Vesicle transport protein GOT1B-like Protein

Overview
NameVesicle transport protein GOT1B-like Protein
Smed IDSMED30023234
Length (bp)539
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vesicle transport protein GOT1B-like Protein (SMED30023234) t-SNE clustered cells

Violin plots show distribution of expression levels for Vesicle transport protein GOT1B-like Protein (SMED30023234) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vesicle transport protein GOT1B-like Protein (SMED30023234) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vesicle transport protein GOT1B-like Protein (SMED30023234) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023234

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30023234SMESG000051715.1 dd_Smed_v4_5105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023234SMESG000051715.1 dd_Smed_v4_5105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30023234SMESG000051715.1 dd_Smed_v4_5105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30023234SMESG000051715.1 dd_Smed_v4_5105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Human
Match: GOLT1B (golgi transport 1B [Source:HGNC Symbol;Acc:HGNC:20175])

HSP 1 Score: 102.834 bits (255), Expect = 8.418e-28
Identity = 87/139 (62.59%), Postives = 113/139 (81.29%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+AGLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   PLIGM+ E YGFFLLF GF P+V+ F+ RVPV+G++L++PGI   V K+ G SN+MV
Sbjct:    1 MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKV-GESNNMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Human
Match: GOLT1B (golgi transport 1B [Source:HGNC Symbol;Acc:HGNC:20175])

HSP 1 Score: 95.1301 bits (235), Expect = 5.285e-25
Identity = 80/126 (63.49%), Postives = 104/126 (82.54%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINK 441
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+AGLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   PLIGM+ E YGFFLLF GF P+V+ F+ RVPV+G++L++PGI  
Sbjct:    1 MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRS 126          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Human
Match: GOLT1A (golgi transport 1A [Source:HGNC Symbol;Acc:HGNC:24766])

HSP 1 Score: 87.8113 bits (216), Expect = 4.525e-22
Identity = 72/139 (51.80%), Postives = 98/139 (70.50%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +I+++QKIGVG+ GFGIFFI FG +L FD  LLA GNLLFL GL+++IG  +TF FFFQ HK+KG+ F  GG++IV+   PL+GM +ETYGFF LF GF P+   FL      G + ++P +  +  +L  G++SMV
Sbjct:    1 MISITEWQKIGVGITGFGIFFILFGTLLYFDSVLLAFGNLLFLTGLSLIIGLRKTFWFFFQRHKLKGTSFLLGGVVIVLLRWPLLGMFLETYGFFSLFKGFFPVAFGFL------GNVCNIPFLGALFRRL-QGTSSMV 132          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Human
Match: GOLT1B (golgi transport 1B [Source:HGNC Symbol;Acc:HGNC:20175])

HSP 1 Score: 48.521 bits (114), Expect = 1.224e-7
Identity = 34/58 (58.62%), Postives = 45/58 (77.59%), Query Frame = 1
Query:  307 HPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
             PLIGM+ E YGFFLLF GF P+V+ F+ RVPV+G++L++PGI   V K+ G SN+MV
Sbjct:   18 WPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKV-GESNNMV 74          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Celegans
Match: eas-1 (Probable Golgi transport protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20263])

HSP 1 Score: 91.2781 bits (225), Expect = 9.278e-24
Identity = 54/101 (53.47%), Postives = 74/101 (73.27%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKL 456
            D ALLAIGNLLF+ G+  +IG +RT  FFF+  K+KGS  FFGGIL+V+F +PL GM+ E +GF +LF GF+P ++N L  +P I TI  +PGI +V+ +L
Sbjct:   33 DSALLAIGNLLFIVGITFIIGVQRTLVFFFEFRKLKGSILFFGGILVVLFGYPLFGMIAECWGFIVLFGGFLPGIVNLLRSIPGISTITYLPGIRQVLDRL 133          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Fly
Match: CG32576 (gene:FBgn0052576 transcript:FBtr0100556)

HSP 1 Score: 123.635 bits (309), Expect = 2.308e-36
Identity = 88/136 (64.71%), Postives = 110/136 (80.88%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSN 471
            M  ISD QKIG+GLAGFGIFF+F G++LLFDK LLAIGN+LF++GLA VIG ERT RFFFQ HK+KG+  F GGI+IV+   P+ GM+IE+YGFF LFSGF P+ +NFL RVPV+G++ ++P I K+V KLGG  N
Sbjct:    1 MIEISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKVKGTTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKIVQKLGGDGN 136          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Fly
Match: CG32576 (gene:FBgn0052576 transcript:FBtr0074245)

