Lysine methyltransferase 2E

Overview
NameLysine methyltransferase 2E
Smed IDSMED30023232
Length (bp)6458
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysine methyltransferase 2E (SMED30023232) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysine methyltransferase 2E (SMED30023232) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysine methyltransferase 2E (SMED30023232) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysine methyltransferase 2E (SMED30023232) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023232

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023232SMESG000051295.1 dd_Smed_v4_9956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023232SMESG000031906.1 SMESG000031905.1 Contig3786GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023232SMESG000051295.1 Contig3786GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30023232SMESG000051295.1 dd_Smed_v4_3192_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30023232SMESG000051295.1 DN314063ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023232SMESG000051295.1 DN314063ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023232SMESG000051295.1 DN314063ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30023232SMESG000051295.1 HO006509ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023232SMESG000051295.1 HO006509ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023232SMESG000051295.1 HO006509ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysine methyltransferase 2E vs. Ensembl Human
Match: KMT2E (lysine methyltransferase 2E [Source:HGNC Symbol;Acc:HGNC:18541])

HSP 1 Score: 114.005 bits (284), Expect = 4.131e-26
Identity = 57/130 (43.85%), Postives = 80/130 (61.54%), Query Frame = 3
Query: 1758 NQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCE 2147
            N+ ++KS K+L    +I+E+ G   L E +     + K   PFVLFY KF  L + +DA +   ++++IRRSCTPNAEV+H  I +G+I  +I  I+ I   TEITI FDF+Y  C Y V+CAC   N E
Sbjct:  197 NKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE-IQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPE 325          
BLAST of Lysine methyltransferase 2E vs. Ensembl Human
Match: SETD5 (SET domain containing 5 [Source:HGNC Symbol;Acc:HGNC:25566])

HSP 1 Score: 117.087 bits (292), Expect = 2.684e-25
Identity = 55/158 (34.81%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  + S       +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  ++ I+ D E+TI FD+ Y  C+Y V+CAC  G+ NC ++
Sbjct:  160 LACNNTVIGSQMQLQLGRVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQ 316          
BLAST of Lysine methyltransferase 2E vs. Ensembl Human
Match: SETD5 (SET domain containing 5 [Source:HGNC Symbol;Acc:HGNC:25566])

HSP 1 Score: 116.316 bits (290), Expect = 4.685e-25
Identity = 55/158 (34.81%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  + S       +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  ++ I+ D E+TI FD+ Y  C+Y V+CAC  G+ NC ++
Sbjct:  258 LACNNTVIGSQMQLQLGRVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQ 414          
BLAST of Lysine methyltransferase 2E vs. Ensembl Human
Match: SETD5 (SET domain containing 5 [Source:HGNC Symbol;Acc:HGNC:25566])

HSP 1 Score: 116.316 bits (290), Expect = 4.685e-25
Identity = 55/158 (34.81%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  + S       +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  ++ I+ D E+TI FD+ Y  C+Y V+CAC  G+ NC ++
Sbjct:  258 LACNNTVIGSQMQLQLGRVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQ 414          
BLAST of Lysine methyltransferase 2E vs. Ensembl Human
Match: SETD5 (SET domain containing 5 [Source:HGNC Symbol;Acc:HGNC:25566])

HSP 1 Score: 116.316 bits (290), Expect = 4.881e-25
Identity = 55/158 (34.81%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  + S       +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  ++ I+ D E+TI FD+ Y  C+Y V+CAC  G+ NC ++
Sbjct:  277 LACNNTVIGSQMQLQLGRVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQ 433          
BLAST of Lysine methyltransferase 2E vs. Ensembl Celegans
Match: set-26 (Histone-lysine N-methyltransferase set-26 [Source:UniProtKB/Swiss-Prot;Acc:Q9U263])

HSP 1 Score: 63.5438 bits (153), Expect = 2.389e-9
Identity = 36/124 (29.03%), Postives = 56/124 (45.16%), Query Frame = 3
Query:  885 SNEINSSCDKTTDKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKF-PILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQP 1253
            S+  +   D+  +++  +  RC CG  H DG  I CE C+TWQH+ CM    K     YKCE C PR +  S+A A +    I  +L              + +  ++ + S+   P  +  QP
Sbjct:  778 SDSESEGIDEAAEESWTM--RCHCGMDHGDGDTIECEGCKTWQHMACMGLTLKSNTSKYKCEMCLPRRLPVSKAEAAREQERILNRLRAAAKKQKRKSEPVEQKQKSQPSTSRKSAPMALQQQP 899          

HSP 2 Score: 60.4622 bits (145), Expect = 1.786e-8
Identity = 35/121 (28.93%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 1788 LHCSEVIMEFNGFISLSEDYNKE-------FDYRKHYNPFVLFYEKFDHLSLA-IDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECA 2126
            +   +VI+E NG +S+S +  ++       F Y           +  D   L  ID   K  D+K+ RRSC PN  +KH +  N ++   I     I+ +TE+T+ FD ++++    +ECA
Sbjct:  958 VQIRQVILEVNGHVSMSNEVKRQPGGGNCIFMYDGLMK-GTAGEDMGDGQELVCIDTKRKGNDTKFTRRSCVPNCVLKHVLGSNATLGIMIVATKDITRNTEVTLPFDADWRESEVELECA 1077          
BLAST of Lysine methyltransferase 2E vs. Ensembl Celegans
Match: set-9 (Histone-lysine N-methyltransferase set-9 [Source:UniProtKB/Swiss-Prot;Acc:O44498])

HSP 1 Score: 62.003 bits (149), Expect = 6.169e-9
Identity = 32/87 (36.78%), Postives = 45/87 (51.72%), Query Frame = 3
Query:  885 SNEINSSCDKTTDKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKF-PILYKCEKCEPRSIDYSRAVATQTNFLIKMKL 1142
            S+  +   D+  +++  +  RC CG  H DG  I CE C+TWQH+ CM    K     YKCE C PR +  S+A A +    I  +L
Sbjct:  770 SDSESEGIDEAAEESWTM--RCHCGMDHGDGDTIECEGCKTWQHMACMGLTLKSNTSKYKCEMCLPRRLPVSKAEAAREQERILNRL 854          

HSP 2 Score: 60.8474 bits (146), Expect = 1.262e-8
Identity = 35/121 (28.93%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 1788 LHCSEVIMEFNGFISLSEDYNKE-------FDYRKHYNPFVLFYEKFDHLSLA-IDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECA 2126
            +   +VI+E NG +S+S +  ++       F Y           +  D   L  ID   K  D+K+ RRSC PN  +KH +  N ++   I     I+ +TE+T+ FD ++++    +ECA
Sbjct:  950 VQIRQVILEVNGHVSMSSEVKRQPGGGNCIFMYDGLMK-GTAGEDMGDGQELVCIDTKRKGNDTKFTRRSCVPNCVLKHVLGSNATLGIMIVATKDITRNTEVTLPFDADWRESEVELECA 1069          
BLAST of Lysine methyltransferase 2E vs. Ensembl Celegans
Match: C16A11.4 (pep chromosome:WBcel235:II:4227046:4229157:1 gene:WBGene00015817.1 transcript:C16A11.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C16A11.4)

HSP 1 Score: 58.151 bits (139), Expect = 5.191e-8
Identity = 32/73 (43.84%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  912 KTTDKTINLIP-----RCVCGYTHDDGGLIRCEICQTWQHIICM--YPDNKFPILYKCEKCEPRSIDYSRAVA 1109
            K+T    NL P     RC CG  + D  LI+C  C+ WQH ICM   P +   + YKCE CEPR +  SR+ A
Sbjct:   19 KSTRAVNNLSPHQKEVRCQCGTNNTDNRLIKCVECEKWQHAICMSVMPLD-IIMTYKCEMCEPRLLMVSRSQA 90          
BLAST of Lysine methyltransferase 2E vs. Ensembl Celegans
Match: C16A11.4 (pep chromosome:WBcel235:II:4227046:4229157:1 gene:WBGene00015817.1 transcript:C16A11.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C16A11.4)

HSP 1 Score: 58.151 bits (139), Expect = 5.665e-8
Identity = 32/73 (43.84%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  912 KTTDKTINLIP-----RCVCGYTHDDGGLIRCEICQTWQHIICM--YPDNKFPILYKCEKCEPRSIDYSRAVA 1109
            K+T    NL P     RC CG  + D  LI+C  C+ WQH ICM   P +   + YKCE CEPR +  SR+ A
Sbjct:   19 KSTRAVNNLSPHQKEVRCQCGTNNTDNRLIKCVECEKWQHAICMSVMPLD-IIMTYKCEMCEPRLLMVSRSQA 90          
BLAST of Lysine methyltransferase 2E vs. Ensembl Fly
Match: upSET (gene:FBgn0036398 transcript:FBtr0333050)

HSP 1 Score: 75.485 bits (184), Expect = 6.410e-13
Identity = 29/60 (48.33%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQ 1115
            + RC+C  THDDG +I C+ C  WQH+ CM  D +  P  Y CE C+PR++D +RA A Q
Sbjct:  854 VTRCICELTHDDGYMICCDKCSAWQHVDCMGIDRQNIPEEYMCELCQPRAVDKARARALQ 913          
BLAST of Lysine methyltransferase 2E vs. Ensembl Fly
Match: upSET (gene:FBgn0036398 transcript:FBtr0075768)

HSP 1 Score: 75.485 bits (184), Expect = 6.410e-13
Identity = 29/60 (48.33%), Postives = 39/60 (65.00%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQ 1115
            + RC+C  THDDG +I C+ C  WQH+ CM  D +  P  Y CE C+PR++D +RA A Q
Sbjct:  854 VTRCICELTHDDGYMICCDKCSAWQHVDCMGIDRQNIPEEYMCELCQPRAVDKARARALQ 913          
BLAST of Lysine methyltransferase 2E vs. Ensembl Fly
Match: ash1 (gene:FBgn0005386 transcript:FBtr0306009)

HSP 1 Score: 58.151 bits (139), Expect = 1.252e-7
Identity = 22/49 (44.90%), Postives = 29/49 (59.18%), Query Frame = 3
Query:  945 RCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSID 1091
            RC+CG   D+G +I+C  C  WQH  C   D      Y+CE+CEPR +D
Sbjct: 1859 RCICGLYKDEGLMIQCSKCMVWQHTECTKADIDADN-YQCERCEPREVD 1906          
BLAST of Lysine methyltransferase 2E vs. Ensembl Fly
Match: ash1 (gene:FBgn0005386 transcript:FBtr0306010)

HSP 1 Score: 58.151 bits (139), Expect = 1.252e-7
Identity = 22/49 (44.90%), Postives = 29/49 (59.18%), Query Frame = 3
Query:  945 RCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSID 1091
            RC+CG   D+G +I+C  C  WQH  C   D      Y+CE+CEPR +D
Sbjct: 1859 RCICGLYKDEGLMIQCSKCMVWQHTECTKADIDADN-YQCERCEPREVD 1906          
BLAST of Lysine methyltransferase 2E vs. Ensembl Zebrafish
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 125.176 bits (313), Expect = 5.334e-28
Identity = 56/135 (41.48%), Postives = 86/135 (63.70%), Query Frame = 3
Query: 1746 KYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNC 2144
            +   N+ ++K++++L    +I+E+ G + L + +     + K   PFVLFY KFD L + +DA S   ++++IRRSCTPNAEV+H VI  G +  +I  +  IS  +EITIGFD++Y  C Y V+CAC  G+P C
Sbjct:  336 QVQKNKRILKAVRDLAADSLIIEYRGKVMLRQQFEANGYFFKRPYPFVLFYSKFDGLEMCVDARSFGNEARFIRRSCTPNAEVRH-VIEEGMLHLYIYSLRSISKGSEITIGFDYDYGSCKYKVDCACVKGNPEC 469          

HSP 2 Score: 77.0258 bits (188), Expect = 2.305e-13
Identity = 31/61 (50.82%), Postives = 41/61 (67.21%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQT 1118
            I RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PR++D   A+  QT
Sbjct:  127 ITRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPETYLCERCQPRTLDREHAILLQT 187          
BLAST of Lysine methyltransferase 2E vs. Ensembl Zebrafish
Match: setd5 (SET domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-080523-1])

