SMED30023226

Overview
NameSMED30023226
Smed IDSMED30023226
Length (bp)3114
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30023226 (SMED30023226) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30023226 (SMED30023226) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30023226 (SMED30023226) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30023226 (SMED30023226) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023226

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023226h1SMcG0000334 dd_Smed_v4_4730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023226h1SMcG0000334 dd_Smed_v4_4730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023226h1SMcG0000334 dd_Smed_v4_4730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023226h1SMcG0000334 dd_Smed_v4_4730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
ovarySMED30023226h1SMcG0000334 Contig1627newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30023226h1SMcG0000334 Contig1627uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30023226h1SMcG0000334 Contig1627newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30023226h1SMcG0000334 Contig1627uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30023226h1SMcG0010072 Contig1627newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30023226h1SMcG0010072 Contig1627uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30023226h1SMcG0010072 Contig1627newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30023226h1SMcG0010072 Contig1627uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30023226 vs. TrEMBL
Match: A0A4S2LLD0 (SH2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006740 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.078e-8
Identity = 57/238 (23.95%), Postives = 96/238 (40.34%), Query Frame = 1
Query:  787 NSSEGDIYRKIKFSCALQQPHMFSVHGEINVLEGSKKKWKLCNGSVDKEHGQLII-KNNRGPTQLIELIRFNFIPIHYSVYQK-YCFLLVNKEANGMPKTYYISIVDPPG---VICNT------VAYDRRELCEEA-YAYRPYNLVEYDKEVYHSTESNADKDS-------------------------DSLLRRAYDRWSVAVKRHCANTKDDVANEENPERHSKLHRYNRRLKLTI 1389
            N     IY  ++++    Q  +  +HGE++++   +KKWK     +D+  G L +    +  T+   L   +F P+H  +Y + +CF L+   A+   +   +  +DPP     IC T      VA   R +   A Y + P       ++  HS  S+    S                          + +   + RW   V+ HC NT+ D ANEE+  R     R  R L++ I
