEIRNLTVMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 104          
BLAST of nuclear factor Y complex C vs. Ensembl Cavefish
Match: pole4 (DNA polymerase epsilon 4, accessory subunit [Source:NCBI gene;Acc:103045108])

HSP 1 Score: 56.9954 bits (136), Expect = 4.367e-9
Identity = 34/86 (39.53%), Postives = 50/86 (58.14%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDI----VPR 447
            LPL+RIK +MK D D+   + S E+  + AKA E F+  I   A ++ ++ KR+TLQR D+  A+     D+F FL  I    +PR
Sbjct:   64 LPLSRIKALMKADPDLS--LASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIE--AIDEFAFLEGIFLQPIPR 145          
BLAST of nuclear factor Y complex C vs. Ensembl Cavefish
Match: pole4 (DNA polymerase epsilon 4, accessory subunit [Source:NCBI gene;Acc:103045108])

HSP 1 Score: 55.0694 bits (131), Expect = 5.962e-9
Identity = 31/76 (40.79%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFL 429
            LPL+RIK +MK D D+   + S E+  + AKA E F+  I   A ++ ++ KR+TLQR D+  A+     D+F FL
Sbjct:   64 LPLSRIKALMKADPDLS--LASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIE--AIDEFAFL 135          
BLAST of nuclear factor Y complex C vs. Ensembl Cavefish
Match: chrac1 (chromatin accessibility complex subunit 1 [Source:NCBI gene;Acc:103031563])

HSP 1 Score: 50.0618 bits (118), Expect = 2.075e-7
Identity = 31/86 (36.05%), Postives = 48/86 (55.81%), Query Frame = 1
Query:  190 KSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPR 447
            K+  LP++R+K IMK   DV    I+ +A  L  KA E F++ + L ++ +    +  TL  SD  LA    +T+ F FL DI+P+
Sbjct:   17 KTISLPVSRVKLIMKSSPDVSC--INQDALFLTTKATELFVQHLALSSYNNGSGKETNTLSYSD--LANTAEETETFQFLTDILPK 98          
BLAST of nuclear factor Y complex C vs. Ensembl Sea Lamprey
Match: drap1 (DR1-associated protein 1 (negative cofactor 2 alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-400])

HSP 1 Score: 48.521 bits (114), Expect = 8.595e-7
Identity = 27/80 (33.75%), Postives = 44/80 (55.00%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIV 441
             P ARIKKIM+ DE+V    ++A  P++ ++A E F+  +  +A   T+    +T+  S +   +      QFDFL D+V
Sbjct:   12 FPPARIKKIMQTDEEVGK--VAAAVPVIISRALELFLESLLTKACQVTQSRNAKTMTTSHLKQCIE--AEQQFDFLKDLV 87          
BLAST of nuclear factor Y complex C vs. Ensembl Yeast
Match: HAP5 (Subunit of the Hap2p/3p/4p/5p CCAAT-binding complex; complex is heme-activated and glucose repressed; complex is a transcriptional activator and global regulator of respiratory gene expression; required for assembly and DNA binding activity of the complex [Source:SGD;Acc:S000005885])

HSP 1 Score: 122.094 bits (305), Expect = 1.536e-32
Identity = 59/90 (65.56%), Postives = 69/90 (76.67%), Query Frame = 1
Query:  178 QITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPR 447
            Q  FKS  LP ARI+K+MK DEDVK  MISAEAPI+FAKA E FI E+T+RAW   ERNKRRTLQ++DI  A+    +D FDFLID+VPR
Sbjct:  152 QDDFKSHSLPFARIRKVMKTDEDVK--MISAEAPIIFAKACEIFITELTMRAWCVAERNKRRTLQKADIAEALQ--KSDMFDFLIDVVPR 237          
BLAST of nuclear factor Y complex C vs. Ensembl Nematostella
Match: EDO41226 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4W7])