HSP 1 Score: 112.849 bits (281), Expect = 2.265e-24
Identity = 55/158 (34.81%), Postives = 93/158 (58.86%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  + S       +V +   ++ ++++ + L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I  G I   I  +  IS D+E+TIGFD+ +  C+Y V+CAC  G+ +C ++
Sbjct:  318 LACNNTVLGSQMQLQLGRVTRVQKHRKILRAARSLDPETLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNEVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIAEGMIHLCIYAVAQISKDSEVTIGFDYEFSCCNYKVDCACHKGNQDCPVQ 474          
BLAST of Lysine methyltransferase 2E vs. Ensembl Zebrafish
Match: setd5 (SET domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-080523-1])

HSP 1 Score: 112.464 bits (280), Expect = 3.109e-24
Identity = 55/158 (34.81%), Postives = 93/158 (58.86%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  + S       +V +   ++ ++++ + L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I  G I   I  +  IS D+E+TIGFD+ +  C+Y V+CAC  G+ +C ++
Sbjct:  312 LACNNTVLGSQMQLQLGRVTRVQKHRKILRAARSLDPETLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNEVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIAEGMIHLCIYAVAQISKDSEVTIGFDYEFSCCNYKVDCACHKGNQDCPVQ 468          
BLAST of Lysine methyltransferase 2E vs. Ensembl Zebrafish
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 77.411 bits (189), Expect = 3.321e-14
Identity = 31/62 (50.00%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQTN 1121
            I RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PR++D   A+  QT 
Sbjct:  127 ITRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPETYLCERCQPRTLDREHAILLQTR 188          
BLAST of Lysine methyltransferase 2E vs. Ensembl Zebrafish
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 77.0258 bits (188), Expect = 6.087e-14
Identity = 31/62 (50.00%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQTN 1121
            I RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PR++D   A+  QT 
Sbjct:  127 ITRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPETYLCERCQPRTLDREHAILLQTR 188          
BLAST of Lysine methyltransferase 2E vs. Ensembl Xenopus
Match: SETD5 (SET domain containing 5 [Source:NCBI gene;Acc:100145036])

HSP 1 Score: 118.627 bits (296), Expect = 9.640e-26
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  V S       +V +   ++ ++++ K+L  + +++E+ G + L + +     + K   PFVLFY KF+ L + +DA +   D+++IRRSCTPNAEV+H +I  G +   I  +  I+ D E+TI FDF+Y  C+Y V+CAC  G+ NC ++
Sbjct:  263 LACNNTVVGSQMQLQLGRVTRVQKHRKILRAAKDLAPNTLVIEYRGKVMLRQQFEVNGHFFKRPYPFVLFYSKFNGLEMCVDARTFGNDARFIRRSCTPNAEVRH-MISEGMVHLCIYTVAAIAKDAEVTIAFDFDYSNCNYKVDCACHKGNRNCPVQ 419          
BLAST of Lysine methyltransferase 2E vs. Ensembl Xenopus
Match: SETD5 (SET domain containing 5 [Source:NCBI gene;Acc:100145036])

HSP 1 Score: 118.242 bits (295), Expect = 9.911e-26
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  V S       +V +   ++ ++++ K+L  + +++E+ G + L + +     + K   PFVLFY KF+ L + +DA +   D+++IRRSCTPNAEV+H +I  G +   I  +  I+ D E+TI FDF+Y  C+Y V+CAC  G+ NC ++
Sbjct:  295 LACNNTVVGSQMQLQLGRVTRVQKHRKILRAAKDLAPNTLVIEYRGKVMLRQQFEVNGHFFKRPYPFVLFYSKFNGLEMCVDARTFGNDARFIRRSCTPNAEVRH-MISEGMVHLCIYTVAAIAKDAEVTIAFDFDYSNCNYKVDCACHKGNRNCPVQ 451          
BLAST of Lysine methyltransferase 2E vs. Ensembl Xenopus
Match: SETD5 (SET domain containing 5 [Source:NCBI gene;Acc:100145036])

HSP 1 Score: 118.242 bits (295), Expect = 1.011e-25
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  V S       +V +   ++ ++++ K+L  + +++E+ G + L + +     + K   PFVLFY KF+ L + +DA +   D+++IRRSCTPNAEV+H +I  G +   I  +  I+ D E+TI FDF+Y  C+Y V+CAC  G+ NC ++
Sbjct:  282 LACNNTVVGSQMQLQLGRVTRVQKHRKILRAAKDLAPNTLVIEYRGKVMLRQQFEVNGHFFKRPYPFVLFYSKFNGLEMCVDARTFGNDARFIRRSCTPNAEVRH-MISEGMVHLCIYTVAAIAKDAEVTIAFDFDYSNCNYKVDCACHKGNRNCPVQ 438          
BLAST of Lysine methyltransferase 2E vs. Ensembl Xenopus
Match: SETD5 (SET domain containing 5 [Source:NCBI gene;Acc:100145036])

HSP 1 Score: 118.242 bits (295), Expect = 1.052e-25
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  V S       +V +   ++ ++++ K+L  + +++E+ G + L + +     + K   PFVLFY KF+ L + +DA +   D+++IRRSCTPNAEV+H +I  G +   I  +  I+ D E+TI FDF+Y  C+Y V+CAC  G+ NC ++
Sbjct:  263 LACNNTVVGSQMQLQLGRVTRVQKHRKILRAAKDLAPNTLVIEYRGKVMLRQQFEVNGHFFKRPYPFVLFYSKFNGLEMCVDARTFGNDARFIRRSCTPNAEVRH-MISEGMVHLCIYTVAAIAKDAEVTIAFDFDYSNCNYKVDCACHKGNRNCPVQ 419          
BLAST of Lysine methyltransferase 2E vs. Ensembl Xenopus
Match: SETD5 (SET domain containing 5 [Source:NCBI gene;Acc:100145036])

HSP 1 Score: 118.242 bits (295), Expect = 1.102e-25
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  V S       +V +   ++ ++++ K+L  + +++E+ G + L + +     + K   PFVLFY KF+ L + +DA +   D+++IRRSCTPNAEV+H +I  G +   I  +  I+ D E+TI FDF+Y  C+Y V+CAC  G+ NC ++
Sbjct:  286 LACNNTVVGSQMQLQLGRVTRVQKHRKILRAAKDLAPNTLVIEYRGKVMLRQQFEVNGHFFKRPYPFVLFYSKFNGLEMCVDARTFGNDARFIRRSCTPNAEVRH-MISEGMVHLCIYTVAAIAKDAEVTIAFDFDYSNCNYKVDCACHKGNRNCPVQ 442          
BLAST of Lysine methyltransferase 2E vs. Ensembl Mouse
Match: Setd5 (SET domain containing 5 [Source:MGI Symbol;Acc:MGI:1920145])

HSP 1 Score: 117.857 bits (294), Expect = 1.228e-25
Identity = 63/193 (32.64%), Postives = 105/193 (54.40%), Query Frame = 3
Query: 1581 IDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            + K A   TIN+       L CN      N  I  +  L+L           +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  ++ I+ D E+TI FD+ Y  C+Y V+CAC  G+ NC ++
Sbjct:  244 VGKPAILDTINKTE-----LACN------NTVIGSQMQLQLG----------RVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQ 414          
BLAST of Lysine methyltransferase 2E vs. Ensembl Mouse
Match: Setd5 (SET domain containing 5 [Source:MGI Symbol;Acc:MGI:1920145])

HSP 1 Score: 117.472 bits (293), Expect = 1.324e-25
Identity = 63/193 (32.64%), Postives = 105/193 (54.40%), Query Frame = 3
Query: 1581 IDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            + K A   TIN+       L CN      N  I  +  L+L           +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  ++ I+ D E+TI FD+ Y  C+Y V+CAC  G+ NC ++
Sbjct:  263 VGKPAILDTINKTE-----LACN------NTVIGSQMQLQLG----------RVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQ 433          
BLAST of Lysine methyltransferase 2E vs. Ensembl Mouse
Match: Setd5 (SET domain containing 5 [Source:MGI Symbol;Acc:MGI:1920145])

HSP 1 Score: 117.472 bits (293), Expect = 1.324e-25
Identity = 63/193 (32.64%), Postives = 105/193 (54.40%), Query Frame = 3
Query: 1581 IDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            + K A   TIN+       L CN      N  I  +  L+L           +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  ++ I+ D E+TI FD+ Y  C+Y V+CAC  G+ NC ++
Sbjct:  263 VGKPAILDTINKTE-----LACN------NTVIGSQMQLQLG----------RVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQ 433          
BLAST of Lysine methyltransferase 2E vs. Ensembl Mouse
Match: Kmt2e (lysine (K)-specific methyltransferase 2E [Source:MGI Symbol;Acc:MGI:1924825])

HSP 1 Score: 115.546 bits (288), Expect = 7.176e-25
Identity = 55/124 (44.35%), Postives = 76/124 (61.29%), Query Frame = 3
Query: 1758 NQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC 2129
            N+ ++KS K+L    +I+E+ G   L E +     + K   PFVLFY KF  L + +DA +   ++++IRRSCTPNAEV+H  I  G+I  +I  I  I   TEITI FDF+Y  C Y V+CAC
Sbjct:  339 NKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE-IEEGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCAC 461          

HSP 2 Score: 79.337 bits (194), Expect = 5.835e-14
Identity = 32/60 (53.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQ 1115
            + RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PRS+D  RAV  Q
Sbjct:  118 VTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRSLDKERAVLLQ 177          
BLAST of Lysine methyltransferase 2E vs. Ensembl Mouse
Match: Kmt2e (lysine (K)-specific methyltransferase 2E [Source:MGI Symbol;Acc:MGI:1924825])

HSP 1 Score: 115.546 bits (288), Expect = 7.176e-25
Identity = 55/124 (44.35%), Postives = 76/124 (61.29%), Query Frame = 3
Query: 1758 NQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC 2129
            N+ ++KS K+L    +I+E+ G   L E +     + K   PFVLFY KF  L + +DA +   ++++IRRSCTPNAEV+H  I  G+I  +I  I  I   TEITI FDF+Y  C Y V+CAC
Sbjct:  339 NKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE-IEEGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCAC 461          

HSP 2 Score: 79.337 bits (194), Expect = 5.835e-14
Identity = 32/60 (53.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQ 1115
            + RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PRS+D  RAV  Q
Sbjct:  118 VTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRSLDKERAVLLQ 177          
BLAST of Lysine methyltransferase 2E vs. UniProt/SwissProt
Match: sp|Q5XJV7|SETD5_MOUSE (Histone-lysine N-methyltransferase SETD5 OS=Mus musculus OX=10090 GN=Setd5 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 8.590e-25
Identity = 63/193 (32.64%), Postives = 105/193 (54.40%), Query Frame = 3
Query: 1581 IDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            + K A   TIN+       L CN      N  I  +  L+L           +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  ++ I+ D E+TI FD+ Y  C+Y V+CAC  G+ NC ++
Sbjct:  244 VGKPAILDTINKTE-----LACN------NTVIGSQMQLQLG----------RVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQ 414          
BLAST of Lysine methyltransferase 2E vs. UniProt/SwissProt
Match: sp|Q9C0A6|SETD5_HUMAN (Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 2.250e-24
Identity = 55/158 (34.81%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  + S       +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  ++ I+ D E+TI FD+ Y  C+Y V+CAC  G+ NC ++
Sbjct:  258 LACNNTVIGSQMQLQLGRVTRVQKHRKILRAARDLALDTLIIEYRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEVRH-MIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQ 414          
BLAST of Lysine methyltransferase 2E vs. UniProt/SwissProt
Match: sp|Q8IZD2|KMT2E_HUMAN (Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.708e-24
Identity = 55/124 (44.35%), Postives = 78/124 (62.90%), Query Frame = 3
Query: 1758 NQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC 2129
            N+ ++KS K+L    +I+E+ G   L E +     + K   PFVLFY KF  L + +DA +   ++++IRRSCTPNAEV+H  I +G+I  +I  I+ I   TEITI FDF+Y  C Y V+CAC
Sbjct:  339 NKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE-IQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCAC 461          