HSP 1 Score: 113.62 bits (283), Expect = 1.473e-32
Identity = 83/127 (65.35%), Postives = 104/127 (81.89%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKV 444
            M  ISD QKIG+GLAGFGIFF+F G++LLFDK LLAIGN+LF++GLA VIG ERT RFFFQ HK+KG+  F GGI+IV+   P+ GM+IE+YGFF LFSGF P+ +NFL RVPV+G++ ++P I KV
Sbjct:    1 MIEISDLQKIGIGLAGFGIFFLFLGMLLLFDKGLLAIGNILFISGLACVIGVERTMRFFFQRHKVKGTTAFLGGIVIVLLGFPIFGMIIESYGFFALFSGFFPVAINFLGRVPVLGSLFNLPFIQKV 127          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Zebrafish
Match: golt1bb (golgi transport 1Bb [Source:ZFIN;Acc:ZDB-GENE-050913-94])

HSP 1 Score: 98.5969 bits (244), Expect = 2.451e-26
Identity = 81/139 (58.27%), Postives = 115/139 (82.73%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+AGL+ VIG ERTFRFFFQ HK+K + FF GG+ +V+   P++G+++E YGFFLLF GF P+ + F+ RVP++G++L++PGI+ +V K+ G SN+MV
Sbjct:    1 MISLTDSQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNILFVAGLSFVIGLERTFRFFFQRHKMKATGFFLGGVCVVLIGWPIVGVVLEVYGFFLLFRGFFPVAVGFIRRVPILGSLLNLPGISGLVDKV-GESNAMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Zebrafish
Match: golt1a (golgi transport 1A [Source:ZFIN;Acc:ZDB-GENE-141212-320])

HSP 1 Score: 92.0485 bits (227), Expect = 6.487e-24
Identity = 74/139 (53.24%), Postives = 98/139 (70.50%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M AI++FQKIGVGL+GFG+FF+ FGI+L FD  LLA GN+LFL+GLA +IG +RT  FFFQ  K++ S FF GG+ +V+   P IGML+ETYGF LLF  F P+   FL       T+ ++P +  +++KL G S SMV
Sbjct:    1 MIAITEFQKIGVGLSGFGVFFVLFGILLYFDSVLLAFGNILFLSGLAFIIGLKRTAHFFFQRQKLRSSAFFLGGVALVLLRWPRIGMLVETYGFVLLFKSFFPVAFGFL------ATVFNIPFLTTILNKLSGSSTSMV 133          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Zebrafish
Match: golt1ba (golgi transport 1Ba [Source:ZFIN;Acc:ZDB-GENE-041210-157])

HSP 1 Score: 92.0485 bits (227), Expect = 7.907e-24
Identity = 81/139 (58.27%), Postives = 111/139 (79.86%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M ++SD QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+ GLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   P++G+++E YGFFLLF GF P+V+ F+ R+PV+G +L++P I+  V K+   SN+MV
Sbjct:    1 MISLSDSQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNILFVVGLAFVIGLERTFRFFFQKHKMKATSFFLGGVFVVLIGWPIVGVVLEFYGFFLLFRGFFPVVVGFIRRIPVLGYLLNLPFISGYVDKM-SESNNMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Zebrafish
Match: golt1ba (golgi transport 1Ba [Source:ZFIN;Acc:ZDB-GENE-041210-157])

HSP 1 Score: 91.2781 bits (225), Expect = 1.591e-23
Identity = 62/109 (56.88%), Postives = 85/109 (77.98%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            DKALLAIGN+LF+ GLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   P++G+++E YGFFLLF GF P+V+ F+ R+PV+G +L++P I+  V K+   SN+MV
Sbjct:   31 DKALLAIGNILFVVGLAFVIGLERTFRFFFQKHKMKATSFFLGGVFVVLIGWPIVGVVLEFYGFFLLFRGFFPVVVGFIRRIPVLGYLLNLPFISGYVDKM-SESNNMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Xenopus
Match: tert (telomerase reverse transcriptase [Source:Xenbase;Acc:XB-GENE-6451333])

HSP 1 Score: 103.99 bits (258), Expect = 1.902e-28
Identity = 68/109 (62.39%), Postives = 89/109 (81.65%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            DKALLAIGN+LF+AGLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   PLIGM++E YGFFLLF GF P+V+ F+ R+PV+G++L++PGI+ +V K  G SN+MV
Sbjct:   25 DKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKVKATGFFLGGVFVVLVGWPLIGMVLEIYGFFLLFRGFFPVVIGFIRRIPVLGSLLNLPGISSLVDK-AGESNNMV 132          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Xenopus
Match: tert (telomerase reverse transcriptase [Source:Xenbase;Acc:XB-GENE-6451333])