HSP 1 Score: 50.447 bits (119), Expect = 3.449e-8
Identity = 29/80 (36.25%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIV 441
             P ARIKKIM+ DEDV    ++A  P++ +KA E F++ +  +A  +T+    +TL  + +   +      QFDFL D+V
Sbjct:   12 FPPARIKKIMQTDEDVGK--VAAAVPVIISKALEIFMQTLVEKACNYTQARNAKTLSTAHLKRCIT--SEQQFDFLKDLV 87          
BLAST of nuclear factor Y complex C vs. Ensembl Medaka
Match: nfyc (nuclear transcription factor Y subunit gamma [Source:NCBI gene;Acc:101158212])

HSP 1 Score: 150.599 bits (379), Expect = 4.022e-41
Identity = 77/122 (63.11%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   17 LQSFWPRVMEEIRNLTLKD--FRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 128          
BLAST of nuclear factor Y complex C vs. Ensembl Medaka
Match: nfyc (nuclear transcription factor Y subunit gamma [Source:NCBI gene;Acc:101158212])

HSP 1 Score: 149.828 bits (377), Expect = 5.029e-41
Identity = 77/122 (63.11%), Postives = 90/122 (73.77%), Query Frame = 1
Query:  124 LNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            L +FW     EI  +      F+ Q+LPLARIKKIMKLDEDVK  MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   17 LQSFWPRVMEEIRNLTLKD--FRVQELPLARIKKIMKLDEDVK--MISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 128          
BLAST of nuclear factor Y complex C vs. Ensembl Medaka
Match: nfyc (nuclear transcription factor Y subunit gamma [Source:NCBI gene;Acc:101158212])

HSP 1 Score: 114.775 bits (286), Expect = 2.008e-28
Identity = 55/88 (62.50%), Postives = 70/88 (79.55%), Query Frame = 1
Query:  232 KLDEDVK--TMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREE 489
            ++ E+++  T+MISAEAP+LFAKAA+ FI E+TLRAWIHTE NKRRTLQR+DI +A+     DQFDFLIDIVPRD++K      KR+E
Sbjct:   23 RVMEEIRNLTLMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKF--DQFDFLIDIVPRDDLKPP----KRQE 104          
BLAST of nuclear factor Y complex C vs. Ensembl Medaka
Match: pole4 (DNA polymerase epsilon 4, accessory subunit [Source:NCBI gene;Acc:101162035])

HSP 1 Score: 58.9214 bits (141), Expect = 2.137e-10
Identity = 33/76 (43.42%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFL 429
            LPLARIK +MK D DV   + S E+  + AKA E F+  I   A ++ ++ KR+TLQR D+  A+     D+F FL
Sbjct:   48 LPLARIKALMKTDPDVS--LASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIE--AVDEFAFL 119          
BLAST of nuclear factor Y complex C vs. Ensembl Medaka
Match: drap1 (DR1 associated protein 1 [Source:NCBI gene;Acc:101159386])