HSP 2 Score: 77.7962 bits (190), Expect = 1.335e-12
Identity = 31/60 (51.67%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQ 1115
            + RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PR++D  RAV  Q
Sbjct:  118 VTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQ 177          
BLAST of Lysine methyltransferase 2E vs. UniProt/SwissProt
Match: sp|Q3UG20|KMT2E_MOUSE (Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 5.019e-24
Identity = 55/124 (44.35%), Postives = 76/124 (61.29%), Query Frame = 3
Query: 1758 NQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC 2129
            N+ ++KS K+L    +I+E+ G   L E +     + K   PFVLFY KF  L + +DA +   ++++IRRSCTPNAEV+H  I  G+I  +I  I  I   TEITI FDF+Y  C Y V+CAC
Sbjct:  339 NKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE-IEEGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCAC 461          

HSP 2 Score: 79.337 bits (194), Expect = 4.082e-13
Identity = 32/60 (53.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQ 1115
            + RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PRS+D  RAV  Q
Sbjct:  118 VTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRSLDKERAVLLQ 177          
BLAST of Lysine methyltransferase 2E vs. UniProt/SwissProt
Match: sp|Q10362|SET3_SCHPO (SET domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set3 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.483e-10
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 3
Query:  945 RCVCGYTHDDGGLIRCEICQTWQHIICMYPD-NKFPILYKCEKCEPRSIDYSRA 1103
            RCVC +  DDG  I+CE C+ WQH +C+  D N  P  Y CE+C+PR ID  +A
Sbjct:    5 RCVCPFEDDDGFTIQCESCEVWQHAVCVNIDANNVPEKYFCEQCQPRPIDADKA 58          
BLAST of Lysine methyltransferase 2E vs. TrEMBL
Match: A0A3P8X8E9 (Lysine (K)-specific methyltransferase 2E OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.133e-40
Identity = 129/413 (31.23%), Postives = 182/413 (44.07%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSV---------HSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCE 2147
            I RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PRS+D  RAV  QT     M                 ++ +T  T S    P       EL T F+H   S             +  +   +  KDP   PP S R  K  ++        ++ +S V  GA  +         +S S  +N I      Y          S+N    D            GK  A       THT               T       +V K   N+ ++K++K+L    +I+E+ G   L + +     + K   PFVLFY KFD L + +DA S   ++++IRRSCTPN+EV+H VI +G +  +I  +  I+  TEITIGFD++Y  C Y V+CAC   N E
Sbjct:   53 ITRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPETYLCERCQPRSLDRDRAVVLQTRKRQNM-----------------SDGDTSATESGDEVPL------ELYTAFQHTPTSITLTTSRLGANKQADKKRKRSGDKDP---PPASARAKKAFREG-------SRKSSRVKGGAPDIE------PGESPSLWENKIKAWMEAYE-------EASSNQYSEDVQILLRVKEAGDGKTLAY-----NTHTA--------------TFKPPVESQVQK---NKKIVKTVKDLAPDSLIIEYRGRFMLRQQFEANGCFFKRPYPFVLFYSKFDGLEMCVDARSFGNEARFIRRSCTPNSEVRH-VIEDGMLHLYIYSLRPIAKGTEITIGFDYDYGCCKYKVDCACVKGNTE 396          
BLAST of Lysine methyltransferase 2E vs. TrEMBL
Match: A0A3P8X8B2 (Lysine (K)-specific methyltransferase 2E OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.309e-40
Identity = 129/413 (31.23%), Postives = 182/413 (44.07%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSV---------HSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCE 2147
            I RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PRS+D  RAV  QT     M                 ++ +T  T S    P       EL T F+H   S             +  +   +  KDP   PP S R  K  ++        ++ +S V  GA  +         +S S  +N I      Y          S+N    D            GK  A       THT               T       +V K   N+ ++K++K+L    +I+E+ G   L + +     + K   PFVLFY KFD L + +DA S   ++++IRRSCTPN+EV+H VI +G +  +I  +  I+  TEITIGFD++Y  C Y V+CAC   N E
Sbjct:   55 ITRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPETYLCERCQPRSLDRDRAVVLQTRKRQNM-----------------SDGDTSATESGDEVPL------ELYTAFQHTPTSITLTTSRLGANKQADKKRKRSGDKDP---PPASARAKKAFREG-------SRKSSRVKGGAPDIE------PGESPSLWENKIKAWMEAYE-------EASSNQYSEDVQILLRVKEAGDGKTLAY-----NTHTA--------------TFKPPVESQVQK---NKKIVKTVKDLAPDSLIIEYRGRFMLRQQFEANGCFFKRPYPFVLFYSKFDGLEMCVDARSFGNEARFIRRSCTPNSEVRH-VIEDGMLHLYIYSLRPIAKGTEITIGFDYDYGCCKYKVDCACVKGNTE 398          
BLAST of Lysine methyltransferase 2E vs. TrEMBL
Match: A0A5N4E001 (Inactive histone-lysine N-methyltransferase 2E OS=Camelus dromedarius OX=9838 GN=Cadr_000007829 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.738e-33
Identity = 118/425 (27.76%), Postives = 194/425 (45.65%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTN----LSIHQEQ---FLKLNNYTVNSNCSCKVIKYNN-------------NQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNC 2144
            + RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+P      R++  +   L++ +                 EN ++   S   +   V V  EL T F+H   S        I  T S+   +      ++ +++Q++   K +  +   +   G   +     H ++K+ +  + S   +++              ++ +ID S+  +       K+KA + +R +   N      + +E     L+L N       +   +  NN             N+ ++KS K+L    +I+E+ G   L E +     + K   PFVLFY KF  L + +DA +   ++++IRRSCTPNAEV+H  I +G+I  +I  I  I   TEITI FDF+Y  C Y V+CAC   +P C
Sbjct:  118 VTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQP------RSLDKERAVLLQRR---------------KRENMSDGDTSATESGDEVPV--ELYTAFQHTPTS--------ITLTASRVSKVNDKRRKKSGEKEQNISKYKKIEMEYRKMFANGFEIITKETSHRNAKAKAFREGSRKSSRVK------------GSAPEIDPSSDGSNFG-WETKIKA-WMDRYEEANNNQYSEGVQREAQRIALRLGNGNDKKEINKSDLNTNNLLFKPPVESHIHKNKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE-IEDGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPEC 496          
BLAST of Lysine methyltransferase 2E vs. TrEMBL
Match: A0A5N4E0F3 (Inactive histone-lysine N-methyltransferase 2E OS=Camelus dromedarius OX=9838 GN=Cadr_000007829 PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.947e-33
Identity = 118/425 (27.76%), Postives = 194/425 (45.65%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTN----LSIHQEQ---FLKLNNYTVNSNCSCKVIKYNN-------------NQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNC 2144
            + RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+P      R++  +   L++ +                 EN ++   S   +   V V  EL T F+H   S        I  T S+   +      ++ +++Q++   K +  +   +   G   +     H ++K+ +  + S   +++              ++ +ID S+  +       K+KA + +R +   N      + +E     L+L N       +   +  NN             N+ ++KS K+L    +I+E+ G   L E +     + K   PFVLFY KF  L + +DA +   ++++IRRSCTPNAEV+H  I +G+I  +I  I  I   TEITI FDF+Y  C Y V+CAC   +P C
Sbjct:  118 VTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQP------RSLDKERAVLLQRR---------------KRENMSDGDTSATESGDEVPV--ELYTAFQHTPTS--------ITLTASRVSKVNDKRRKKSGEKEQNISKYKKIEMEYRKMFANGFEIITKETSHRNAKAKAFREGSRKSSRVK------------GSAPEIDPSSDGSNFG-WETKIKA-WMDRYEEANNNQYSEGVQREAQRIALRLGNGNDKKEINKSDLNTNNLLFKPPVESHIHKNKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE-IEDGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPEC 496          
BLAST of Lysine methyltransferase 2E vs. TrEMBL
Match: M4KB43 (NKp44L (Fragment) OS=Mus musculus OX=10090 GN=Kmt2e PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 3.910e-33
Identity = 116/407 (28.50%), Postives = 182/407 (44.72%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDK--SAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNC 2144
            + RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+P      R++  +   L++ +                 EN ++   S   +   V V  EL T F+H   S        I  T S+ P +      ++ +++Q+    K                         S+ +S ++ S  E   + +  SN++  T   +  +D+   A     +E   +       R+ +  +     +  L  NN          + K   N+ ++KS K+L    +I+E+ G   L E +     + K   PFVLFY KF  L + +DA +   ++++IRRSCTPNAEV+H  I  G+I  +I  I  I   TEITI FDF+Y  C Y V+CAC   +P C
Sbjct:  118 VTRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQP------RSLDKERAVLLQRR---------------KRENMSDGDTSATESGDEVPV--ELYTAFQHTPTS--------ITLTASRVPKVTDKRRKKSGEKEQNFSKCKKAF-------------------REGSRKSSRVKGSAPEIDPSSDS-SNFVWETKIKAW-MDRYEEANNNQYSEGVQREAQRLAQRLGSGNDSKDMNKSELSTNNSLFRPPVESHIQK---NKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE-IEEGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPEC 468          
BLAST of Lysine methyltransferase 2E vs. Ensembl Cavefish
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 120.553 bits (301), Expect = 9.240e-28
Identity = 55/130 (42.31%), Postives = 84/130 (64.62%), Query Frame = 3
Query: 1758 NQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCE 2147
            N+ ++K++++L    +I+E+ G + L + +     + K   PFVLFY KFD L + +DA S   ++++IRRSCTPNAEV+H VI +G +  +I  +  IS  +EITIGFD++Y  C Y V+CAC   N E
Sbjct:  255 NKRILKAVRDLAADSLIIEYRGKVMLRQQFEANGYFFKRPYPFVLFYSKFDGLEMCVDARSFGNEARFIRRSCTPNAEVRH-VIEDGMLHLYIYSLRSISKGSEITIGFDYDYGSCKYKVDCACVRGNQE 383          

HSP 2 Score: 79.7221 bits (195), Expect = 1.293e-14
Identity = 33/61 (54.10%), Postives = 42/61 (68.85%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQT 1118
            I RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PRS+D  RA+  QT
Sbjct:   43 ITRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPETYLCERCQPRSLDRERAILLQT 103          
BLAST of Lysine methyltransferase 2E vs. Ensembl Cavefish
Match: setd5 (SET domain containing 5 [Source:NCBI gene;Acc:103025313])

HSP 1 Score: 116.701 bits (291), Expect = 1.853e-25
Identity = 56/158 (35.44%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  ++S       +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+   + +DA +   D+++IRRSCTPNAEV+H +I  G I   I  +  IS D+E+TIGFD+ +  C+Y V+CAC  G+ NC ++
Sbjct:  315 LACNNTVLSSQMQLQLGRVTRVQKHRKILRAARDLEFDTLIIEYRGKVMLKQQFEVNGHFFKKPYPFVLFYSKFNETEMCVDARTFGNDARFIRRSCTPNAEVRH-MIAEGMIHLCIYAVTRISKDSEVTIGFDYEFNSCNYKVDCACHKGNQNCPVQ 471          
BLAST of Lysine methyltransferase 2E vs. Ensembl Cavefish
Match: setd5 (SET domain containing 5 [Source:NCBI gene;Acc:103025313])

HSP 1 Score: 116.701 bits (291), Expect = 1.920e-25
Identity = 56/158 (35.44%), Postives = 94/158 (59.49%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELK 2153
            L  NN  ++S       +V +   ++ ++++ ++L    +I+E+ G + L + +     + K   PFVLFY KF+   + +DA +   D+++IRRSCTPNAEV+H +I  G I   I  +  IS D+E+TIGFD+ +  C+Y V+CAC  G+ NC ++
Sbjct:  315 LACNNTVLSSQMQLQLGRVTRVQKHRKILRAARDLEFDTLIIEYRGKVMLKQQFEVNGHFFKKPYPFVLFYSKFNETEMCVDARTFGNDARFIRRSCTPNAEVRH-MIAEGMIHLCIYAVTRISKDSEVTIGFDYEFNSCNYKVDCACHKGNQNCPVQ 471          
BLAST of Lysine methyltransferase 2E vs. Ensembl Cavefish
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 81.2629 bits (199), Expect = 2.552e-15
Identity = 33/62 (53.23%), Postives = 42/62 (67.74%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQTN 1121
            I RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PRS+D  RA+  QT 
Sbjct:  126 ITRCICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPETYLCERCQPRSLDRERAILLQTR 187          
BLAST of Lysine methyltransferase 2E vs. Ensembl Cavefish
Match: ash1l (histone-lysine N-methyltransferase ASH1L-like [Source:NCBI gene;Acc:103022779])