HSP 1 Score: 100.138 bits (248), Expect = 1.430e-26
Identity = 64/108 (59.26%), Postives = 87/108 (80.56%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSM 477
            DKALLAIGN+LF+AGLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   PLIGM++E YGFFLLF GF P+V+ F+ R+PV+G++L++PGI+ V  +  G +N++
Sbjct:   26 DKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKVKATGFFLGGVFVVLVGWPLIGMVLEIYGFFLLFRGFFPVVIGFIRRIPVLGSLLNLPGISSVKMEGSGTTNTL 133          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Mouse
Match: Golt1b (golgi transport 1B [Source:MGI Symbol;Acc:MGI:1914214])

HSP 1 Score: 103.605 bits (257), Expect = 2.306e-28
Identity = 87/139 (62.59%), Postives = 113/139 (81.29%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+AGLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   PLIGM+ E YGFFLLF GF P+V+ F+ RVPV+G++L++PGI   V K+ G SN+MV
Sbjct:    1 MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQRHKVKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKV-GESNNMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Mouse
Match: Gm28040 (predicted gene, 28040 [Source:MGI Symbol;Acc:MGI:5547776])

HSP 1 Score: 94.3597 bits (233), Expect = 8.027e-25
Identity = 76/139 (54.68%), Postives = 100/139 (71.94%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +I+++QKIGVG+ GFG+FFI FGI+L FD  LLA GNLLFL GL+++IG  RTF FFFQ HK+KG+ FF GG+ IV+   PL+GML+E YGF  LF GF P+V  FL      G+  ++P ++ +  KL G S+SMV
Sbjct:    1 MISITEWQKIGVGITGFGVFFILFGILLYFDSVLLAFGNLLFLTGLSLIIGLRRTFAFFFQRHKLKGTSFFLGGVAIVLLRWPLLGMLLEAYGFISLFKGFFPVVFGFL------GSAFNIPFLSTLFQKLQGSSSSMV 133          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Mouse
Match: Golt1a (golgi transport 1A [Source:MGI Symbol;Acc:MGI:1915588])

HSP 1 Score: 94.3597 bits (233), Expect = 8.027e-25
Identity = 76/139 (54.68%), Postives = 100/139 (71.94%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +I+++QKIGVG+ GFG+FFI FGI+L FD  LLA GNLLFL GL+++IG  RTF FFFQ HK+KG+ FF GG+ IV+   PL+GML+E YGF  LF GF P+V  FL      G+  ++P ++ +  KL G S+SMV
Sbjct:    1 MISITEWQKIGVGITGFGVFFILFGILLYFDSVLLAFGNLLFLTGLSLIIGLRRTFAFFFQRHKLKGTSFFLGGVAIVLLRWPLLGMLLEAYGFISLFKGFFPVVFGFL------GSAFNIPFLSTLFQKLQGSSSSMV 133          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Mouse
Match: Gm28040 (predicted gene, 28040 [Source:MGI Symbol;Acc:MGI:5547776])