Sbjct:  442 NPPSSAIYMALRYTRQPAQLAVLEIHGEMSMMTTQRKKWKPYYAQLDRRQGILTLWGGEKRKTERFNLADCDFFPVHPLMYDRPFCFGLILYGASLGDREELVFSIDPPSFSCAICRTTTGLTAVAPSNRSVLPSANYDWEPSTYAARPEDAVHSAPSSVASGSCPRLSPSNSVSAENSAPGFSCSHAPPASMETIFQRWLRCVRLHCCNTRVDAANEEDLGRRQTHLRIYRTLEVKI 679          
BLAST of SMED30023226 vs. TrEMBL
Match: A0A419PC99 (Ras GTPase-activating protein 1 OS=Clonorchis sinensis OX=79923 GN=RASA1 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.889e-8
Identity = 56/238 (23.53%), Postives = 95/238 (39.92%), Query Frame = 1
Query:  787 NSSEGDIYRKIKFSCALQQPHMFSVHGEINVLEGSKKKWKLCNGSVDKEHGQLII-KNNRGPTQLIELIRFNFIPIHYSVYQK-YCFLLVNKEANGMPKTYYISIVDPPGVICN---------TVAYDRRELCEEA-YAYRPYNLVEYDKEVYHSTESNADKDS-------------------------DSLLRRAYDRWSVAVKRHCANTKDDVANEENPERHSKLHRYNRRLKLTI 1389
            N     IY  ++++    Q  +  +HGE++++   +KKWK     +D+  G L +    +  T+   L   +F P+H  +Y + +CF L+   A+   +   I  +DPP   C          TVA   R +   A Y + P       ++  +S  S+    S                          + +   + RW   V+ HC NT+ D ANEE+  R     R  R L++ I
Sbjct:  443 NPPSSAIYMALRYTRQPAQLAVLEIHGEMSMMTTQRKKWKPYYAQLDRRQGILTLWGGEKRKTERFNLADCDFFPVHPLMYDRPFCFGLILYGASLGDREELIFSIDPPSFSCAICRTTSGLITVAPSNRSVLPSANYDWEPSTYAARPEDAVYSAPSSVASGSCPRLSPSNSVSAENSAPGFPCSHAPPASMETIFQRWLRCVRLHCCNTRVDAANEEDLGRRQTHLRIYRTLEVKI 680          
BLAST of SMED30023226 vs. Planmine SMEST
Match: SMESG000011108.1 (SMESG000011108.1)

HSP 1 Score: 2043.08 bits (5292), Expect = 0.000e+0
Identity = 1027/1028 (99.90%), Postives = 1027/1028 (99.90%), Query Frame = 1
Query:   28 MTSINFIDEEECPKHSDNLNIPDFRDIYHGCMSREVSLKTLKASGENNCYLIRKRINAEEDEHCIEYILSFLNGDDDYHFKIKKENKYFIFANRYFPSFKCVISHYMLSNIINDAHLEFGVVNKTITAVRESLRGQLCYLMDNISNERIIELLHKNGPGSYLFRPRTDDNNQFVLMFFDGAKIHKLKMDVQVLEKKSNSSNNELTQPVVVIVLGRNFFETWKEMVDNFTENPIVKVDGPNCQDKLVTAVDINGNSSEGDIYRKIKFSCALQQPHMFSVHGEINVLEGSKKKWKLCNGSVDKEHGQLIIKNNRGPTQLIELIRFNFIPIHYSVYQKYCFLLVNKEANGMPKTYYISIVDPPGVICNTVAYDRRELCEEAYAYRPYNLVEYDKEVYHSTESNADKDSDSLLRRAYDRWSVAVKRHCANTKDDVANEENPERHSKLHRYNRRLKLTIGHTGGQEISLVDADANIXXXXXXXXXXXXXXXXXXXXGQFEVMLGKYLIAVIPRIRDGSPQTLLFQDLPSNLNDVSVNIRIKGSKRKEFTKELCNFTRVHQELVPRSIINSQTYQEPDLTSSTNSCLGPPSIQADPPSSCGPITVDCYASIEYRELIILPFNNYTTLSRHIMDNLSSIFGNENFSKSFKNALELNEYKKLLNCFLYMAIWEKRQVXXXXXXXXXXXRDYVKDSNLYFRNNTCASRLFLDYVFQFASDWLVCSYVGFFETLFLSTDLITSSEPTNDDPASIDNLEQSPPRNTSCKDKKIENEVLLKCLIAALDGIIDNWKKCPITLRQLFNFIQCEIERLHPNFNENKPDNSTDSSNITEPQGGLRYKLLTNLVLFRFFCAVMNSRGERQDDFLRKISENIRKKNFSNFSSFPKTFARQEPLNDFMTKISRLIFQTYSSNKNNKDKIDFFSQIEEYREKTIKTLNDELTRDLSIKEKEAMTQQLESESQTICRLSSLSRRFNEVLEFLTKLQEEPSYFLKLKQDQENIIPCKITKSHVISSELSTIIDEINTKKSCKNNTLIDRL 3111