HSP 1 Score: 55.0694 bits (131), Expect = 1.330e-6
Identity = 26/68 (38.24%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  921 DKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSIDYSRAVATQTNF 1124
            DK  ++I RC+CG   D+G +I+CE C  WQH  CM  + +    Y CE+C+PR +D    +  Q ++
Sbjct: 2518 DKDDDVI-RCICGMYKDEGLMIQCEKCMVWQHCDCMRLEAEVE-HYLCEQCDPRPVDREVPMVPQPSY 2583          
BLAST of Lysine methyltransferase 2E vs. Ensembl Sea Lamprey
Match: kmt2e (lysine (K)-specific methyltransferase 2E [Source:ZFIN;Acc:ZDB-GENE-030131-4120])

HSP 1 Score: 102.449 bits (254), Expect = 3.214e-22
Identity = 46/121 (38.02%), Postives = 73/121 (60.33%), Query Frame = 3
Query: 1767 VIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC 2129
             +K+ ++L    +++E+ G + L + +     + K   PFVLFY KF  + + +DA +   +++++RRSC+PNAEV+H  I  G    +I  +  IS   EITIGFDF+Y  C Y+V CAC
Sbjct:  339 ALKAARDLPAHTLLIEYRGMVMLQQQFEANGLFFKRPYPFVLFYSKFLGVEMCVDARTFGNEARFVRRSCSPNAEVRH-AIEAGLFHLYIYSLADISKGAEITIGFDFDYSGCHYTVNCAC 458          

HSP 2 Score: 77.7962 bits (190), Expect = 1.339e-14
Identity = 33/61 (54.10%), Postives = 40/61 (65.57%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPD-NKFPILYKCEKCEPRSIDYSRAVATQT 1118
            + RCVCG+THDDG +I C+ C  WQHI CM  D  + P  Y CE CEPRS+D  RA   Q+
Sbjct:  116 VTRCVCGFTHDDGYMICCDKCSVWQHIDCMGIDRQRIPDTYLCEFCEPRSVDQERAFQLQS 176          
BLAST of Lysine methyltransferase 2E vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004065.1 (pep scaffold:Pmarinus_7.0:GL479372:18838:35317:1 gene:ENSPMAG00000003707.1 transcript:ENSPMAT00000004065.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 6.685e-6
Identity = 19/47 (40.43%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICM-YPDNKFPILYKCEKCE 1076
            I RC CG   + G +I+CE+C  WQH +CM + +   P  Y C  C+
Sbjct:  646 IVRCSCGINEETGFMIQCEMCSCWQHSVCMGFTEENIPDRYSCHVCQ 692          
BLAST of Lysine methyltransferase 2E vs. Ensembl Yeast
Match: SET3 (Defining member of the SET3 histone deacetylase complex; which is a meiosis-specific repressor of sporulation genes; necessary for efficient transcription by RNAPII; one of two yeast proteins that contains both SET and PHD domains; SET3 has a paralog, SET4, that arose from the whole genome duplication [Source:SGD;Acc:S000001737])

HSP 1 Score: 52.7582 bits (125), Expect = 6.654e-7
Identity = 24/63 (38.10%), Postives = 31/63 (49.21%), Query Frame = 3
Query:  948 CVCGYTHDDGGLIRCEICQTWQHIIC-------MYPDNKFPILYKCEKCEPRSIDYSRAVATQ 1115
            C+C    DDG  I+C+ C  WQH IC       M PD+     Y C  C+PR +D + A   Q
Sbjct:  120 CICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDD-----YLCNSCDPREVDINLARKIQ 177          
BLAST of Lysine methyltransferase 2E vs. Ensembl Nematostella
Match: EDO45423 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT90])

HSP 1 Score: 81.6481 bits (200), Expect = 6.059e-18
Identity = 41/127 (32.28%), Postives = 74/127 (58.27%), Query Frame = 3
Query: 1770 IKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCEL 2150
            + + ++L+ ++ +++  G + L  ++ KE  + K Y+P VLFY+K DHL L +DA +   D++++RRSC+PNAEV+H    NG +   +  +  +    EITI F+ +  +    + CAC    C +
Sbjct:    1 LVTTEDLNKNQFLIKCKGRMMLGSNFEKENQFFKRYSPHVLFYDKLDHLCLCVDARTFGNDARFVRRSCSPNAEVRH-FFSNGKLCLALFSLCPLPKGAEITIPFEHSLHEYKSHLTCACSQDTCAV 126          
BLAST of Lysine methyltransferase 2E vs. Ensembl Nematostella
Match: EDO47610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLI6])

HSP 1 Score: 52.373 bits (124), Expect = 1.819e-6
Identity = 21/54 (38.89%), Postives = 31/54 (57.41%), Query Frame = 3
Query:  918 TDKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIIC--MYPDNKFPILYKCEKC 1073
            TD T++    C CGY  DDG +I C IC+ W+H +C  +  + + P  + C KC
Sbjct:  278 TDDTVS----CACGYNEDDGLMIMCGICKFWEHAVCYGILQEEQAPDFHVCAKC 327          
BLAST of Lysine methyltransferase 2E vs. Ensembl Medaka
Match: kmt2e (lysine methyltransferase 2E [Source:NCBI gene;Acc:101162568])

HSP 1 Score: 117.087 bits (292), Expect = 1.056e-26
Identity = 55/132 (41.67%), Postives = 83/132 (62.88%), Query Frame = 3
Query: 1752 NNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCE 2147
              N+ ++K++++L    +I+E+ G   L + +     + K   PFVLFY KFD L + +DA S   ++++IRRSC+PNAEV+H VI +G +  +I  +  I+  TEITIGFDF+Y  C Y V+CAC   N E
Sbjct:  264 QKNKKILKAVRDLAPDSLIIEYRGKFMLRQQFEANGYFFKRPYPFVLFYSKFDGLEMCVDARSFGNEARFIRRSCSPNAEVRH-VIEDGMLHLYIYSLRHITKGTEITIGFDFDYGNCKYKVDCACVKGNQE 394          

HSP 2 Score: 77.7962 bits (190), Expect = 4.963e-14
Identity = 32/61 (52.46%), Postives = 41/61 (67.21%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQT 1118
            I RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PR +D  RA+  QT
Sbjct:   52 ITRCICGFTHDDGYMICCDKCSAWQHIDCMGIDRQNIPETYLCERCQPRHLDRERAILLQT 112          
BLAST of Lysine methyltransferase 2E vs. Ensembl Medaka
Match: setd5 (SET domain containing 5 [Source:NCBI gene;Acc:101159908])

HSP 1 Score: 117.857 bits (294), Expect = 9.545e-26
Identity = 61/174 (35.06%), Postives = 101/174 (58.05%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELKYWMIEEARRKKMVTSP 2201
            L  NN  + S       +V +   ++ ++++ K L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  I+ IS D+E+TIGFD+ +  C Y V+CAC  G+ NC ++   +  + R  ++ SP
Sbjct:  318 LACNNTVLGSQMQLQLGRVTRVQRHRKILRAAKNLDPDTLIIEYRGKVMLKQQFEVNGHFFKKPYPFVLFYSKFNEVEMCVDARTFGNDARFIRRSCTPNAEVRH-MISDGMIHLCIYAISHISKDSEVTIGFDYEFNSCDYKVDCACHKGNQNCPVQKHNL--SPRDGLMVSP 488          
BLAST of Lysine methyltransferase 2E vs. Ensembl Medaka
Match: setd5 (SET domain containing 5 [Source:NCBI gene;Acc:101159908])

HSP 1 Score: 117.857 bits (294), Expect = 9.718e-26
Identity = 61/174 (35.06%), Postives = 101/174 (58.05%), Query Frame = 3
Query: 1695 LKLNNYTVNSNCSC---KVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECAC--GHPNCELKYWMIEEARRKKMVTSP 2201
            L  NN  + S       +V +   ++ ++++ K L    +I+E+ G + L + +     + K   PFVLFY KF+ + + +DA +   D+++IRRSCTPNAEV+H +I +G I   I  I+ IS D+E+TIGFD+ +  C Y V+CAC  G+ NC ++   +  + R  ++ SP
Sbjct:  318 LACNNTVLGSQMQLQLGRVTRVQRHRKILRAAKNLDPDTLIIEYRGKVMLKQQFEVNGHFFKKPYPFVLFYSKFNEVEMCVDARTFGNDARFIRRSCTPNAEVRH-MISDGMIHLCIYAISHISKDSEVTIGFDYEFNSCDYKVDCACHKGNQNCPVQKHNL--SPRDGLMVSP 488          
BLAST of Lysine methyltransferase 2E vs. Ensembl Medaka
Match: kmt2e (lysine methyltransferase 2E [Source:NCBI gene;Acc:101162568])

HSP 1 Score: 78.5666 bits (192), Expect = 6.977e-14
Identity = 32/61 (52.46%), Postives = 41/61 (67.21%), Query Frame = 3
Query:  939 IPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNK-FPILYKCEKCEPRSIDYSRAVATQT 1118
            I RC+CG+THDDG +I C+ C  WQHI CM  D +  P  Y CE+C+PR +D  RA+  QT
Sbjct:  116 ITRCICGFTHDDGYMICCDKCSAWQHIDCMGIDRQNIPETYLCERCQPRHLDRERAILLQT 176          

HSP 2 Score: 67.3958 bits (163), Expect = 2.085e-10
Identity = 30/81 (37.04%), Postives = 51/81 (62.96%), Query Frame = 3
Query: 1746 KYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNA 1988
            +   N+ ++K++++L    +I+E+ G   L + +     + K Y PFVLFY KFD L + +DA S   ++++IRRSC+PNA
Sbjct:  326 QVQKNKKILKAVRDLAPDSLIIEYRGKFMLRQQFEANGYFFKPY-PFVLFYSKFDGLEMCVDARSFGNEARFIRRSCSPNA 405          
BLAST of Lysine methyltransferase 2E vs. Ensembl Medaka
Match: ash1l (histone-lysine N-methyltransferase ASH1L [Source:NCBI gene;Acc:101161417])

HSP 1 Score: 53.1434 bits (126), Expect = 4.770e-6
Identity = 25/68 (36.76%), Postives = 40/68 (58.82%), Query Frame = 3
Query:  921 DKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSIDYSRAVATQTNF 1124
            DK  ++I RC+CG   D+G +I+CE C  WQH  CM  + +    Y CE+C+PR ++    +  Q ++
Sbjct: 2475 DKDDDVI-RCICGMYKDEGLMIQCEKCMVWQHFDCMRLETEVE-HYLCEQCDPRPVEREVPMLPQPSY 2540          
BLAST of Lysine methyltransferase 2E vs. Planmine SMEST
Match: SMESG000051295.1 (SMESG000051295.1)

