Solute carrier family 35 member F6

Overview
NameSolute carrier family 35 member F6
Smed IDSMED30023219
Length (bp)1461
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Solute carrier family 35 member F6 (SMED30023219) t-SNE clustered cells

Violin plots show distribution of expression levels for Solute carrier family 35 member F6 (SMED30023219) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Solute carrier family 35 member F6 (SMED30023219) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Solute carrier family 35 member F6 (SMED30023219) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023219

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30023219SMESG000054692.1 dd_Smed_v4_2053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023219SMESG000054692.1 dd_Smed_v4_2053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Solute carrier family 35 member F6 vs. Ensembl Human
Match: SLC35F6 (solute carrier family 35 member F6 [Source:HGNC Symbol;Acc:HGNC:26055])

HSP 1 Score: 193.741 bits (491), Expect = 1.588e-56
Identity = 135/390 (34.62%), Postives = 220/390 (56.41%), Query Frame = 2
Query:  188 LFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYF----IKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIINEERVDADDSEED 1342
            LF+ G ML+TG+INT+S K   +  A G  G K       H+F  P+LQ + MFLGE  CL  F ++R R   +       S  S   +  +   +F+ P + D+ GTS+  ++L    AS +QM+RG++IIF G+ S+ FL R L L  W G+  T+ GL++VGL+ +L   D   +    + G +L+++  +I A+QMVLEE  + K   HPL+ VG+EG+ G +I  L+++P+ Y       G+  G+ E+ LD   Q+GQ P++ V ++  I SIAF+N+ G+S++K L+A  R ++D+LRT+++W ++L L +       E+F      +QI GF  L+IGT +YN +                 +P+   ++  R  A++SE++
Sbjct:    8 LFLAGLMLVTGSINTLSAKWADNFMAEGCGGSKE------HSFQHPFLQAVGMFLGEFSCLAAFYLLRCRAAGQ-------SDSSVDPQQPFNPLLFLPPALCDMTGTSLMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLGRRLVLSQWLGILATIAGLVVVGLADLLSKHDSQHKLSEVITGDLLIIMAQIIVAIQMVLEEKFVYKHNVHPLRAVGTEGLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVALLGNISSIAFFNFAGISVTKELSATTRMVLDSLRTVVIWALSLALGW-------EAFHA----LQILGFLILLIGTALYNGLH----------------RPLLGRLSRGRPLAEESEQE 357          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Celegans
Match: C29H12.2 (pep chromosome:WBcel235:II:6123809:6125438:1 gene:WBGene00016235.1 transcript:C29H12.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C29H12.2)

HSP 1 Score: 146.747 bits (369), Expect = 3.059e-39
Identity = 110/358 (30.73%), Postives = 194/358 (54.19%), Query Frame = 2
Query:  203 MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAII---------RRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYF-----IKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVM 1234
            M++TG++NTI  K            W +S +++   FN P+LQ   MF GE +CL+ F +I         R   Q +   +   + E   T   +  ++F  P + D+LGTS+  I L    AS +QM+RG++IIF G+LS+  L   +  F W GM F ++GL++VG++ +    DP  +    + G +L+++  +I A+QMV E+  L K     L  VG EG+ G +   ++++P  Y         +  G  E+V     +I + P + + +   ++SIAF+N+ G+S++K L+A  R ++D++RT+++W V++ L++       E F      +Q+ GFA L++GT++YN ++
Sbjct:   12 MVVTGSLNTICAK------------WADSIKADGVPFNHPFLQATCMFFGEFLCLVVFFLIFGYKRYVWNRANVQGESGSVTEITSEEKPTLPPFNPFLFFPPALCDILGTSIMYIGLNLTTASSFQMLRGAVIIFTGLLSVGMLNAQIKPFKWFGMLFVMLGLVIVGVTDIYYDDDPLDDKNAIITGNLLIVMAQIIVAIQMVYEQKYLTKYDVPALFAVGLEGLFGMVTLSILMIPFYYIHVPRTFSTNPEGRLEDVFYAWKEITEEPTIALALSGTVVSIAFFNFAGVSVTKELSATTRMVLDSVRTLVIWVVSIPLFH-------EKFIA----IQLSGFAMLILGTLIYNDIL 346          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Celegans
Match: C29H12.2 (pep chromosome:WBcel235:II:6123815:6125424:1 gene:WBGene00016235.1 transcript:C29H12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C29H12.2)

HSP 1 Score: 146.747 bits (369), Expect = 3.059e-39
Identity = 110/358 (30.73%), Postives = 194/358 (54.19%), Query Frame = 2
Query:  203 MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAII---------RRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYF-----IKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVM 1234
            M++TG++NTI  K            W +S +++   FN P+LQ   MF GE +CL+ F +I         R   Q +   +   + E   T   +  ++F  P + D+LGTS+  I L    AS +QM+RG++IIF G+LS+  L   +  F W GM F ++GL++VG++ +    DP  +    + G +L+++  +I A+QMV E+  L K     L  VG EG+ G +   ++++P  Y         +  G  E+V     +I + P + + +   ++SIAF+N+ G+S++K L+A  R ++D++RT+++W V++ L++       E F      +Q+ GFA L++GT++YN ++
Sbjct:   12 MVVTGSLNTICAK------------WADSIKADGVPFNHPFLQATCMFFGEFLCLVVFFLIFGYKRYVWNRANVQGESGSVTEITSEEKPTLPPFNPFLFFPPALCDILGTSIMYIGLNLTTASSFQMLRGAVIIFTGLLSVGMLNAQIKPFKWFGMLFVMLGLVIVGVTDIYYDDDPLDDKNAIITGNLLIVMAQIIVAIQMVYEQKYLTKYDVPALFAVGLEGLFGMVTLSILMIPFYYIHVPRTFSTNPEGRLEDVFYAWKEITEEPTIALALSGTVVSIAFFNFAGVSVTKELSATTRMVLDSVRTLVIWVVSIPLFH-------EKFIA----IQLSGFAMLILGTLIYNDIL 346          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Fly
Match: Tango9 (gene:FBgn0260744 transcript:FBtr0082508)