HSP 1 Score: 48.1358 bits (113), Expect = 3.962e-6
Identity = 26/80 (32.50%), Postives = 44/80 (55.00%), Query Frame = 1
Query:  202 LPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIV 441
             P ARIKKIM+ DE++    ++A  P++ ++A E F+  +  +A   T+    +T+  S +   +      QFDFL D+V
Sbjct:   12 FPPARIKKIMQTDEEIGK--VAAAVPVIISRALELFLESLLTKACQVTQSRNAKTMTMSHLKQCIE--LEQQFDFLKDLV 87          
BLAST of nuclear factor Y complex C vs. Planmine SMEST
Match: SMESG000077821.1 (SMESG000077821.1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 346/346 (100.00%), Postives = 346/346 (100.00%), Query Frame = 1
Query:   88 MDMFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNXXXXXXXXXXXXXXXVLNGQQQSHIFAIGGNQTNQQTAXXXXXXXXXXXXXXXXXXXXXXXSLDPQQXXXXXXXXXXXXXXDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI 1125
            MDMFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNSSDNQTATTMTTSSTVLNGQQQSHIFAIGGNQTNQQTATVVLQPGLLTGTTGTSIYSTTPLSLDPQQTSIATVATTASVTTDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI
Sbjct:    1 MDMFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNSSDNQTATTMTTSSTVLNGQQQSHIFAIGGNQTNQQTATVVLQPGLLTGTTGTSIYSTTPLSLDPQQTSIATVATTASVTTDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI 346          
BLAST of nuclear factor Y complex C vs. Planmine SMEST
Match: SMESG000077821.1 (SMESG000077821.1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 344/344 (100.00%), Postives = 344/344 (100.00%), Query Frame = 1
Query:   94 MFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNXXXXXXXXXXXXXXXVLNGQQQSHIFAIGGNQTNQQTAXXXXXXXXXXXXXXXXXXXXXXXSLDPQQXXXXXXXXXXXXXXDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI 1125
            MFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNSSDNQTATTMTTSSTVLNGQQQSHIFAIGGNQTNQQTATVVLQPGLLTGTTGTSIYSTTPLSLDPQQTSIATVATTASVTTDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI
Sbjct:    1 MFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKLDEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDITLAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNLFGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAVQYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNSSDNQTATTMTTSSTVLNGQQQSHIFAIGGNQTNQQTATVVLQPGLLTGTTGTSIYSTTPLSLDPQQTSIATVATTASVTTDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI 344          
The following BLAST results are available for this feature:
BLAST of nuclear factor Y complex C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NFYC7.167e-4359.69nuclear transcription factor Y subunit gamma [Sour... [more]
NFYC7.718e-4263.93nuclear transcription factor Y subunit gamma [Sour... [more]
NFYC8.317e-4263.93nuclear transcription factor Y subunit gamma [Sour... [more]
NFYC8.317e-4263.93nuclear transcription factor Y subunit gamma [Sour... [more]
NFYC8.317e-4263.93nuclear transcription factor Y subunit gamma [Sour... [more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nfyc-13.740e-2644.86Nuclear transcription factor Y subunit gamma [Sou... [more]
nfyc-14.708e-2644.86Nuclear transcription factor Y subunit gamma [Sou... [more]
nfyc-14.708e-2644.86Nuclear transcription factor Y subunit gamma [Sou... [more]
pole-44.653e-742.31pep chromosome:WBcel235:II:14968633:14969354:-1 ge... [more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nf-YC2.052e-3761.61gene:FBgn0029905 transcript:FBtr0070974[more]
Mes42.215e-1040.00gene:FBgn0034726 transcript:FBtr0071827[more]
Mes42.215e-1040.00gene:FBgn0034726 transcript:FBtr0301243[more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfyc1.455e-4263.93nuclear transcription factor Y, gamma [Source:ZFIN... [more]
nfyc2.164e-4163.11nuclear transcription factor Y, gamma [Source:ZFIN... [more]
nfyc2.288e-4163.11nuclear transcription factor Y, gamma [Source:ZFIN... [more]
nfyc2.288e-4163.11nuclear transcription factor Y, gamma [Source:ZFIN... [more]
nfyc2.288e-4163.11nuclear transcription factor Y, gamma [Source:ZFIN... [more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inpp5j1.622e-4264.75inositol polyphosphate-5-phosphatase J [Source:Xen... [more]
inpp5j1.991e-4264.75inositol polyphosphate-5-phosphatase J [Source:Xen... [more]
inpp5j9.467e-4173.27inositol polyphosphate-5-phosphatase J [Source:Xen... [more]
pole41.195e-940.79polymerase (DNA-directed), epsilon 4, accessory su... [more]
pole41.429e-936.78polymerase (DNA-directed), epsilon 4, accessory su... [more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nfyc6.138e-4263.93nuclear transcription factor-Y gamma [Source:MGI S... [more]