HSP 1 Score: 3588.89 bits (9305), Expect = 0.000e+0
Identity = 2041/2054 (99.37%), Postives = 2041/2054 (99.37%), Query Frame = 3
Query:   90 MANMKTDGLNDFDRNDLFKSIGNSFYDDVPNLGSVITLDNKGRLINSQFSKPSSSQTLLKLNSSEEVPDADDLPYSVISYGDTVNAINLPYNDHNYVGTLSNKSLENYDKKALEFTSKQTGQYTNRSTFPPPTNLRISHFSSFNTNHLSQSDFINNRPENIFFNEKPKTNNQFSYNQTINSLTPLITNKSLNNQSQPNGFVAKKQILPNAXXXXXXXXXXXXXXXXXXLQRPPNLETNSLMNEPRXXXXXXXXXXLTNVVTNEVMSNEINSSCDKTTDKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCELKYWMIEEARRKKMVTSPLDEYDAFMYNSEHLKPIMSKPHKKRGRAAKILNTSNRQIMDRPVVMDANPPSAVVRRNKRGRPPLNRQNGIQRSDVKAXXXXXXNNCLTEFKEISDNESVPCRTNENIHPSLALRSNFKNFKRISSSHWSLKAHRKLCANKTKPTKSYKTIVPQKVGRPXXXXXXXXXXXXRDVDLSSEPPSSPDRYNETEKSFDNNANISSNEEYE-TNMLQYSHEMKHEMTREEEGKYWLEEINNKIYKQKLKEAXXXXXXXXXXXXLSRKITNFNSHKNYVENFEREQVKEIXXXXXXXXXXXXXXXXXXXXTHSQSVTEVVKEKNNLSVATPVKAKRGRKSFKNNKSYIVSYKTSNIDDLKNDLMLISASLKXXXXXXXXXXXXXVCHTSEKLKVETLIEPTTTIEAEGSEKNFSDSFETKKSSTEVESFIDSSDEKLLAAFKSKHRKLHSCKTKDGMKDPMKGSREERWVNIMWQRILKNENSDXXXXXXXXXXXFADXXXXXXXXXXXXXDLASPKFGDSDFCDDNLSCENKESDSNVYKLNSIYNIKRKPNXXXXXXXXXXXXLQPPEKPSHSKSNEIDNHVRVXXXXXXXXXXXXKANVSSNEQCGLIVYKEQQSNPMEKFSRENSAKMFXXXXXXXXXXXXXXXXVQHPPHAKKRWXXXXXXXXXXXXXXXTSKETNNTLNDAFIEKFISIDNSSKHSFLPPVITSVDNTAFSLTPPKIAMNPKKRLLNQFSMEDNAFXXXXXXXXXXXXXXXXXXXXXX--XXXXXQEQSKTKLTLSEYRKRRYCDKTVKSESNLSLKISKKACNNKDSEWVGISDRYGSPPVKEPVEESGQIDNYNSAAYLDATKKLKVDSPIIATVTEPAESNANKXXXXXXXXXXXXXKMPGNLDPRLTKSTAFLNKIYINRNQSEIEPSSMDNTNSIPVVTYSHVESCPRSPSKSPNSPGSEWRMSNFNDRGPRTPSDIDELSINPNNDNDCLSIYAPSQRSIDSFESQPSPTSDCHFDFDRSENNFECKSKSINCDSSGANDWTSHAASIARMAGIPNPDLLQEIEEFDDEYVPLPDNLPERSKEEMETLLLTQKRDSQIREWQEVKQLEREKVKLEHQVRSMQRRNQRITKPNDVAVXXXXXXXXXXXXADHQSNGDPKFSFSLMTTMTDERTMKTFNVQLSNFNDKLMEQINLVKNNNRPLKPPSQNADLPLSYRLSDDIIIPNDTKKSIPIPDDLNNLTXXXXXXXXXXXITTSNPSSNPKLRKRNNEKTINPQQKMITTKPDDTASEIDQSHFSIVHSNNSS-----XXXXXXXXTYPICSQPAPPHAQFLGXXXXXXXXXXXXXXXDHVPTFKSMTSAFM 6227
            MANMKTDGLNDFDRNDLFKSIGNSFYDDVPNLGSVITLDNKGRLINSQFSKPSSSQTLLKLNSSEEVPDADDLPYSVISYGDTVNAINLPYNDHNYVGTLSNKSLENYDKKALEFTSKQTGQYTNRSTFPPPTNLRISHFSSFNTNHLSQSDFINNRPENIFFNEKPKTNNQFSYNQTINSLTPLITNK LNNQSQPNGFVAKKQILPNAIVINSNSVNKVKSVSVIKLQRPPNLETNSLMNEPRIINIPIKKPNLTNVVTNEVMSNEINSSCDKTTDKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCELKYWMIEEARRKKMVTSPLDEYDAFMYNSEHLKPIMSKPHKKRGRAAKILNTSNRQIMDRPVVMDANPPSAVVRRNKRGRPPLNRQNGIQRSDVKASSDSSSNNCLTEFKEISDNESVPCRTNENIHPSLALRSNFKNFKRISSSHWSLKAHRKLCANKTKPTKSYKTIVPQKVGRPVKHKKEKVVEFKRDVDLSSEPPSSPDRYNETEKSFDNNANISSNEEYE TNMLQYSHEMKHEMTREEEGKYWLEEINNKIYKQKLKEAKKIKRKSRTDKKLSRKITNFNSHKNYVENFEREQVKEIVSKESPEEYKEEIVKEEVIETHSQSVTEVVKEKNNLSVATPVKAKRGRKSFKNNKSYIVSYKTSNIDDLKNDLMLISASLKEEPEEEPNIEPEIVCHTSEKLKVETLIEPTTTIEAEGSEKNFSDSFETKKSSTEVESFIDSSDEKLLAAFKSKHRKLHSCKTKDGMKDPMKGSREERWVNIMWQRILKNENSDSKSKRKRSKSSFADESNQSEENANESNDLASPKFGDSDFCDDNLSCENKESDSNVYKLNSIYNIKRKPNKFKSSSFSDSDKLQPPEKPSHSKSNEIDNHVRVEYSNNSSMEESEKANVSSNEQCGLIVYKEQQSNPMEKFSRENSAKMFNESYSEGGNNNSSNPSVQHPPHAKKRWLSQALLEENLNEASETSKETNNTLNDAFIEKFISIDNSSKHSFLPPVITSVDNTAFSLTPPKIAMNPKKRLLNQFSMEDNAFKINSSDISSYNNKSNNNNN     QNGIDQEQSKTKLTLSEYRKRRYCDKTVKSESNLSLKISKKACNNKDSEWVGISDRYGSPPVKEPVEESGQIDNYNSAAYLDATKKLKVDSPI ATVTEPAESNANKNSSLSYLNTLNNLKMPGNLDPRLTKSTAFLNKIYINRNQSEIEPSSMDNTNSIPVVTYSHVESCPRSPSKSPNSPGSEWRMSNFNDRGPRTPSDIDELSINPNNDNDCLSIYAPSQRSIDSFESQPSPTSDCHFDFDRSENNFECKSKSINCDSSGANDWTSHAASIARMAGIPNPDLLQEIEEFDDEYVPLPDNLPERSKEEMETLLLTQKRDSQIREWQEVKQLEREKVKLEHQVRSMQRRNQRITKPNDVAVKSTSMMKSSIKSADHQSNGDPKFSFSLMTTMTDERTMKTFNVQLSNFNDKLMEQINLVKNNNRPLKPPSQNADLPLSYRLSDDIIIPNDTKKSIPIPDDLNNLTASAVAVAAAAAITTSNPSSNPKLRKRNNEKTINPQQKMITTKPDDTASEIDQSHFSIVHSNNSS     GGGGGGGGTYPICSQPAPPHAQFLGSIQKSSEVVSSIIISDHVPTFKSMTSAFM
Sbjct:    1 MANMKTDGLNDFDRNDLFKSIGNSFYDDVPNLGSVITLDNKGRLINSQFSKPSSSQTLLKLNSSEEVPDADDLPYSVISYGDTVNAINLPYNDHNYVGTLSNKSLENYDKKALEFTSKQTGQYTNRSTFPPPTNLRISHFSSFNTNHLSQSDFINNRPENIFFNEKPKTNNQFSYNQTINSLTPLITNKLLNNQSQPNGFVAKKQILPNAIVINSNSVNKVKSVSVIKLQRPPNLETNSLMNEPRIINIPIKKPNLTNVVTNEVMSNEINSSCDKTTDKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCELKYWMIEEARRKKMVTSPLDEYDAFMYNSEHLKPIMSKPHKKRGRAAKILNTSNRQIMDRPVVMDANPPSAVVRRNKRGRPPLNRQNGIQRSDVKASSDSSSNNCLTEFKEISDNESVPCRTNENIHPSLALRSNFKNFKRISSSHWSLKAHRKLCANKTKPTKSYKTIVPQKVGRPVKHKKEKVVEFKRDVDLSSEPPSSPDRYNETEKSFDNNANISSNEEYETTNMLQYSHEMKHEMTREEEGKYWLEEINNKIYKQKLKEAKKIKRKSRTDKKLSRKITNFNSHKNYVENFEREQVKEIVSKESPEEYKEEIVKEEVIETHSQSVTEVVKEKNNLSVATPVKAKRGRKSFKNNKSYIVSYKTSNIDDLKNDLMLISASLKEEPEEEPNIEPEIVCHTSEKLKVETLIEPTTTIEAEGSEKNFSDSFETKKSSTEVESFIDSSDEKLLAAFKSKHRKLHSCKTKDGMKDPMKGSREERWVNIMWQRILKNENSDSKSKRKRSKSSFADESNQSEENANESNDLASPKFGDSDFCDDNLSCENKESDSNVYKLNSIYNIKRKPNKFKSSSFSDSDKLQPPEKPSHSKSNEIDNHVRVEYSNNSSMEESEKANVSSNEQCGLIVYKEQQSNPMEKFSRENSAKMFNESYSEGGNNNSSNPSVQHPPHAKKRWLSQALLEENLNEASETSKETNNTLNDAFIEKFISIDNSSKHSFLPPVITSVDNTAFSLTPPKIAMNPKKRLLNQFSMEDNAFKINSSDISSYNNKSNNNNNNNKWDQNGIDQEQSKTKLTLSEYRKRRYCDKTVKSESNLSLKISKKACNNKDSEWVGISDRYGSPPVKEPVEESGQIDNYNSAAYLDATKKLKVDSPINATVTEPAESNANKNSSLSYLNTLNNLKMPGNLDPRLTKSTAFLNKIYINRNQSEIEPSSMDNTNSIPVVTYSHVESCPRSPSKSPNSPGSEWRMSNFNDRGPRTPSDIDELSINPNNDNDCLSIYAPSQRSIDSFESQPSPTSDCHFDFDRSENNFECKSKSINCDSSGANDWTSHAASIARMAGIPNPDLLQEIEEFDDEYVPLPDNLPERSKEEMETLLLTQKRDSQIREWQEVKQLEREKVKLEHQVRSMQRRNQRITKPNDVAVKSTSMMKSSIKSADHQSNGDPKFSFSLMTTMTDERTMKTFNVQLSNFNDKLMEQINLVKNNNRPLKPPSQNADLPLSYRLSDDIIIPNDTKKSIPIPDDLNNLTASAVAVAAAAAITTSNPSSNPKLRKRNNEKTINPQQKMITTKPDDTASEIDQSHFSIVHSNNSSGGGGGGGGGGGGGTYPICSQPAPPHAQFLGSIQKSSEVVSSIIISDHVPTFKSMTSAFM 2054          
BLAST of Lysine methyltransferase 2E vs. Planmine SMEST
Match: SMESG000051295.1 (SMESG000051295.1)