HSP 1 Score: 83.1889 bits (204), Expect = 4.921e-20
Identity = 51/93 (54.84%), Postives = 63/93 (67.74%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFL---LRVPVIGTILS 423
            D  LLA GNLLFL GL+++IG  RTF FFFQ HK+KG+ FF GG+ IV+   PL+GML+E YGF  LF GF P+V  FL     +P + T L 
Sbjct:   31 DSVLLAFGNLLFLTGLSLIIGLRRTFAFFFQRHKLKGTSFFLGGVAIVLLRWPLLGMLLEAYGFISLFKGFFPVVFGFLGSAFNIPFLSTSLE 123          
BLAST of Vesicle transport protein GOT1B-like Protein vs. UniProt/SwissProt
Match: sp|Q9CR60|GOT1B_MOUSE (Vesicle transport protein GOT1B OS=Mus musculus OX=10090 GN=Golt1b PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.613e-27
Identity = 87/139 (62.59%), Postives = 113/139 (81.29%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+AGLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   PLIGM+ E YGFFLLF GF P+V+ F+ RVPV+G++L++PGI   V K+ G SN+MV
Sbjct:    1 MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQRHKVKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKV-GESNNMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. UniProt/SwissProt
Match: sp|Q9Y3E0|GOT1B_HUMAN (Vesicle transport protein GOT1B OS=Homo sapiens OX=9606 GN=GOLT1B PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.043e-27
Identity = 87/139 (62.59%), Postives = 113/139 (81.29%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+AGLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   PLIGM+ E YGFFLLF GF P+V+ F+ RVPV+G++L++PGI   V K+ G SN+MV
Sbjct:    1 MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKV-GESNNMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. UniProt/SwissProt
Match: sp|Q2YDE3|GOT1B_BOVIN (Vesicle transport protein GOT1B OS=Bos taurus OX=9913 GN=GOLT1B PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.043e-27
Identity = 87/139 (62.59%), Postives = 113/139 (81.29%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+AGLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   PLIGM+ E YGFFLLF GF P+V+ F+ RVPV+G++L++PGI   V K+ G SN+MV
Sbjct:    1 MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKV-GESNNMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. UniProt/SwissProt
Match: sp|Q9DCQ3|GOT1A_MOUSE (Vesicle transport protein GOT1A OS=Mus musculus OX=10090 GN=Golt1a PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 5.615e-24
Identity = 76/139 (54.68%), Postives = 100/139 (71.94%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +I+++QKIGVG+ GFG+FFI FGI+L FD  LLA GNLLFL GL+++IG  RTF FFFQ HK+KG+ FF GG+ IV+   PL+GML+E YGF  LF GF P+V  FL      G+  ++P ++ +  KL G S+SMV
Sbjct:    1 MISITEWQKIGVGITGFGVFFILFGILLYFDSVLLAFGNLLFLTGLSLIIGLRRTFAFFFQRHKLKGTSFFLGGVAIVLLRWPLLGMLLEAYGFISLFKGFFPVVFGFL------GSAFNIPFLSTLFQKLQGSSSSMV 133          
BLAST of Vesicle transport protein GOT1B-like Protein vs. UniProt/SwissProt
Match: sp|Q20263|GOT1_CAEEL (Probable Golgi transport protein 1 OS=Caenorhabditis elegans OX=6239 GN=eas-1 PE=3 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.180e-22
Identity = 54/101 (53.47%), Postives = 74/101 (73.27%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKL 456
            D ALLAIGNLLF+ G+  +IG +RT  FFF+  K+KGS  FFGGIL+V+F +PL GM+ E +GF +LF GF+P ++N L  +P I TI  +PGI +V+ +L
Sbjct:   33 DSALLAIGNLLFIVGITFIIGVQRTLVFFFEFRKLKGSILFFGGILVVLFGYPLFGMIAECWGFIVLFGGFLPGIVNLLRSIPGISTITYLPGIRQVLDRL 133          
BLAST of Vesicle transport protein GOT1B-like Protein vs. TrEMBL
Match: A0A3M6TQ70 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00010858 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 4.140e-39
Identity = 93/140 (66.43%), Postives = 116/140 (82.86%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGG-GSNSMV 480
            M  I+D+QKIG+G+ GFG+FF+F G++  FDK LLAIGN+LF++GLA+VIG ERTFRFFFQ HK+KGS  F GG+L+V+   PLIGM+IE YGF LLFSGF P+V+NFL RVPVIG IL++PGI+ +V KL G GSNSMV
Sbjct:    1 MLPITDYQKIGIGVTGFGVFFLFLGVLFFFDKGLLAIGNILFISGLALVIGLERTFRFFFQKHKLKGSSCFLGGVLVVLIGWPLIGMIIEIYGFILLFSGFFPVVINFLRRVPVIGNILNLPGISMIVGKLAGDGSNSMV 140          
BLAST of Vesicle transport protein GOT1B-like Protein vs. TrEMBL
Match: A0A2B4SSW3 (Vesicle transport protein GOT1A OS=Stylophora pistillata OX=50429 GN=Golt1a PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 8.313e-39
Identity = 92/140 (65.71%), Postives = 116/140 (82.86%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGG-GSNSMV 480
            M  I+D+QKIG+G+ GFG+FF+F G++  FDK LLAIGN+LF++GLA+VIG ERTFRFFFQ HK+KGS  F GG+L+V+   PLIGM+IE YGF LLFSGF P+V+NFL RVPVIG IL++PGI+ +V +L G GSNSMV
Sbjct:    1 MLPITDYQKIGIGVTGFGVFFLFLGVLFFFDKGLLAIGNILFISGLALVIGLERTFRFFFQKHKLKGSSCFLGGVLVVLIGWPLIGMIIEIYGFVLLFSGFFPVVINFLRRVPVIGNILNLPGISMIVDRLAGDGSNSMV 140          
BLAST of Vesicle transport protein GOT1B-like Protein vs. TrEMBL
Match: U5EWB4 (Putative vesicle-mediated transport OS=Corethrella appendiculata OX=1370023 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 7.752e-38
Identity = 96/136 (70.59%), Postives = 114/136 (83.82%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSN 471
            M+ ISD QKIGVGLAGFGI F+F G++LLFDK LLAIGN+LF+ GLA VIG ERTFRFFFQ HK+K S  FFGGI IV+F +PLIGM++ETYGF LLFSGF P+ +NFL RVP++GT L+MPGI+K+V KL G SN
Sbjct:    1 MFEISDTQKIGVGLAGFGIAFLFLGVLLLFDKGLLAIGNILFICGLACVIGLERTFRFFFQKHKVKASIAFFGGISIVLFGYPLIGMIVETYGFVLLFSGFFPVAINFLRRVPLLGTFLNMPGISKIVDKLAGDSN 136          
BLAST of Vesicle transport protein GOT1B-like Protein vs. TrEMBL
Match: Q1HQF4 (AAEL010895-PA OS=Aedes aegypti OX=7159 GN=5574055 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.007e-37
Identity = 96/136 (70.59%), Postives = 113/136 (83.09%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSN 471
            M+ ISD QKIGVGLAGFGI F+F G++LLFDK LLAIGN+LF+ GLA VIG ERTFRFFFQ HK+K S  FFGGILIV+  +PLIGMLIETYGF LLFSGF P+ +NFL RVP++G  L+MPG++KVV +L G SN
Sbjct:    1 MFEISDTQKIGVGLAGFGIAFLFLGVLLLFDKGLLAIGNILFICGLACVIGLERTFRFFFQKHKVKASIAFFGGILIVLLGYPLIGMLIETYGFILLFSGFFPVAINFLRRVPILGNFLNMPGVSKVVDRLAGDSN 136          
BLAST of Vesicle transport protein GOT1B-like Protein vs. TrEMBL
Match: A0A1S4FRL2 (Uncharacterized protein OS=Aedes aegypti OX=7159 GN=5574055 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.408e-37
Identity = 96/136 (70.59%), Postives = 113/136 (83.09%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSN 471
            M+ ISD QKIGVGLAGFGI F+F G++LLFDK LLAIGN+LF+ GLA VIG ERTFRFFFQ HK+K S  FFGGILIV+  +PLIGMLIETYGF LLFSGF P+ +NFL RVP++G  L+MPG++KVV +L G SN
Sbjct:    1 MFEISDTQKIGVGLAGFGIAFLFLGVLLLFDKGLLAIGNILFICGLACVIGLERTFRFFFQKHKVKASIAFFGGILIVLLGYPLIGMLIETYGFILLFSGFFPVAINFLRRVPILGNFLNMPGVSKVVDRLAGDSN 136          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Cavefish
Match: golt1bb (vesicle transport protein GOT1B [Source:NCBI gene;Acc:103028140])