            MTSINFIDEEECPKHSDNLNIPDFRDIYHGCMSREVSLKTLKASGENNCYLIRKRINAEEDEHCIEYILSFLNGDDDYHFKIKKENKYFIFANRYFPSFKCVISHYMLSNIINDAHLEFGVVNKTITAVRESLRGQLCYLMDNISNERIIELLHKNGPGSYLFRPRTDDNNQFVLMFFDGAKIHKLKMDVQVLEKKSNSSNNELTQPVVVIVLGRNFFETWKEMVDNFTENPIVKVDGPNCQDKLVTAVDINGNSSEGDIYRKIKFSCALQQPHMFSVHGEINVLEGSKKKWKLCNGSVDKEHGQLIIKNNRGPTQLIELIRFNFIPIHYSVYQKYCFLLVNKEANGMPKTYYISIVDPPGVICNTVAYDRRELCEEAYAYRPYNLVEYDKEVYHSTESNADKDSDSLLRRAYDRWSVAVKRHCANTKDDVANEENPERHSKLHRYNRRLKLTIGHTGGQEISLVDADANISPPLNSSLSASQSSQPLPASGQFEVMLGKYLIAVIPRIRDGSPQTLLFQDLPSNLNDVSVNIRIKGSKRKEFTKELCNFTRVHQELVPRSIINSQTYQEPDLTSSTNSCLGPPSIQADPPSSCGPITVDCYASIEYRELIILPFNNYTTLSRHIMDNLSSIFGNENFSKSFKNALELNEYKKLLNCFLYMAIWEKRQVDFLFLFFEEDLRDYVKDSNLYFRNNTCASRLFLDYVFQFASDWLVCSYVGFFETLFLSTDLITSSEPTNDDPASIDNLEQSPPRNTSCKDKKIENEVLLKCLIAALDGIIDNWKKCPITLRQLFNFIQCEIERLHPNFNENKPDNSTDSSNITEPQGGLRYKLLTNLVLFRFFCAVMNSRGERQDDFLRKISENIRKKNFSNFSSFPKTFAR EPLNDFMTKISRLIFQTYSSNKNNKDKIDFFSQIEEYREKTIKTLNDELTRDLSIKEKEAMTQQLESESQTICRLSSLSRRFNEVLEFLTKLQEEPSYFLKLKQDQENIIPCKITKSHVISSELSTIIDEINTKKSCKNNTLIDRL
Sbjct:    1 MTSINFIDEEECPKHSDNLNIPDFRDIYHGCMSREVSLKTLKASGENNCYLIRKRINAEEDEHCIEYILSFLNGDDDYHFKIKKENKYFIFANRYFPSFKCVISHYMLSNIINDAHLEFGVVNKTITAVRESLRGQLCYLMDNISNERIIELLHKNGPGSYLFRPRTDDNNQFVLMFFDGAKIHKLKMDVQVLEKKSNSSNNELTQPVVVIVLGRNFFETWKEMVDNFTENPIVKVDGPNCQDKLVTAVDINGNSSEGDIYRKIKFSCALQQPHMFSVHGEINVLEGSKKKWKLCNGSVDKEHGQLIIKNNRGPTQLIELIRFNFIPIHYSVYQKYCFLLVNKEANGMPKTYYISIVDPPGVICNTVAYDRRELCEEAYAYRPYNLVEYDKEVYHSTESNADKDSDSLLRRAYDRWSVAVKRHCANTKDDVANEENPERHSKLHRYNRRLKLTIGHTGGQEISLVDADANISPPLNSSLSASQSSQPLPASGQFEVMLGKYLIAVIPRIRDGSPQTLLFQDLPSNLNDVSVNIRIKGSKRKEFTKELCNFTRVHQELVPRSIINSQTYQEPDLTSSTNSCLGPPSIQADPPSSCGPITVDCYASIEYRELIILPFNNYTTLSRHIMDNLSSIFGNENFSKSFKNALELNEYKKLLNCFLYMAIWEKRQVDFLFLFFEEDLRDYVKDSNLYFRNNTCASRLFLDYVFQFASDWLVCSYVGFFETLFLSTDLITSSEPTNDDPASIDNLEQSPPRNTSCKDKKIENEVLLKCLIAALDGIIDNWKKCPITLRQLFNFIQCEIERLHPNFNENKPDNSTDSSNITEPQGGLRYKLLTNLVLFRFFCAVMNSRGERQDDFLRKISENIRKKNFSNFSSFPKTFARHEPLNDFMTKISRLIFQTYSSNKNNKDKIDFFSQIEEYREKTIKTLNDELTRDLSIKEKEAMTQQLESESQTICRLSSLSRRFNEVLEFLTKLQEEPSYFLKLKQDQENIIPCKITKSHVISSELSTIIDEINTKKSCKNNTLIDRL 1028          
BLAST of SMED30023226 vs. Planmine SMEST
Match: SMESG000011108.1 (SMESG000011108.1)

HSP 1 Score: 2020.36 bits (5233), Expect = 0.000e+0
Identity = 1018/1028 (99.03%), Postives = 1019/1028 (99.12%), Query Frame = 1