HSP 1 Score: 3583.88 bits (9292), Expect = 0.000e+0
Identity = 2038/2051 (99.37%), Postives = 2038/2051 (99.37%), Query Frame = 3
Query:   99 MKTDGLNDFDRNDLFKSIGNSFYDDVPNLGSVITLDNKGRLINSQFSKPSSSQTLLKLNSSEEVPDADDLPYSVISYGDTVNAINLPYNDHNYVGTLSNKSLENYDKKALEFTSKQTGQYTNRSTFPPPTNLRISHFSSFNTNHLSQSDFINNRPENIFFNEKPKTNNQFSYNQTINSLTPLITNKSLNNQSQPNGFVAKKQILPNAXXXXXXXXXXXXXXXXXXLQRPPNLETNSLMNEPRXXXXXXXXXXLTNVVTNEVMSNEINSSCDKTTDKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCELKYWMIEEARRKKMVTSPLDEYDAFMYNSEHLKPIMSKPHKKRGRAAKILNTSNRQIMDRPVVMDANPPSAVVRRNKRGRPPLNRQNGIQRSDVKAXXXXXXNNCLTEFKEISDNESVPCRTNENIHPSLALRSNFKNFKRISSSHWSLKAHRKLCANKTKPTKSYKTIVPQKVGRPXXXXXXXXXXXXRDVDLSSEPPSSPDRYNETEKSFDNNANISSNEEYE-TNMLQYSHEMKHEMTREEEGKYWLEEINNKIYKQKLKEAXXXXXXXXXXXXLSRKITNFNSHKNYVENFEREQVKEIXXXXXXXXXXXXXXXXXXXXTHSQSVTEVVKEKNNLSVATPVKAKRGRKSFKNNKSYIVSYKTSNIDDLKNDLMLISASLKXXXXXXXXXXXXXVCHTSEKLKVETLIEPTTTIEAEGSEKNFSDSFETKKSSTEVESFIDSSDEKLLAAFKSKHRKLHSCKTKDGMKDPMKGSREERWVNIMWQRILKNENSDXXXXXXXXXXXFADXXXXXXXXXXXXXDLASPKFGDSDFCDDNLSCENKESDSNVYKLNSIYNIKRKPNXXXXXXXXXXXXLQPPEKPSHSKSNEIDNHVRVXXXXXXXXXXXXKANVSSNEQCGLIVYKEQQSNPMEKFSRENSAKMFXXXXXXXXXXXXXXXXVQHPPHAKKRWXXXXXXXXXXXXXXXTSKETNNTLNDAFIEKFISIDNSSKHSFLPPVITSVDNTAFSLTPPKIAMNPKKRLLNQFSMEDNAFXXXXXXXXXXXXXXXXXXXXXX--XXXXXQEQSKTKLTLSEYRKRRYCDKTVKSESNLSLKISKKACNNKDSEWVGISDRYGSPPVKEPVEESGQIDNYNSAAYLDATKKLKVDSPIIATVTEPAESNANKXXXXXXXXXXXXXKMPGNLDPRLTKSTAFLNKIYINRNQSEIEPSSMDNTNSIPVVTYSHVESCPRSPSKSPNSPGSEWRMSNFNDRGPRTPSDIDELSINPNNDNDCLSIYAPSQRSIDSFESQPSPTSDCHFDFDRSENNFECKSKSINCDSSGANDWTSHAASIARMAGIPNPDLLQEIEEFDDEYVPLPDNLPERSKEEMETLLLTQKRDSQIREWQEVKQLEREKVKLEHQVRSMQRRNQRITKPNDVAVXXXXXXXXXXXXADHQSNGDPKFSFSLMTTMTDERTMKTFNVQLSNFNDKLMEQINLVKNNNRPLKPPSQNADLPLSYRLSDDIIIPNDTKKSIPIPDDLNNLTXXXXXXXXXXXITTSNPSSNPKLRKRNNEKTINPQQKMITTKPDDTASEIDQSHFSIVHSNNSS-----XXXXXXXXTYPICSQPAPPHAQFLGXXXXXXXXXXXXXXXDHVPTFKSMTSAFM 6227
            MKTDGLNDFDRNDLFKSIGNSFYDDVPNLGSVITLDNKGRLINSQFSKPSSSQTLLKLNSSEEVPDADDLPYSVISYGDTVNAINLPYNDHNYVGTLSNKSLENYDKKALEFTSKQTGQYTNRSTFPPPTNLRISHFSSFNTNHLSQSDFINNRPENIFFNEKPKTNNQFSYNQTINSLTPLITNK LNNQSQPNGFVAKKQILPNAIVINSNSVNKVKSVSVIKLQRPPNLETNSLMNEPRIINIPIKKPNLTNVVTNEVMSNEINSSCDKTTDKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCELKYWMIEEARRKKMVTSPLDEYDAFMYNSEHLKPIMSKPHKKRGRAAKILNTSNRQIMDRPVVMDANPPSAVVRRNKRGRPPLNRQNGIQRSDVKASSDSSSNNCLTEFKEISDNESVPCRTNENIHPSLALRSNFKNFKRISSSHWSLKAHRKLCANKTKPTKSYKTIVPQKVGRPVKHKKEKVVEFKRDVDLSSEPPSSPDRYNETEKSFDNNANISSNEEYE TNMLQYSHEMKHEMTREEEGKYWLEEINNKIYKQKLKEAKKIKRKSRTDKKLSRKITNFNSHKNYVENFEREQVKEIVSKESPEEYKEEIVKEEVIETHSQSVTEVVKEKNNLSVATPVKAKRGRKSFKNNKSYIVSYKTSNIDDLKNDLMLISASLKEEPEEEPNIEPEIVCHTSEKLKVETLIEPTTTIEAEGSEKNFSDSFETKKSSTEVESFIDSSDEKLLAAFKSKHRKLHSCKTKDGMKDPMKGSREERWVNIMWQRILKNENSDSKSKRKRSKSSFADESNQSEENANESNDLASPKFGDSDFCDDNLSCENKESDSNVYKLNSIYNIKRKPNKFKSSSFSDSDKLQPPEKPSHSKSNEIDNHVRVEYSNNSSMEESEKANVSSNEQCGLIVYKEQQSNPMEKFSRENSAKMFNESYSEGGNNNSSNPSVQHPPHAKKRWLSQALLEENLNEASETSKETNNTLNDAFIEKFISIDNSSKHSFLPPVITSVDNTAFSLTPPKIAMNPKKRLLNQFSMEDNAFKINSSDISSYNNKSNNNNN     QNGIDQEQSKTKLTLSEYRKRRYCDKTVKSESNLSLKISKKACNNKDSEWVGISDRYGSPPVKEPVEESGQIDNYNSAAYLDATKKLKVDSPI ATVTEPAESNANKNSSLSYLNTLNNLKMPGNLDPRLTKSTAFLNKIYINRNQSEIEPSSMDNTNSIPVVTYSHVESCPRSPSKSPNSPGSEWRMSNFNDRGPRTPSDIDELSINPNNDNDCLSIYAPSQRSIDSFESQPSPTSDCHFDFDRSENNFECKSKSINCDSSGANDWTSHAASIARMAGIPNPDLLQEIEEFDDEYVPLPDNLPERSKEEMETLLLTQKRDSQIREWQEVKQLEREKVKLEHQVRSMQRRNQRITKPNDVAVKSTSMMKSSIKSADHQSNGDPKFSFSLMTTMTDERTMKTFNVQLSNFNDKLMEQINLVKNNNRPLKPPSQNADLPLSYRLSDDIIIPNDTKKSIPIPDDLNNLTASAVAVAAAAAITTSNPSSNPKLRKRNNEKTINPQQKMITTKPDDTASEIDQSHFSIVHSNNSS     GGGGGGGGTYPICSQPAPPHAQFLGSIQKSSEVVSSIIISDHVPTFKSMTSAFM
Sbjct:    1 MKTDGLNDFDRNDLFKSIGNSFYDDVPNLGSVITLDNKGRLINSQFSKPSSSQTLLKLNSSEEVPDADDLPYSVISYGDTVNAINLPYNDHNYVGTLSNKSLENYDKKALEFTSKQTGQYTNRSTFPPPTNLRISHFSSFNTNHLSQSDFINNRPENIFFNEKPKTNNQFSYNQTINSLTPLITNKLLNNQSQPNGFVAKKQILPNAIVINSNSVNKVKSVSVIKLQRPPNLETNSLMNEPRIINIPIKKPNLTNVVTNEVMSNEINSSCDKTTDKTINLIPRCVCGYTHDDGGLIRCEICQTWQHIICMYPDNKFPILYKCEKCEPRSIDYSRAVATQTNFLIKMKLNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHESSVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGTGAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDKSAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNCELKYWMIEEARRKKMVTSPLDEYDAFMYNSEHLKPIMSKPHKKRGRAAKILNTSNRQIMDRPVVMDANPPSAVVRRNKRGRPPLNRQNGIQRSDVKASSDSSSNNCLTEFKEISDNESVPCRTNENIHPSLALRSNFKNFKRISSSHWSLKAHRKLCANKTKPTKSYKTIVPQKVGRPVKHKKEKVVEFKRDVDLSSEPPSSPDRYNETEKSFDNNANISSNEEYETTNMLQYSHEMKHEMTREEEGKYWLEEINNKIYKQKLKEAKKIKRKSRTDKKLSRKITNFNSHKNYVENFEREQVKEIVSKESPEEYKEEIVKEEVIETHSQSVTEVVKEKNNLSVATPVKAKRGRKSFKNNKSYIVSYKTSNIDDLKNDLMLISASLKEEPEEEPNIEPEIVCHTSEKLKVETLIEPTTTIEAEGSEKNFSDSFETKKSSTEVESFIDSSDEKLLAAFKSKHRKLHSCKTKDGMKDPMKGSREERWVNIMWQRILKNENSDSKSKRKRSKSSFADESNQSEENANESNDLASPKFGDSDFCDDNLSCENKESDSNVYKLNSIYNIKRKPNKFKSSSFSDSDKLQPPEKPSHSKSNEIDNHVRVEYSNNSSMEESEKANVSSNEQCGLIVYKEQQSNPMEKFSRENSAKMFNESYSEGGNNNSSNPSVQHPPHAKKRWLSQALLEENLNEASETSKETNNTLNDAFIEKFISIDNSSKHSFLPPVITSVDNTAFSLTPPKIAMNPKKRLLNQFSMEDNAFKINSSDISSYNNKSNNNNNNNKWDQNGIDQEQSKTKLTLSEYRKRRYCDKTVKSESNLSLKISKKACNNKDSEWVGISDRYGSPPVKEPVEESGQIDNYNSAAYLDATKKLKVDSPINATVTEPAESNANKNSSLSYLNTLNNLKMPGNLDPRLTKSTAFLNKIYINRNQSEIEPSSMDNTNSIPVVTYSHVESCPRSPSKSPNSPGSEWRMSNFNDRGPRTPSDIDELSINPNNDNDCLSIYAPSQRSIDSFESQPSPTSDCHFDFDRSENNFECKSKSINCDSSGANDWTSHAASIARMAGIPNPDLLQEIEEFDDEYVPLPDNLPERSKEEMETLLLTQKRDSQIREWQEVKQLEREKVKLEHQVRSMQRRNQRITKPNDVAVKSTSMMKSSIKSADHQSNGDPKFSFSLMTTMTDERTMKTFNVQLSNFNDKLMEQINLVKNNNRPLKPPSQNADLPLSYRLSDDIIIPNDTKKSIPIPDDLNNLTASAVAVAAAAAITTSNPSSNPKLRKRNNEKTINPQQKMITTKPDDTASEIDQSHFSIVHSNNSSGGGGGGGGGGGGGTYPICSQPAPPHAQFLGSIQKSSEVVSSIIISDHVPTFKSMTSAFM 2051          
BLAST of Lysine methyltransferase 2E vs. Planmine SMEST
Match: SMESG000017190.1 (SMESG000017190.1)