HSP 1 Score: 98.2117 bits (243), Expect = 2.264e-26
Identity = 81/139 (58.27%), Postives = 115/139 (82.73%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+AGL+ VIG ERTFRFFFQ HK+K + FF GG+ +V+   P+IG+++E YGFFLLF GF P+ + F+ R+P++G++L++PGI+ +V K+ G SN+MV
Sbjct:    1 MISLTDSQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNILFVAGLSFVIGLERTFRFFFQRHKMKATGFFLGGVFVVLIGWPIIGVVLEVYGFFLLFRGFFPVAVGFIRRIPILGSLLNLPGISGLVDKV-GESNTMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Cavefish
Match: golt1a (golgi transport 1A [Source:NCBI gene;Acc:103045450])

HSP 1 Score: 86.6557 bits (213), Expect = 7.457e-22
Identity = 76/139 (54.68%), Postives = 98/139 (70.50%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M AI++FQKIGVG++GFGIFFI FG++L FD  LLA GN+LFL GLA +IG  RT  FFFQ  K++ S FF GG+ +VV   P IGML+E+YGFFLLF  F P+V  FL      GT+L++P +  + + L   S+SMV
Sbjct:    1 MVAITEFQKIGVGISGFGIFFILFGVLLYFDSVLLAFGNILFLTGLAFIIGLRRTAHFFFQRQKLRASSFFLGGVALVVLRWPRIGMLVESYGFFLLFKSFFPMVFGFL------GTVLNLPFLTTLFN-LSESSSSMV 132          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Cavefish
Match: golt1ba (vesicle transport protein GOT1B-like [Source:NCBI gene;Acc:103034056])