Nfyc6.138e-4263.93nuclear transcription factor-Y gamma [Source:MGI S... [more]
Nfyc6.138e-4263.93nuclear transcription factor-Y gamma [Source:MGI S... [more]
Nfyc6.138e-4263.93nuclear transcription factor-Y gamma [Source:MGI S... [more]
Nfyc3.908e-1237.70nuclear transcription factor-Y gamma [Source:MGI S... [more]
back to top
BLAST of nuclear factor Y complex C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5E9X1|NFYC_BOVIN3.832e-4163.93Nuclear transcription factor Y subunit gamma OS=Bo... [more]
sp|Q5RA23|NFYC_PONAB4.120e-4163.93Nuclear transcription factor Y subunit gamma OS=Po... [more]
sp|Q62725|NFYC_RAT4.294e-4163.93Nuclear transcription factor Y subunit gamma OS=Ra... [more]
sp|P70353|NFYC_MOUSE4.294e-4163.93Nuclear transcription factor Y subunit gamma OS=Mu... [more]
sp|Q13952|NFYC_HUMAN1.522e-4063.93Nuclear transcription factor Y subunit gamma OS=Ho... [more]
back to top
BLAST of nuclear factor Y complex C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182BAE60.000e+0100.00Nuclear factor-Y subunit C OS=Schmidtea mediterran... [more]
A0A0F7GWV42.773e-14899.64Nuclear factor Y complex C (Fragment) OS=Schmidtea... [more]
A0A448XRZ04.649e-6349.80CBFD_NFYB_HMF domain-containing protein OS=Protopo... [more]
A0A0R3WMJ47.063e-6349.58CBFD_NFYB_HMF domain-containing protein OS=Hydatig... [more]
A0A564YCS71.351e-6247.81CBFD_NFYB_HMF domain-containing protein OS=Hymenol... [more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfyc2.355e-4163.11nuclear transcription factor Y subunit gamma [Sour... [more]
nfyc2.857e-2862.50nuclear transcription factor Y subunit gamma [Sour... [more]
pole44.367e-939.53DNA polymerase epsilon 4, accessory subunit [Sourc... [more]
pole45.962e-940.79DNA polymerase epsilon 4, accessory subunit [Sourc... [more]
chrac12.075e-736.05chromatin accessibility complex subunit 1 [Source:... [more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
drap18.595e-733.75DR1-associated protein 1 (negative cofactor 2 alph... [more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HAP51.536e-3265.56Subunit of the Hap2p/3p/4p/5p CCAAT-binding comple... [more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO412263.449e-836.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nuclear factor Y complex C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfyc4.022e-4163.11nuclear transcription factor Y subunit gamma [Sour... [more]
nfyc5.029e-4163.11nuclear transcription factor Y subunit gamma [Sour... [more]
nfyc2.008e-2862.50nuclear transcription factor Y subunit gamma [Sour... [more]
pole42.137e-1043.42DNA polymerase epsilon 4, accessory subunit [Sourc... [more]
drap13.962e-632.50DR1 associated protein 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of nuclear factor Y complex C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077821.10.000e+0100.00SMESG000077821.1[more]
SMESG000077821.10.000e+0100.00SMESG000077821.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30023249
GenBankAKG62118.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023249 ID=SMED30023249|Name=nuclear factor Y complex C|organism=Schmidtea mediterranea sexual|type=transcript|length=1363bp
AAATAAAAATAAAAAAAACCTATTATTATATTTTTTCTTGAAGTTTATCA
ATATTTTCCAGATTCCATATTGAATTTATGATTTAAGATGGATATGTTTG
AAAATACTGAATCGATTAATAAATTAAATAACTTCTGGGAAACTGCAAAA
TTAGAAATAAGTCAAATTAAGACAGATCAAATTACTTTTAAATCTCAAGA
TTTGCCTTTAGCGCGCATTAAGAAGATAATGAAATTGGACGAAGATGTTA
AAACTATGATGATTAGCGCTGAAGCGCCAATTTTATTTGCTAAAGCAGCA
GAATTTTTTATTCGTGAAATCACATTGAGAGCATGGATTCATACTGAACG
AAATAAACGGCGAACATTACAACGCAGTGACATAACGTTGGCTGTCGCTG
ATGGTGATACCGATCAATTTGATTTCTTAATTGATATTGTTCCAAGAGAT
GAAATCAAAAGTCATGGCTCTGCCACAAAACGAGAAGAAACATCTCATAA
TCAACCAATGACACAAGTCACTGGGAATTTAAACTTATTTGGAGGAAACA
CTATTCAGTTAAATACTCAAGCTTTATCGTCAGGGCAATTAGGATTAGTT
GATTCAAATGGTTTATCAGTTGGAGCTAATATAATTCAAGCTCAAGGCAA
TCAATCAAATGTTCAAAATCAATCTCATGGAGCTGTGCAGTATGTTTTAC
AATTACCGATTGGCTCTAACAATTCTTTGTCGGGTGGTCAAACAATTCAA
ATTCAAATGTTACCTCAGTCAATGATATCCAATTCCAGCGATAATCAAAC
CGCGACTACAATGACAACATCCAGCACCGTTTTGAATGGTCAACAACAAT
CTCATATATTTGCGATTGGTGGAAACCAGACCAATCAACAAACTGCAACT
GTGGTTTTACAACCCGGTCTGCTTACTGGAACCACTGGAACATCAATCTA
TTCGACCACTCCTTTATCATTAGATCCTCAACAAACCTCTATTGCTACTG
TTGCTACAACTGCGTCTGTAACTACTGATGGTGACCAGAATACCGGTGGC
AGTGGTGGCCACTTTGTTCTAACATCGATCAAAAGAGACACGGAGGAAAC
TGGATCACTAAATCAAGAACAAATATGAGACCCAATAAACTTTGTACAGC
ATTCATTGTAGATAAATAAATATGTAACAATCCCGTTATCATTTGATAGG
TGAATTCTCGCACAAGCTGTGTGTGTGTGCTCTCAACTCATTGGTTAATT
GAAAACGATCAATTGGTGGTTTTGCATTTACTATATATTATGTTAATTTA
TGTATTTACTGATTTTATTCAATGCATTTTATTATTAGTCTTGGTTTTTT
TTGGAAATTTATC
back to top