Query:   28 MTSINFIDEEECPKHSDNLNIPDFRDIYHGCMSREVSLKTLKASGENNCYLIRKRINAEEDEHCIEYILSFLNGDDDYHFKIKKENKYFIFANRYFPSFKCVISHYMLSNIINDAHLEFGVVNKTITAVRESLRGQLCYLMDNISNERIIELLHKNGPGSYLFRPRTDDNNQFVLMFFDGAKIHKLKMDVQVLEKKSNSSNNELTQPVVVIVLGRNFFETWKEMVDNFTENPIVKVDGPNCQDKLVTAVDINGNSSEGDIYRKIKFSCALQQPHMFSVHGEINVLEGSKKKWKLCNGSVDKEHGQLIIKNNRGPTQLIELIRFNFIPIHYSVYQKYCFLLVNKEANGMPKTYYISIVDPPGVICNTVAYDRRELCEEAYAYRPYNLVEYDKEVYHSTESNADKDSDSLLRRAYDRWSVAVKRHCANTKDDVANEENPERHSKLHRYNRRLKLTIGHTGGQEISLVDADANIXXXXXXXXXXXXXXXXXXXXGQFEVMLGKYLIAVIPRIRDGSPQTLLFQDLPSNLNDVSVNIRIKGSKRKEFTKELCNFTRVHQELVPRSIINSQTYQEPDLTSSTNSCLGPPSIQADPPSSCGPITVDCYASIEYRELIILPFNNYTTLSRHIMDNLSSIFGNENFSKSFKNALELNEYKKLLNCFLYMAIWEKRQVXXXXXXXXXXXRDYVKDSNLYFRNNTCASRLFLDYVFQFASDWLVCSYVGFFETLFLSTDLITSSEPTNDDPASIDNLEQSPPRNTSCKDKKIENEVLLKCLIAALDGIIDNWKKCPITLRQLFNFIQCEIERLHPNFNENKPDNSTDSSNITEPQGGLRYKLLTNLVLFRFFCAVMNSRGERQDDFLRKISENIRKKNFSNFSSFPKTFARQEPLNDFMTKISRLIFQTYSSNKNNKDKIDFFSQIEEYREKTIKTLNDELTRDLSIKEKEAMTQQLESESQTICRLSSLSRRFNEVLEFLTKLQEEPSYFLKLKQDQENIIPCKITKSHVISSELSTIIDEINTKKSCKNNTLIDRL 3111
            MTSINFIDEEECPKHSDNLNIPDFRDIYHGCMSREVSLKTLKASGENNCYLIRKRINAEEDEHCIEYILSFLNGDDDYHFKIKKENKYFIFANRYFPSFKCVISHYMLSNIINDAHLEFGVVNKTITAVRESLRGQLCYLMDNISNERIIELLHKNGPGSYLFRPRTDDNNQFVLMFFDGAKIHKLKMDVQVLEKKSNSSNNELTQPVVVIVLGRNFFETWKEMVDNFTENPIVKVDGPNCQDKLVTAVDINGNSSEGDIYRKIKFSCALQQPHMFSVHGEINVLEGSKKKWKLCNGSVDKEHGQLIIKNNRGPTQLIELIRFNFIPIHYSVYQKYCFLLVNKEANGMPKTYYISIVDPPGVICNTVAYDRRELCEEAYAYRPYNLVEYDKEVYHSTESNADKDSDSLLRRAYDRWSVAVKRHCANTKDDVANEENPERHSKLHRYNRRLKLTIGHTGGQEISLVDADANISPPLNSSLSASQSSQPLPASGQFEVMLGKYLIAVIPRIRDGSPQTLLFQDLPSNLNDVSVNIRIKGSKRKEFTKELCNFTRVHQELVPRSIINSQTYQEPDLTSSTNSCLGPPSIQADPPSSCGPITVDCYASIEYRELIILPFNNYTTLSRHIMDNLSSIFGNENFSKSFKNALELNEYKKLLNCFLYMAIWEKRQVDFLFLFFEEDLRDYVKDSNLYFRNNTCASRLFLDYVFQFASDWLVCSYVGFFETLFLSTDLITSSEPTNDDPASIDNLEQSPP        +IENEVLLKCLIAALDGIIDNWKKCPITLRQLFNFIQCEIERLHPNFNENKPDNSTDSSNITEPQGGLRYKLLTNLVLFRFFCAVMNSRGERQDDFLRKISENIRKKNFSNFSSFPKTFAR EPLNDFMTKISRLIFQTYSSNKNNKDKIDFFSQIEEYREKTIKTLNDELTRDLSIKEKEAMTQQLESESQTICRLSSLSRRFNEVLEFLTKLQEEPSYFLKLKQDQENIIPCKITKSHVISSELSTIIDEINTKKSCKNNTLIDRL