HSP 1 Score: 79.337 bits (194), Expect = 4.189e-19
Identity = 74/125 (59.20%), Postives = 102/125 (81.60%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGIN 438
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+ GLA VIG ERTFRFFFQ  KIK + FF GG+ +V+   P++G+++E YGFFLLF GF P+V+ F+ R+PV+G +L++P I+
Sbjct:    1 MISLTDSQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNILFVVGLAFVIGLERTFRFFFQ--KIKATSFFLGGVFVVLIGWPIVGLVLEFYGFFLLFRGFFPVVIGFIRRIPVLGYLLNLPFIS 123          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Yeast
Match: GOT1 (Homodimeric protein that is packaged into COPII vesicles; cycles between the ER and Golgi; involved in secretory transport but not directly required for aspects of transport assayed in vitro; may influence membrane composition [Source:SGD;Acc:S000004906])

HSP 1 Score: 72.0182 bits (175), Expect = 4.222e-17
Identity = 43/103 (41.75%), Postives = 67/103 (65.05%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGG 462
            D+ALLA+GN+LFL G+ ++IG ++T+ FF + +K +GS FF  G  +++     +G +IE+ G   LF  F  +++ FL  +P+IG ILS P I  +V KL G
Sbjct:   30 DRALLALGNILFLIGVFLIIGSQKTYIFFTRPNKRRGSLFFLVGAFLILLKWTFLGFIIESLGIIGLFGDFFGVIVQFLRSMPIIGPILSHPAIAPIVDKLAG 132          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Nematostella
Match: EDO40339 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7J0])

HSP 1 Score: 134.806 bits (338), Expect = 5.143e-41
Identity = 91/140 (65.00%), Postives = 118/140 (84.29%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGG-SNSMV 480
            M  I+D QKIG+G+ GFG+FF+FFG++L FDK LLAIGN+LF++GLA+VIG ERTFRFFFQ HK++GS  F GGI++V+   PL+GM+IETYGF LLFSGF P+V+NFL RVPVIG IL++P I+++VS++ G  SNSMV
Sbjct:    1 MLPITDLQKIGIGVTGFGMFFLFFGVLLFFDKGLLAIGNILFISGLALVIGLERTFRFFFQKHKLRGSTCFLGGIMVVLIGWPLVGMIIETYGFVLLFSGFFPVVVNFLRRVPVIGNILNLPVISQIVSRVAGEPSNSMV 140          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Medaka
Match: golt1bb (vesicle transport protein GOT1B [Source:NCBI gene;Acc:101162835])

HSP 1 Score: 100.523 bits (249), Expect = 2.893e-27
Identity = 83/139 (59.71%), Postives = 115/139 (82.73%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF++GL+ VIG ERTFRFFFQ HK+K + FF GG+L+V+   P+IG+++E YGFFLLF GF P+ + F+ RVPV+G++L +PGI+ +V K+ G SN+MV
Sbjct:    1 MISLTDSQKIGMGLTGFGVFFLFFGMVLFFDKALLAIGNILFVSGLSFVIGLERTFRFFFQRHKVKATSFFLGGVLVVLIGWPIIGVILEIYGFFLLFRGFFPVAVGFIRRVPVLGSLLRLPGISALVDKI-GESNTMV 138          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Medaka
Match: golt1ba (golgi transport 1B [Source:NCBI gene;Acc:101155893])

HSP 1 Score: 90.1225 bits (222), Expect = 2.948e-23
Identity = 77/125 (61.60%), Postives = 105/125 (84.00%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGIN 438
            M +++D QKIG+GL GFG+FF+FFG++L FDKALLAIGN+LF+AGLA VIG ERTFRFFFQ HK+K + FF GG+ +V+   P+IG+++E YGFFLLF GF P+V+ F+ R+PV+G+IL++P I+
Sbjct:    1 MISLTDSQKIGMGLTGFGVFFLFFGMVLFFDKALLAIGNILFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPIIGVVLEIYGFFLLFRGFFPVVVGFIRRIPVLGSILNLPFIS 125          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Medaka
Match: golt1a (golgi transport 1A [Source:NCBI gene;Acc:101160064])

HSP 1 Score: 75.0998 bits (183), Expect = 1.968e-17
Identity = 44/82 (53.66%), Postives = 59/82 (71.95%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRV 399
            D  LLA GN+LFLAGL  +IG  RT  FFFQ +K +G+ FF GG+ +V+F  P+IGML+E+YGF LLF  F P+ + F+L +
Sbjct:   31 DSVLLAFGNILFLAGLCFIIGIRRTAHFFFQRNKFRGTLFFLGGVTLVLFRWPVIGMLVESYGFVLLFRSFFPVAIGFVLSI 112          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Medaka
Match: golt1a (golgi transport 1A [Source:NCBI gene;Acc:101160064])