HSP 1 Score: 87.4261 bits (215), Expect = 9.855e-17
Identity = 41/143 (28.67%), Postives = 69/143 (48.25%), Query Frame = 3
Query: 1716 VNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNC 2144
            ++ N  C+++ ++     +++   L    ++    G + L E+Y K       Y PFV  Y  F    L +D       ++Y+RRSC PN +++H ++  GS+   I     I    E+TI FD  ++ C Y V+CACG   C
Sbjct:  530 LDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIV-GGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 671          
BLAST of Lysine methyltransferase 2E vs. Planmine SMEST
Match: SMESG000017190.1 (SMESG000017190.1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.077e-16
Identity = 41/143 (28.67%), Postives = 69/143 (48.25%), Query Frame = 3
Query: 1716 VNSNCSCKVIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFVLFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFITPINWISNDTEITIGFDFNYKKCSYSVECACGHPNC 2144
            ++ N  C+++ ++     +++   L    ++    G + L E+Y K       Y PFV  Y  F    L +D       ++Y+RRSC PN +++H ++  GS+   I     I    E+TI FD  ++ C Y V+CACG   C
Sbjct:  524 LDRNPRCRIVLFDGCTMGLEASVRLQSCSIVAAMIGRMMLMEEYLKYASPAAEYKPFVFLYHGFGDHGLVVDTTVYGNIARYLRRSCDPNVKLEHTIV-GGSLYIVIRTTTEICQGVELTIPFDLPFEICQYPVQCACGKVRC 665          
The following BLAST results are available for this feature:
BLAST of Lysine methyltransferase 2E vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KMT2E4.131e-2643.85lysine methyltransferase 2E [Source:HGNC Symbol;Ac... [more]
SETD52.684e-2534.81SET domain containing 5 [Source:HGNC Symbol;Acc:HG... [more]
SETD54.685e-2534.81SET domain containing 5 [Source:HGNC Symbol;Acc:HG... [more]
SETD54.685e-2534.81SET domain containing 5 [Source:HGNC Symbol;Acc:HG... [more]
SETD54.881e-2534.81SET domain containing 5 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
set-262.389e-929.03Histone-lysine N-methyltransferase set-26 [Source... [more]
set-96.169e-936.78Histone-lysine N-methyltransferase set-9 [Source:... [more]
C16A11.45.191e-843.84pep chromosome:WBcel235:II:4227046:4229157:1 gene:... [more]
C16A11.45.665e-843.84pep chromosome:WBcel235:II:4227046:4229157:1 gene:... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
upSET6.410e-1348.33gene:FBgn0036398 transcript:FBtr0333050[more]
upSET6.410e-1348.33gene:FBgn0036398 transcript:FBtr0075768[more]
ash11.252e-744.90gene:FBgn0005386 transcript:FBtr0306009[more]
ash11.252e-744.90gene:FBgn0005386 transcript:FBtr0306010[more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2e5.334e-2841.48lysine (K)-specific methyltransferase 2E [Source:Z... [more]
setd52.265e-2434.81SET domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
setd53.109e-2434.81SET domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kmt2e3.321e-1450.00lysine (K)-specific methyltransferase 2E [Source:Z... [more]
kmt2e6.087e-1450.00lysine (K)-specific methyltransferase 2E [Source:Z... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SETD59.640e-2636.08SET domain containing 5 [Source:NCBI gene;Acc:1001... [more]
SETD59.911e-2636.08SET domain containing 5 [Source:NCBI gene;Acc:1001... [more]
SETD51.011e-2536.08SET domain containing 5 [Source:NCBI gene;Acc:1001... [more]
SETD51.052e-2536.08SET domain containing 5 [Source:NCBI gene;Acc:1001... [more]
SETD51.102e-2536.08SET domain containing 5 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Setd51.228e-2532.64SET domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
Setd51.324e-2532.64SET domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
Setd51.324e-2532.64SET domain containing 5 [Source:MGI Symbol;Acc:MGI... [more]
Kmt2e7.176e-2544.35lysine (K)-specific methyltransferase 2E [Source:M... [more]
Kmt2e7.176e-2544.35lysine (K)-specific methyltransferase 2E [Source:M... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XJV7|SETD5_MOUSE8.590e-2532.64Histone-lysine N-methyltransferase SETD5 OS=Mus mu... [more]
sp|Q9C0A6|SETD5_HUMAN2.250e-2434.81Histone-lysine N-methyltransferase SETD5 OS=Homo s... [more]
sp|Q8IZD2|KMT2E_HUMAN2.708e-2444.35Inactive histone-lysine N-methyltransferase 2E OS=... [more]
sp|Q3UG20|KMT2E_MOUSE5.019e-2444.35Inactive histone-lysine N-methyltransferase 2E OS=... [more]
sp|Q10362|SET3_SCHPO8.483e-1050.00SET domain-containing protein 3 OS=Schizosaccharom... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8X8E91.133e-4031.23Lysine (K)-specific methyltransferase 2E OS=Esox l... [more]
A0A3P8X8B21.309e-4031.23Lysine (K)-specific methyltransferase 2E OS=Esox l... [more]
A0A5N4E0012.738e-3327.76Inactive histone-lysine N-methyltransferase 2E OS=... [more]
A0A5N4E0F32.947e-3327.76Inactive histone-lysine N-methyltransferase 2E OS=... [more]
M4KB433.910e-3328.50NKp44L (Fragment) OS=Mus musculus OX=10090 GN=Kmt2... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2e9.240e-2842.31lysine (K)-specific methyltransferase 2E [Source:Z... [more]
setd51.853e-2535.44SET domain containing 5 [Source:NCBI gene;Acc:1030... [more]
setd51.920e-2535.44SET domain containing 5 [Source:NCBI gene;Acc:1030... [more]
kmt2e2.552e-1553.23lysine (K)-specific methyltransferase 2E [Source:Z... [more]
ash1l1.330e-638.24histone-lysine N-methyltransferase ASH1L-like [Sou... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kmt2e3.214e-2238.02lysine (K)-specific methyltransferase 2E [Source:Z... [more]
ENSPMAT00000004065.16.685e-640.43pep scaffold:Pmarinus_7.0:GL479372:18838:35317:1 g... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SET36.654e-738.10Defining member of the SET3 histone deacetylase co... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO454236.059e-1832.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476101.819e-638.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2e1.056e-2641.67lysine methyltransferase 2E [Source:NCBI gene;Acc:... [more]
setd59.545e-2635.06SET domain containing 5 [Source:NCBI gene;Acc:1011... [more]
setd59.718e-2635.06SET domain containing 5 [Source:NCBI gene;Acc:1011... [more]
kmt2e6.977e-1452.46lysine methyltransferase 2E [Source:NCBI gene;Acc:... [more]
ash1l4.770e-636.76histone-lysine N-methyltransferase ASH1L [Source:N... [more]
back to top
BLAST of Lysine methyltransferase 2E vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000051295.10.000e+099.37SMESG000051295.1[more]
SMESG000051295.10.000e+099.37SMESG000051295.1[more]
SMESG000017190.19.855e-1728.67SMESG000017190.1[more]
SMESG000017190.11.077e-1628.67SMESG000017190.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023232 ID=SMED30023232|Name=Lysine methyltransferase 2E|organism=Schmidtea mediterranea sexual|type=transcript|length=6458bp
TTTTTGGTTAGTTACTGCATTTAAATTTATCATTTTAGAGTTAATACAGC
TATCAATTTAATTTTAAATTTAGTGATTTATGATATTTTATGGCAAATAT
GAAAACTGATGGGCTAAATGATTTTGATAGAAATGATTTATTTAAATCTA
TAGGAAATTCCTTTTATGACGATGTTCCTAATTTGGGTTCTGTGATAACA
CTTGATAATAAAGGTCGTTTAATCAATTCTCAATTTTCCAAACCTTCCTC
ATCTCAAACACTTTTAAAATTAAATTCGTCGGAAGAAGTTCCCGATGCAG
ACGATTTACCTTACTCTGTAATATCATATGGCGATACTGTAAATGCTATT
AATCTCCCTTACAACGATCATAATTATGTCGGTACTCTAAGTAATAAAAG
TCTGGAAAATTATGATAAAAAGGCTTTAGAATTCACAAGTAAACAAACCG
GCCAATACACGAATAGATCAACATTTCCACCTCCTACTAATTTAAGAATT
TCTCATTTTAGTAGTTTTAATACCAATCATTTATCACAAAGTGATTTCAT
CAACAACCGCCCTGAAAATATATTTTTTAATGAAAAGCCCAAAACAAACA
ATCAATTCAGCTATAATCAAACTATTAATTCATTAACACCACTTATTACA
AATAAGTCACTGAATAATCAATCACAACCGAATGGATTTGTAGCCAAAAA
GCAGATTTTGCCTAACGCAATCGTAATAAATTCTAATTCAGTGAACAAAG
TAAAAAGCGTTAGCGTCATCAAGTTGCAACGACCGCCGAATTTAGAAACG
AATTCTTTAATGAATGAACCGAGAATTATTAATATTCCAATTAAAAAACC
GAATCTGACAAATGTTGTGACAAATGAAGTAATGTCCAACGAAATTAATT
CTAGTTGTGATAAAACGACGGATAAAACAATCAATCTTATACCTCGTTGC
GTCTGTGGTTACACCCACGATGATGGTGGATTGATTAGATGTGAAATTTG
TCAAACATGGCAACATATTATCTGTATGTATCCTGACAACAAATTTCCAA
TTCTATACAAATGTGAAAAATGTGAGCCTCGTAGTATTGATTACAGTCGG
GCAGTGGCTACTCAGACTAATTTCTTAATCAAGATGAAGCTTAATCCAAC
TGAATTTCTAGTCAATCACGATTATCACAGCTATGACAATGAAAACAACA
CCGAAAACACTCACTCAAAATGTCACACTCCTCAATATGTGATCGTTCAA
CCGGAATTGAAAACTCCATTCAAACACATGCATGAATCATCAGTTCACAG
TTCACAAAACCAAATTATGTTCACCAATTCCAAAGATCCTTTATTGGTAC
CACCCGGATCACCGAGAACATCGAAACGAAAACAAGATCTCATTAGTCTT
AAAACCGTATTAACAAAGCCGAATAGTGTTGTCGGTACTGGAGCGTTCAC
AGTGAATAACATTGTCATTCATAATTCTTCCAAATCAAACAGTGAACTAC
AAAACAGTATCATGGAGAACCAAATGAATTATAATTGCTATTCCAATTAT
TTGATTCCTACCTCAGCAAACTCTGTGAAAATCGATAAGTCGGCATTTTT
CACAACAATCAATGAAATAAGCGGAAAATTAAAAGCGCTTTTCTGTAACC
GAATACAAACTCATACGAATTTATCAATTCACCAAGAACAATTTCTCAAA
CTCAACAATTACACAGTTAATTCAAACTGCAGCTGCAAAGTGATAAAATA
CAATAACAATCAAACTGTCATCAAATCAATAAAGGAATTACACTGCAGCG
AGGTAATCATGGAATTCAACGGATTTATAAGCCTCTCTGAAGACTACAAC
AAAGAATTTGATTATAGAAAGCATTACAATCCATTTGTACTTTTCTATGA
GAAATTCGACCATTTATCTTTGGCAATTGATGCTATCAGTAAAAGTTGTG
ATTCCAAATACATCAGACGTTCGTGTACGCCAAACGCTGAGGTGAAGCAC
CGAGTAATACCGAATGGATCTATACGGTTCTTTATCACGCCGATCAATTG
GATTTCAAATGACACTGAAATTACGATCGGGTTCGATTTTAATTATAAGA
AGTGCAGTTACTCGGTTGAATGTGCTTGTGGTCACCCGAATTGCGAGTTG
AAATACTGGATGATAGAGGAAGCCCGTCGCAAAAAGATGGTAACTTCTCC
GTTGGATGAATACGACGCTTTCATGTACAATTCTGAGCACTTGAAGCCAA
TTATGTCGAAGCCTCACAAAAAACGAGGTCGGGCCGCTAAAATATTGAAT
ACTTCCAATCGGCAAATCATGGACCGACCGGTTGTTATGGATGCTAATCC
ACCATCGGCGGTGGTTAGACGCAACAAACGAGGACGGCCTCCATTAAACC
GACAGAATGGCATCCAGCGGTCTGATGTGAAAGCATCATCCGATAGTAGC
TCGAATAATTGCCTGACAGAATTCAAAGAAATATCAGACAACGAGTCGGT
ACCGTGTCGGACCAATGAAAATATCCATCCCAGTTTGGCTCTGCGTTCGA
ATTTCAAAAATTTTAAACGAATATCGTCTAGCCATTGGAGCTTAAAGGCC
CACCGTAAACTCTGTGCCAATAAAACCAAACCAACTAAATCCTATAAAAC
AATTGTTCCACAAAAAGTCGGAAGACCTGTCAAACATAAAAAAGAAAAAG
TAGTCGAGTTTAAAAGAGATGTAGATTTATCCAGCGAGCCTCCTTCATCT
CCTGATCGGTATAACGAGACTGAGAAATCATTCGATAACAATGCAAATAT
TTCTTCAAATGAAGAATATGAAACTAATATGCTTCAGTATTCTCACGAAA
TGAAGCACGAAATGACTAGAGAAGAGGAGGGCAAATATTGGCTAGAAGAA
ATTAATAACAAAATTTACAAACAGAAATTAAAAGAAGCAAAAAAGATAAA
ACGTAAAAGTCGTACGGATAAGAAACTATCAAGAAAAATAACCAATTTTA
ATAGCCACAAGAATTATGTGGAGAACTTTGAAAGGGAACAAGTTAAAGAA
ATTGTTTCTAAAGAGTCACCAGAGGAATATAAAGAGGAAATAGTGAAAGA
AGAAGTAATCGAGACTCATTCGCAGTCTGTGACTGAAGTGGTTAAGGAAA
AAAATAATTTATCTGTTGCCACTCCCGTTAAAGCTAAAAGAGGAAGAAAA
AGTTTTAAAAACAATAAGAGTTATATTGTCAGCTATAAAACCTCTAATAT
TGACGACTTGAAAAATGATTTGATGCTTATTTCAGCTAGTTTAAAAGAAG
AACCAGAAGAAGAACCGAATATTGAACCGGAAATTGTTTGTCATACATCT
GAGAAATTAAAAGTAGAAACTTTAATTGAACCAACAACAACTATTGAGGC
AGAAGGATCGGAGAAGAATTTCTCAGATTCATTTGAAACTAAAAAGTCTT
CTACTGAAGTTGAATCTTTTATTGATTCTTCGGATGAAAAACTATTGGCA
GCTTTTAAATCCAAACATCGCAAGTTACATTCATGTAAAACAAAAGACGG
AATGAAAGATCCAATGAAAGGCAGCCGAGAAGAACGATGGGTGAATATTA
TGTGGCAAAGAATTTTGAAAAATGAAAATTCAGACAGTAAATCAAAGAGG
AAACGCAGCAAGAGTTCATTTGCAGATGAAAGCAACCAATCAGAAGAAAA
TGCTAATGAATCTAATGATTTGGCATCCCCGAAATTCGGCGACTCTGACT
TTTGTGATGACAATTTATCGTGCGAGAACAAAGAAAGTGACAGCAATGTC
TATAAGCTGAATTCTATATACAACATCAAACGGAAACCCAATAAATTCAA
GTCGTCATCGTTCAGCGATTCGGACAAGTTACAACCTCCTGAAAAACCAT
CACACTCTAAATCAAATGAAATTGATAACCACGTGAGAGTTGAATATTCA
AATAATTCATCAATGGAAGAAAGCGAGAAAGCTAATGTGTCGTCAAATGA
GCAATGCGGGCTAATTGTCTACAAGGAACAGCAATCAAATCCAATGGAAA
AATTCAGCAGAGAAAATAGTGCAAAAATGTTCAATGAAAGTTATAGTGAA
GGAGGAAATAACAATTCATCGAATCCATCTGTTCAGCACCCGCCACATGC
AAAGAAACGCTGGCTTAGTCAGGCACTATTGGAAGAAAATCTTAATGAGG
CGTCAGAAACCTCTAAAGAAACTAATAACACATTAAATGATGCATTTATT
GAGAAATTTATATCTATTGACAACAGTTCCAAGCACAGTTTTTTACCGCC
TGTTATAACATCTGTTGATAATACTGCTTTCTCCTTGACACCGCCCAAAA
TTGCGATGAATCCCAAAAAACGTTTGTTGAATCAATTCTCAATGGAAGAC
AACGCATTTAAAATCAACTCTTCAGACATTAGTAGCTACAATAATAAATC
TAATAATAATAATAATAAATGGGATCAGAATGGGATCGATCAAGAGCAAT
CGAAAACCAAATTAACGTTATCTGAGTATCGAAAGCGAAGATATTGTGAC
AAAACAGTTAAAAGCGAATCGAATCTGTCATTGAAAATCAGTAAGAAGGC
ATGCAATAATAAGGACAGCGAGTGGGTTGGAATCTCCGACAGATACGGCT
CGCCGCCTGTTAAGGAACCCGTCGAGGAATCTGGGCAAATTGACAATTAT
AATTCTGCAGCATATCTTGATGCAACTAAAAAATTGAAAGTAGATTCTCC
AATTATTGCCACAGTAACGGAACCAGCCGAATCTAATGCCAACAAAAATT
CATCTTTATCCTATTTGAATACTTTAAATAATTTAAAAATGCCTGGAAAT
CTTGATCCACGGCTTACAAAATCTACTGCTTTCCTAAACAAAATATATAT
TAACAGAAACCAATCAGAAATCGAACCGAGTTCAATGGATAATACCAATA
GTATTCCAGTTGTTACTTATTCCCATGTGGAGTCATGCCCGAGATCTCCG
TCTAAATCTCCAAATTCTCCTGGATCCGAATGGCGAATGTCAAATTTTAA
CGATCGTGGTCCAAGGACTCCCAGTGACATAGATGAACTATCGATTAATC
CCAATAACGATAACGACTGCTTGTCAATATACGCCCCTTCCCAGAGATCT
ATCGATTCTTTTGAAAGCCAGCCATCTCCTACTTCTGATTGCCATTTCGA
CTTTGACAGATCGGAAAATAATTTTGAATGTAAGAGTAAATCGATAAATT
GTGACTCATCGGGTGCCAATGACTGGACTAGTCACGCGGCAAGCATAGCT
AGAATGGCCGGAATTCCAAATCCAGATCTACTTCAAGAAATTGAAGAGTT
TGACGATGAATATGTCCCGCTACCGGATAATCTCCCAGAACGGAGCAAAG
AGGAGATGGAAACGTTGTTATTAACCCAGAAGCGAGATTCCCAGATCCGT
GAATGGCAGGAAGTAAAGCAGTTGGAGAGAGAAAAGGTGAAACTGGAGCA
TCAAGTGCGATCGATGCAACGGCGTAACCAGCGGATTACAAAACCAAATG
ATGTGGCCGTCAAATCGACATCAATGATGAAATCTTCAATTAAATCCGCA
GATCACCAGAGCAACGGTGACCCGAAATTCTCGTTCTCGTTAATGACAAC
TATGACCGATGAGAGAACCATGAAAACTTTCAACGTTCAACTGTCGAATT
TCAATGACAAATTGATGGAACAAATAAACCTGGTGAAAAATAATAACAGG
CCCCTTAAGCCGCCGTCACAGAACGCCGATTTGCCATTATCCTATCGATT
ATCAGATGATATTATTATCCCCAACGACACCAAAAAATCCATCCCAATCC
CCGATGATCTCAACAACCTAACTGCCAGTGCCGTCGCCGTCGCCGCCGCC
GCCGCCATCACAACCTCAAATCCATCATCAAATCCCAAGCTGAGAAAACG
GAACAATGAGAAAACAATCAATCCACAACAAAAAATGATAACTACTAAAC
CAGATGACACTGCGTCAGAAATTGACCAATCACATTTCTCCATCGTCCAC
AGCAACAACAGTAGCGGTGGAGGTGGTGGTGGTGGTGGAACCTACCCTAT
TTGTTCACAGCCTGCACCGCCACACGCGCAATTCCTCGGTAGCATTCAAA
AATCGTCAGAAGTTGTCAGCTCAATAATTATATCAGATCACGTCCCTACT
TTTAAATCGATGACTTCAGCTTTCATGTAAATACATTGTGTAAAGAATTT
ATCGATTTGTGTTGCACAAAACATATTTTGGTTACGGTTGACGACTAAAA
CAACAACGTATATATAAAATATACTTATAAATATTATATATATAAATAAT
TTGTATTTAATTGCGCTATTTATTATTAAAAAAAATATTGTTGATAGAAA
CTGCGGATATTACTTTCATCGTCATCGTATTTGTCCTTGTCGTCTTCATG
AGTTCAAT
back to top