protein sequence of SMED30023249-orf-1

>SMED30023249-orf-1 ID=SMED30023249-orf-1|Name=SMED30023249-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=347bp
MDMFENTESINKLNNFWETAKLEISQIKTDQITFKSQDLPLARIKKIMKL
DEDVKTMMISAEAPILFAKAAEFFIREITLRAWIHTERNKRRTLQRSDIT
LAVADGDTDQFDFLIDIVPRDEIKSHGSATKREETSHNQPMTQVTGNLNL
FGGNTIQLNTQALSSGQLGLVDSNGLSVGANIIQAQGNQSNVQNQSHGAV
QYVLQLPIGSNNSLSGGQTIQIQMLPQSMISNSSDNQTATTMTTSSTVLN
GQQQSHIFAIGGNQTNQQTATVVLQPGLLTGTTGTSIYSTTPLSLDPQQT
SIATVATTASVTTDGDQNTGGSGGHFVLTSIKRDTEETGSLNQEQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR027170HAP5_su
IPR003958CBFA_NFYB_domain
IPR009072Histone-fold
Vocabulary: molecular function
TermDefinition
GO:0046982protein heterodimerization activity
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016602CCAAT-binding factor complex
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003958Transcription factor CBF/NF-Y/archaeal histone domainPFAMPF00808CBFD_NFYB_HMFcoord: 38..103
e-value: 1.3E-19
score: 70.2
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 2..120
e-value: 1.4E-37
score: 130.5
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 11..111
IPR027170Transcriptional activator HAP5 subunitPANTHERPTHR10252:SF8NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMAcoord: 11..276
NoneNo IPR availablePANTHERPTHR10252HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATEDcoord: 11..276