Sbjct:    1 MTSINFIDEEECPKHSDNLNIPDFRDIYHGCMSREVSLKTLKASGENNCYLIRKRINAEEDEHCIEYILSFLNGDDDYHFKIKKENKYFIFANRYFPSFKCVISHYMLSNIINDAHLEFGVVNKTITAVRESLRGQLCYLMDNISNERIIELLHKNGPGSYLFRPRTDDNNQFVLMFFDGAKIHKLKMDVQVLEKKSNSSNNELTQPVVVIVLGRNFFETWKEMVDNFTENPIVKVDGPNCQDKLVTAVDINGNSSEGDIYRKIKFSCALQQPHMFSVHGEINVLEGSKKKWKLCNGSVDKEHGQLIIKNNRGPTQLIELIRFNFIPIHYSVYQKYCFLLVNKEANGMPKTYYISIVDPPGVICNTVAYDRRELCEEAYAYRPYNLVEYDKEVYHSTESNADKDSDSLLRRAYDRWSVAVKRHCANTKDDVANEENPERHSKLHRYNRRLKLTIGHTGGQEISLVDADANISPPLNSSLSASQSSQPLPASGQFEVMLGKYLIAVIPRIRDGSPQTLLFQDLPSNLNDVSVNIRIKGSKRKEFTKELCNFTRVHQELVPRSIINSQTYQEPDLTSSTNSCLGPPSIQADPPSSCGPITVDCYASIEYRELIILPFNNYTTLSRHIMDNLSSIFGNENFSKSFKNALELNEYKKLLNCFLYMAIWEKRQVDFLFLFFEEDLRDYVKDSNLYFRNNTCASRLFLDYVFQFASDWLVCSYVGFFETLFLSTDLITSSEPTNDDPASIDNLEQSPP--------QIENEVLLKCLIAALDGIIDNWKKCPITLRQLFNFIQCEIERLHPNFNENKPDNSTDSSNITEPQGGLRYKLLTNLVLFRFFCAVMNSRGERQDDFLRKISENIRKKNFSNFSSFPKTFARHEPLNDFMTKISRLIFQTYSSNKNNKDKIDFFSQIEEYREKTIKTLNDELTRDLSIKEKEAMTQQLESESQTICRLSSLSRRFNEVLEFLTKLQEEPSYFLKLKQDQENIIPCKITKSHVISSELSTIIDEINTKKSCKNNTLIDRL 1020          
The following BLAST results are available for this feature:
BLAST of SMED30023226 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A4S2LLD02.078e-823.95SH2 domain-containing protein OS=Opisthorchis feli... [more]
A0A419PC993.889e-823.53Ras GTPase-activating protein 1 OS=Clonorchis sine... [more]
back to top
BLAST of SMED30023226 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30023226 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000011108.10.000e+099.90SMESG000011108.1[more]
SMESG000011108.10.000e+099.03SMESG000011108.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023226 ID=SMED30023226|Name=SMED30023226|organism=Schmidtea mediterranea sexual|type=transcript|length=3114bp
ATGACTTTAGTTTAAATTCTTTTTTTCATGACATCTATTAATTTTATTGA
TGAAGAAGAGTGTCCAAAACATTCTGATAATCTCAATATACCTGATTTTA
GAGATATTTATCATGGTTGTATGTCTAGAGAAGTTTCATTGAAAACTCTA
AAGGCTAGCGGTGAAAATAATTGTTATTTAATAAGAAAACGAATCAACGC
AGAAGAAGACGAGCACTGTATTGAATATATATTGTCATTTCTAAATGGTG
ACGATGATTATCATTTTAAAATTAAAAAAGAAAATAAGTATTTTATATTT
GCTAATCGATATTTCCCGAGTTTCAAATGCGTTATTTCTCATTACATGCT
GTCGAATATTATCAATGATGCTCATTTGGAATTTGGAGTTGTAAACAAAA
CAATAACAGCGGTTCGGGAGTCTTTGCGAGGACAACTGTGTTATTTGATG
GATAATATATCCAATGAAAGAATTATAGAATTATTACATAAAAACGGCCC
TGGCAGCTATTTGTTCCGTCCACGAACTGATGACAATAATCAATTCGTTC
TCATGTTTTTCGATGGTGCGAAAATCCATAAATTGAAAATGGACGTCCAA
GTATTGGAAAAGAAATCGAACAGTAGTAACAACGAGTTAACCCAACCGGT
TGTCGTGATCGTTTTGGGTAGAAATTTCTTTGAGACCTGGAAGGAAATGG
TCGATAATTTTACTGAAAATCCTATTGTGAAAGTTGACGGACCGAATTGT
CAAGACAAATTAGTCACTGCAGTTGATATTAATGGCAATTCTTCGGAGGG
AGATATTTATCGCAAGATCAAATTTAGTTGCGCGTTACAACAACCTCACA
TGTTCAGTGTACACGGGGAGATAAATGTTTTGGAAGGCTCAAAAAAGAAA
TGGAAATTATGCAATGGTTCCGTTGATAAAGAACATGGCCAACTGATAAT