HSP 1 Score: 74.7146 bits (182), Expect = 1.017e-16
Identity = 44/82 (53.66%), Postives = 59/82 (71.95%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRV 399
            D  LLA GN+LFLAGL  +IG  RT  FFFQ +K +G+ FF GG+ +V+F  P+IGML+E+YGF LLF  F P+ + F+L +
Sbjct:   54 DSVLLAFGNILFLAGLCFIIGIRRTAHFFFQRNKFRGTLFFLGGVTLVLFRWPVIGMLVESYGFVLLFRSFFPVAIGFVLSI 135          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Medaka
Match: golt1a (golgi transport 1A [Source:NCBI gene;Acc:101160064])

HSP 1 Score: 75.0998 bits (183), Expect = 1.048e-16
Identity = 44/82 (53.66%), Postives = 59/82 (71.95%), Query Frame = 1
Query:  154 DKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRV 399
            D  LLA GN+LFLAGL  +IG  RT  FFFQ +K +G+ FF GG+ +V+F  P+IGML+E+YGF LLF  F P+ + F+L +
Sbjct:   31 DSVLLAFGNILFLAGLCFIIGIRRTAHFFFQRNKFRGTLFFLGGVTLVLFRWPVIGMLVESYGFVLLFRSFFPVAIGFVLSI 112          
BLAST of Vesicle transport protein GOT1B-like Protein vs. Planmine SMEST
Match: SMESG000051715.1 (SMESG000051715.1)