protein sequence of SMED30023232-orf-1

>SMED30023232-orf-1 ID=SMED30023232-orf-1|Name=SMED30023232-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2047bp
MANMKTDGLNDFDRNDLFKSIGNSFYDDVPNLGSVITLDNKGRLINSQFS
KPSSSQTLLKLNSSEEVPDADDLPYSVISYGDTVNAINLPYNDHNYVGTL
SNKSLENYDKKALEFTSKQTGQYTNRSTFPPPTNLRISHFSSFNTNHLSQ
SDFINNRPENIFFNEKPKTNNQFSYNQTINSLTPLITNKSLNNQSQPNGF
VAKKQILPNAIVINSNSVNKVKSVSVIKLQRPPNLETNSLMNEPRIINIP
IKKPNLTNVVTNEVMSNEINSSCDKTTDKTINLIPRCVCGYTHDDGGLIR
CEICQTWQHIICMYPDNKFPILYKCEKCEPRSIDYSRAVATQTNFLIKMK
LNPTEFLVNHDYHSYDNENNTENTHSKCHTPQYVIVQPELKTPFKHMHES
SVHSSQNQIMFTNSKDPLLVPPGSPRTSKRKQDLISLKTVLTKPNSVVGT
GAFTVNNIVIHNSSKSNSELQNSIMENQMNYNCYSNYLIPTSANSVKIDK
SAFFTTINEISGKLKALFCNRIQTHTNLSIHQEQFLKLNNYTVNSNCSCK
VIKYNNNQTVIKSIKELHCSEVIMEFNGFISLSEDYNKEFDYRKHYNPFV
LFYEKFDHLSLAIDAISKSCDSKYIRRSCTPNAEVKHRVIPNGSIRFFIT
PINWISNDTEITIGFDFNYKKCSYSVECACGHPNCELKYWMIEEARRKKM
VTSPLDEYDAFMYNSEHLKPIMSKPHKKRGRAAKILNTSNRQIMDRPVVM
DANPPSAVVRRNKRGRPPLNRQNGIQRSDVKASSDSSSNNCLTEFKEISD
NESVPCRTNENIHPSLALRSNFKNFKRISSSHWSLKAHRKLCANKTKPTK
SYKTIVPQKVGRPVKHKKEKVVEFKRDVDLSSEPPSSPDRYNETEKSFDN
NANISSNEEYETNMLQYSHEMKHEMTREEEGKYWLEEINNKIYKQKLKEA
KKIKRKSRTDKKLSRKITNFNSHKNYVENFEREQVKEIVSKESPEEYKEE
IVKEEVIETHSQSVTEVVKEKNNLSVATPVKAKRGRKSFKNNKSYIVSYK
TSNIDDLKNDLMLISASLKEEPEEEPNIEPEIVCHTSEKLKVETLIEPTT
TIEAEGSEKNFSDSFETKKSSTEVESFIDSSDEKLLAAFKSKHRKLHSCK
TKDGMKDPMKGSREERWVNIMWQRILKNENSDSKSKRKRSKSSFADESNQ
SEENANESNDLASPKFGDSDFCDDNLSCENKESDSNVYKLNSIYNIKRKP
NKFKSSSFSDSDKLQPPEKPSHSKSNEIDNHVRVEYSNNSSMEESEKANV
SSNEQCGLIVYKEQQSNPMEKFSRENSAKMFNESYSEGGNNNSSNPSVQH
PPHAKKRWLSQALLEENLNEASETSKETNNTLNDAFIEKFISIDNSSKHS
FLPPVITSVDNTAFSLTPPKIAMNPKKRLLNQFSMEDNAFKINSSDISSY
NNKSNNNNNKWDQNGIDQEQSKTKLTLSEYRKRRYCDKTVKSESNLSLKI
SKKACNNKDSEWVGISDRYGSPPVKEPVEESGQIDNYNSAAYLDATKKLK
VDSPIIATVTEPAESNANKNSSLSYLNTLNNLKMPGNLDPRLTKSTAFLN
KIYINRNQSEIEPSSMDNTNSIPVVTYSHVESCPRSPSKSPNSPGSEWRM
SNFNDRGPRTPSDIDELSINPNNDNDCLSIYAPSQRSIDSFESQPSPTSD
CHFDFDRSENNFECKSKSINCDSSGANDWTSHAASIARMAGIPNPDLLQE
IEEFDDEYVPLPDNLPERSKEEMETLLLTQKRDSQIREWQEVKQLEREKV
KLEHQVRSMQRRNQRITKPNDVAVKSTSMMKSSIKSADHQSNGDPKFSFS
LMTTMTDERTMKTFNVQLSNFNDKLMEQINLVKNNNRPLKPPSQNADLPL
SYRLSDDIIIPNDTKKSIPIPDDLNNLTASAVAVAAAAAITTSNPSSNPK
LRKRNNEKTINPQQKMITTKPDDTASEIDQSHFSIVHSNNSSGGGGGGGG
TYPICSQPAPPHAQFLGSIQKSSEVVSSIIISDHVPTFKSMTSAFM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR019786Zinc_finger_PHD-type_CS
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0018024histone-lysine N-methyltransferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0032259methylation
GO:0034968histone lysine methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1795..1815
NoneNo IPR availableCOILSCoilCoilcoord: 1362..1382
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 536..691
e-value: 6.0E-13
score: 50.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1179..1215
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1198..1214
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 877..896
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1266..1282
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1180..1197
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 877..906
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 769..789
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1336..1356
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1632..1651
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1336..1351
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1255..1282
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 758..789
NoneNo IPR availablePANTHERPTHR46462FAMILY NOT NAMEDcoord: 86..1119
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 482..685
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 283..348
e-value: 2.4E-16
score: 61.0
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 287..328
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 283..337