CAAAAATAATCGAGGACCCACGCAACTTATAGAATTAATTCGATTCAATT
TCATACCCATACATTACTCCGTTTACCAAAAATATTGTTTTCTCCTTGTC
AATAAAGAAGCAAATGGAATGCCGAAAACCTATTACATATCAATTGTTGA
TCCACCTGGCGTCATATGCAATACAGTTGCTTATGACCGTAGAGAATTAT
GCGAAGAAGCTTATGCCTATCGACCTTATAATCTAGTCGAATACGATAAG
GAGGTGTACCACAGTACAGAATCAAACGCTGACAAAGACAGTGATTCTTT
ATTGCGTAGAGCTTACGATCGCTGGAGTGTAGCCGTGAAGAGACATTGTG
CTAATACAAAAGACGATGTGGCTAATGAAGAAAATCCAGAAAGGCATTCG
AAACTTCATCGATATAATAGAAGATTAAAATTGACGATTGGCCACACAGG
TGGTCAAGAAATATCGTTGGTCGACGCCGATGCCAATATTTCACCTCCGC
TCAATTCCTCTCTTTCAGCTAGTCAATCTTCACAACCGCTCCCTGCCAGT
GGACAATTTGAAGTGATGTTAGGTAAATATTTAATAGCAGTAATTCCCAG
AATCAGAGATGGCAGTCCACAAACCTTATTATTTCAAGACCTTCCATCTA
ATCTCAATGACGTTTCTGTAAATATTCGAATCAAAGGCAGTAAGCGGAAA
GAATTTACCAAAGAATTATGTAATTTCACACGCGTGCACCAAGAATTGGT
GCCAAGATCAATAATCAACTCACAGACCTATCAAGAACCAGACCTTACTA
GCTCAACAAATTCATGTCTTGGTCCTCCGTCTATTCAAGCTGATCCACCA
TCATCATGCGGTCCAATCACAGTTGACTGTTATGCTAGTATCGAATATCG
AGAACTGATTATTCTACCATTTAATAATTATACAACTCTCAGTCGACATA
TCATGGATAATCTCAGTTCAATATTCGGAAATGAAAATTTCTCAAAGTCG
TTTAAAAACGCTCTCGAACTGAATGAATATAAAAAGCTCCTTAATTGTTT
TCTCTATATGGCAATCTGGGAAAAGAGACAAGTCGATTTTCTATTTCTGT
TTTTTGAAGAAGATCTAAGGGATTATGTAAAAGACTCGAACTTGTATTTC
AGAAACAACACATGCGCAAGTCGTTTGTTTCTCGATTATGTCTTCCAGTT
TGCCAGTGATTGGCTTGTTTGTTCCTATGTGGGGTTTTTTGAAACTTTGT
TTCTATCCACTGATCTGATAACGAGTTCTGAACCGACAAATGATGATCCA
GCTTCGATCGACAATCTCGAACAGTCACCCCCTCGTAACACATCGTGCAA
GGATAAGAAAATCGAAAACGAAGTTCTTCTGAAATGTTTAATTGCCGCTC
TCGATGGAATTATTGATAATTGGAAAAAATGTCCTATCACACTTAGACAA
CTTTTTAATTTTATACAATGTGAAATCGAACGGTTACATCCTAATTTCAA
TGAAAATAAGCCAGACAATTCAACGGATTCGTCAAATATTACCGAACCTC
AAGGAGGACTTCGTTATAAATTGTTGACCAATCTTGTATTGTTCCGATTT
TTCTGCGCAGTCATGAATTCAAGAGGAGAACGACAGGATGATTTTTTGAG
AAAAATTTCAGAAAATATTCGAAAGAAAAATTTTTCTAATTTTTCTTCTT
TTCCTAAGACATTTGCTAGACAAGAACCGTTGAATGATTTTATGACAAAA
ATTTCCCGGCTCATTTTCCAAACGTATTCCTCCAACAAGAACAACAAAGA
CAAAATTGACTTCTTTAGTCAGATTGAGGAGTACAGAGAGAAAACGATAA
AAACGTTAAATGATGAATTAACGAGAGATCTTTCTATCAAAGAAAAAGAA
GCAATGACTCAGCAGCTTGAAAGTGAATCACAAACCATTTGTCGTCTTTC
TTCACTCAGCAGACGTTTCAATGAAGTCCTGGAATTTCTCACGAAACTGC
AAGAAGAACCGTCATATTTCCTGAAGCTGAAACAAGATCAGGAGAACATC
ATCCCCTGTAAAATCACCAAGAGCCATGTCATCAGTTCAGAGTTAAGCAC
AATTATTGATGAAATTAACACAAAAAAGTCATGTAAGAATAATACTTTGA
TTGATCGGTTATAG
back to top

protein sequence of SMED30023226-orf-1

>SMED30023226-orf-1 ID=SMED30023226-orf-1|Name=SMED30023226-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1029bp
MTSINFIDEEECPKHSDNLNIPDFRDIYHGCMSREVSLKTLKASGENNCY