HSP 1 Score: 195.282 bits (495), Expect = 1.145e-64
Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 1
Query:   64 MYAISDFQKXXXXXXXXXXXXXXXXXXXXXDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCXXXXXXXXXXXXHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 480
            MYAISDFQKIGVGLAGFGIFFIFFGIMLLFDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCFFFGGILIVVFIHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV
Sbjct:    1 MYAISDFQKIGVGLAGFGIFFIFFGIMLLFDKALLAIGNLLFLAGLAMVIGFERTFRFFFQMHKIKGSCFFFGGILIVVFIHPLIGMLIETYGFFLLFSGFIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV 139          
The following BLAST results are available for this feature:
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GOLT1B8.418e-2862.59golgi transport 1B [Source:HGNC Symbol;Acc:HGNC:20... [more]
GOLT1B5.285e-2563.49golgi transport 1B [Source:HGNC Symbol;Acc:HGNC:20... [more]
GOLT1A4.525e-2251.80golgi transport 1A [Source:HGNC Symbol;Acc:HGNC:24... [more]
GOLT1B1.224e-758.62golgi transport 1B [Source:HGNC Symbol;Acc:HGNC:20... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eas-19.278e-2453.47Probable Golgi transport protein 1 [Source:UniPro... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG325762.308e-3664.71gene:FBgn0052576 transcript:FBtr0100556[more]
CG325761.473e-3265.35gene:FBgn0052576 transcript:FBtr0074245[more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
golt1bb2.451e-2658.27golgi transport 1Bb [Source:ZFIN;Acc:ZDB-GENE-0509... [more]
golt1a6.487e-2453.24golgi transport 1A [Source:ZFIN;Acc:ZDB-GENE-14121... [more]
golt1ba7.907e-2458.27golgi transport 1Ba [Source:ZFIN;Acc:ZDB-GENE-0412... [more]
golt1ba1.591e-2356.88golgi transport 1Ba [Source:ZFIN;Acc:ZDB-GENE-0412... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tert1.902e-2862.39telomerase reverse transcriptase [Source:Xenbase;A... [more]
tert1.430e-2659.26telomerase reverse transcriptase [Source:Xenbase;A... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Golt1b2.306e-2862.59golgi transport 1B [Source:MGI Symbol;Acc:MGI:1914... [more]
Gm280408.027e-2554.68predicted gene, 28040 [Source:MGI Symbol;Acc:MGI:5... [more]
Golt1a8.027e-2554.68golgi transport 1A [Source:MGI Symbol;Acc:MGI:1915... [more]
Gm280404.921e-2054.84predicted gene, 28040 [Source:MGI Symbol;Acc:MGI:5... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CR60|GOT1B_MOUSE1.613e-2762.59Vesicle transport protein GOT1B OS=Mus musculus OX... [more]
sp|Q9Y3E0|GOT1B_HUMAN4.043e-2762.59Vesicle transport protein GOT1B OS=Homo sapiens OX... [more]
sp|Q2YDE3|GOT1B_BOVIN4.043e-2762.59Vesicle transport protein GOT1B OS=Bos taurus OX=9... [more]
sp|Q9DCQ3|GOT1A_MOUSE5.615e-2454.68Vesicle transport protein GOT1A OS=Mus musculus OX... [more]
sp|Q20263|GOT1_CAEEL1.180e-2253.47Probable Golgi transport protein 1 OS=Caenorhabdit... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6TQ704.140e-3966.43Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A2B4SSW38.313e-3965.71Vesicle transport protein GOT1A OS=Stylophora pist... [more]
U5EWB47.752e-3870.59Putative vesicle-mediated transport OS=Corethrella... [more]
Q1HQF41.007e-3770.59AAEL010895-PA OS=Aedes aegypti OX=7159 GN=5574055 ... [more]
A0A1S4FRL21.408e-3770.59Uncharacterized protein OS=Aedes aegypti OX=7159 G... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
golt1bb2.264e-2658.27vesicle transport protein GOT1B [Source:NCBI gene;... [more]
golt1a7.457e-2254.68golgi transport 1A [Source:NCBI gene;Acc:103045450... [more]
golt1ba4.189e-1959.20vesicle transport protein GOT1B-like [Source:NCBI ... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GOT14.222e-1741.75Homodimeric protein that is packaged into COPII ve... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO403395.143e-4165.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
golt1bb2.893e-2759.71vesicle transport protein GOT1B [Source:NCBI gene;... [more]
golt1ba2.948e-2361.60golgi transport 1B [Source:NCBI gene;Acc:101155893... [more]
golt1a1.968e-1753.66golgi transport 1A [Source:NCBI gene;Acc:101160064... [more]
golt1a1.017e-1653.66golgi transport 1A [Source:NCBI gene;Acc:101160064... [more]
golt1a1.048e-1653.66golgi transport 1A [Source:NCBI gene;Acc:101160064... [more]
back to top
BLAST of Vesicle transport protein GOT1B-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000051715.11.145e-64100.00SMESG000051715.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023234 ID=SMED30023234|Name=Vesicle transport protein GOT1B-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=539bp
TTTTCAAACTATTATCGATGATGTGTTAATTATTTTTTATTTGTAAAATT
TCAAAACATAGTTATGTATGCTATTAGTGATTTTCAGAAAATCGGCGTTG
GTTTAGCTGGATTTGGAATATTTTTTATTTTCTTCGGAATTATGCTTTTA
TTCGATAAAGCTCTTTTGGCAATTGGAAATCTCCTGTTTCTTGCGGGATT
GGCAATGGTTATTGGTTTTGAGAGAACTTTTAGATTTTTTTTTCAAATGC
ACAAAATAAAAGGATCTTGTTTCTTTTTTGGTGGAATTCTTATAGTGGTT
TTCATTCACCCATTAATTGGTATGCTCATTGAGACTTATGGATTTTTCCT
TCTTTTCAGTGGATTTATTCCTATTGTATTGAACTTTTTATTGAGAGTTC
CAGTAATTGGAACAATTTTGAGTATGCCTGGTATTAATAAAGTTGTATCG
AAATTGGGGGGAGGAAGTAATTCGATGGTGTGAAGATTTATTTTGCAATT
ATTATTACTATCACTGTAAATATGTTTTGCTTGCGATCG
back to top

protein sequence of SMED30023234-orf-1

>SMED30023234-orf-1 ID=SMED30023234-orf-1|Name=SMED30023234-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MYAISDFQKIGVGLAGFGIFFIFFGIMLLFDKALLAIGNLLFLAGLAMVI
GFERTFRFFFQMHKIKGSCFFFGGILIVVFIHPLIGMLIETYGFFLLFSG
FIPIVLNFLLRVPVIGTILSMPGINKVVSKLGGGSNSMV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR007305Vesicle_transpt_Got1/SFT2
Vocabulary: biological process
TermDefinition
GO:0016192vesicle-mediated transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007305Vesicle transport protein, Got1/SFT2-likePFAMPF04178Got1coord: 19..113
e-value: 6.4E-15
score: 55.6
NoneNo IPR availablePANTHERPTHR21493:SF79VESICLE TRANSPORT PROTEIN GOT1Bcoord: 1..138
NoneNo IPR availablePANTHERPTHR21493CGI-141-RELATED/LIPASE CONTAINING PROTEINcoord: 1..138
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 93..115