LIRKRINAEEDEHCIEYILSFLNGDDDYHFKIKKENKYFIFANRYFPSFK
CVISHYMLSNIINDAHLEFGVVNKTITAVRESLRGQLCYLMDNISNERII
ELLHKNGPGSYLFRPRTDDNNQFVLMFFDGAKIHKLKMDVQVLEKKSNSS
NNELTQPVVVIVLGRNFFETWKEMVDNFTENPIVKVDGPNCQDKLVTAVD
INGNSSEGDIYRKIKFSCALQQPHMFSVHGEINVLEGSKKKWKLCNGSVD
KEHGQLIIKNNRGPTQLIELIRFNFIPIHYSVYQKYCFLLVNKEANGMPK
TYYISIVDPPGVICNTVAYDRRELCEEAYAYRPYNLVEYDKEVYHSTESN
ADKDSDSLLRRAYDRWSVAVKRHCANTKDDVANEENPERHSKLHRYNRRL
KLTIGHTGGQEISLVDADANISPPLNSSLSASQSSQPLPASGQFEVMLGK
YLIAVIPRIRDGSPQTLLFQDLPSNLNDVSVNIRIKGSKRKEFTKELCNF
TRVHQELVPRSIINSQTYQEPDLTSSTNSCLGPPSIQADPPSSCGPITVD
CYASIEYRELIILPFNNYTTLSRHIMDNLSSIFGNENFSKSFKNALELNE
YKKLLNCFLYMAIWEKRQVDFLFLFFEEDLRDYVKDSNLYFRNNTCASRL
FLDYVFQFASDWLVCSYVGFFETLFLSTDLITSSEPTNDDPASIDNLEQS
PPRNTSCKDKKIENEVLLKCLIAALDGIIDNWKKCPITLRQLFNFIQCEI
ERLHPNFNENKPDNSTDSSNITEPQGGLRYKLLTNLVLFRFFCAVMNSRG
ERQDDFLRKISENIRKKNFSNFSSFPKTFARQEPLNDFMTKISRLIFQTY
SSNKNNKDKIDFFSQIEEYREKTIKTLNDELTRDLSIKEKEAMTQQLESE
SQTICRLSSLSRRFNEVLEFLTKLQEEPSYFLKLKQDQENIIPCKITKSH
VISSELSTIIDEINTKKSCKNNTLIDRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR000980SH2
IPR001936RasGAP_dom
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0043087regulation of GTPase activity
GO:0007165signal transduction
GO:0043547positive regulation of GTPase activity
GO:0046580negative regulation of Ras protein signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 183..203
NoneNo IPR availableGENE3DG3DSA:1.10.506.10coord: 669..909
e-value: 1.9E-9
score: 39.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 737..753
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 737..756
NoneNo IPR availableCDDcd04519RasGAPcoord: 606..902
e-value: 1.8537E-10
score: 60.5828
IPR000980SH2 domainSMARTSM00252SH2_5coord: 25..112
e-value: 3.3E-5
score: 33.3
coord: 137..234
e-value: 0.064
score: 14.3
IPR000980SH2 domainPFAMPF00017SH2coord: 28..106
e-value: 3.1E-6
score: 27.2
IPR000980SH2 domainPROSITEPS50001SH2coord: 27..106
score: 11.027
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 127..250
e-value: 2.5E-8
score: 35.5
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 25..126
e-value: 2.6E-14
score: 54.9
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 25..121
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 138..233
IPR001936Ras GTPase-activating domainPROSITEPS50018RAS_GTPASE_ACTIV_2coord: 650..881
score: 12.367
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 638..955