HSP 1 Score: 100.138 bits (248), Expect = 1.127e-22
Identity = 95/360 (26.39%), Postives = 170/360 (47.22%), Query Frame = 2
Query:  206 LLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNS--YLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKD------PGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVV-----LPILYFIKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNF 1246
            +L+GT N +  K     + IG       S+ ++H F  P + TL MFLGE +C   F +IR    ++     +   +S L+++S  +     ++PT+ D   + +    L    A+ +QM+RG+ +IFVGI S +FL   L   HW  + FT+   LL  +S  +   +      P ++  + + G +L+++  ++  +Q V EE  LK     PLQ  G +GI G  IT ++      LP +          +++  D    +  +  L++ +I + IS A YN+ GL I+   ++ +R L D LR   +W   + + +               L+ I GF  L +G ++Y + + L++
Sbjct:   12 VLSGTFNVLVVKWANQQQVIG-------SDGKLHGFQHPVVFTLLMFLGEFLCFAVFKVIRLISNRRGV---ISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAI-FTISCGLLDIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIFGLGITSMLAICMNFLPSIDPFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTISCAMYNFIGLYIAMYSSSANRLLADGLRVYFIWVFVIIMEWEYMN-----------LVTIMGFLILQMGIILYRQALFLDW 349          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Fly
Match: Tango9 (gene:FBgn0260744 transcript:FBtr0347147)

HSP 1 Score: 100.138 bits (248), Expect = 1.127e-22
Identity = 95/360 (26.39%), Postives = 170/360 (47.22%), Query Frame = 2
Query:  206 LLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNS--YLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKD------PGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVV-----LPILYFIKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNF 1246
            +L+GT N +  K     + IG       S+ ++H F  P + TL MFLGE +C   F +IR    ++     +   +S L+++S  +     ++PT+ D   + +    L    A+ +QM+RG+ +IFVGI S +FL   L   HW  + FT+   LL  +S  +   +      P ++  + + G +L+++  ++  +Q V EE  LK     PLQ  G +GI G  IT ++      LP +          +++  D    +  +  L++ +I + IS A YN+ GL I+   ++ +R L D LR   +W   + + +               L+ I GF  L +G ++Y + + L++
Sbjct:   12 VLSGTFNVLVVKWANQQQVIG-------SDGKLHGFQHPVVFTLLMFLGEFLCFAVFKVIRLISNRRGV---ISDLDSILSQDSSEFRPVSMLLPTLLDAAASILLFTGLYLTYATSFQMIRGAALIFVGIFSTMFLNHTLTGRHWLAI-FTISCGLLDIISLDVHRVEYDLVTLPYTDYKSILTGDLLIIIAEILHGLQYVCEEKQLKTSNVAPLQAAGWQGIFGLGITSMLAICMNFLPSIDPFSCSSRAVFDDWGDLFAALQGSISLIMTLIAFTISCAMYNFIGLYIAMYSSSANRLLADGLRVYFIWVFVIIMEWEYMN-----------LVTIMGFLILQMGIILYRQALFLDW 349          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Zebrafish
Match: slc35f6 (solute carrier family 35 member F6 [Source:ZFIN;Acc:ZDB-GENE-040718-297])

HSP 1 Score: 182.185 bits (461), Expect = 2.524e-52
Identity = 134/395 (33.92%), Postives = 226/395 (57.22%), Query Frame = 2
Query:  188 LFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTR-NSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXS-LISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGH--DNGS--YENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMN--LNFIPFCYVEDQTPIKPVDNIINEERVDADDSEEDD 1345
            LF+ G ML TG++NT+S K      A G  G      S  H+F+ P++Q + MFLGE  CL+ F I+    +++        PE ++    S+   +F+ P + D+LGTS+  ++L    AS +QM+RG++IIF G+LS+ FL R L    W G+  T++GL++VGL+  +      S   ++++   L+++ + +I A+QMVLEE  + K   HPL+ VG+EG+ G +I  L+++P+ +   G   DN     E+ LD   QIG  P++L+ ++   +SIAF+N+ G+S++K ++A  R ++D+LRT+++W V+L L +       E F      +QI GF  L++GT MYN +    +  +P C+  +Q  I    N+   ER+   +  E++
Sbjct:    8 LFLAGLMLTTGSLNTLSAKWADMFSAPGCHG------SPDHDFSHPFVQAVGMFLGELSCLVVFYILLCHDRRR--------PEPTMDPGESFNPLVFLPPALCDMLGTSIMYVALNMTSASSFQMLRGAVIIFTGLLSVAFLGRRLKPSQWFGILITILGLVVVGLADFVSGHGDDSHKLSEIITGDLLIIMAQIIVAVQMVLEEKFVYKHNVHPLKAVGTEGVFGFVILSLLLIPMFFIHVGSFADNPRQVLEDTLDAFCQIGHKPLILLALLGNTVSIAFFNFAGISVTKEISATTRMVLDSLRTLVIWVVSLALGW-------EKFQG----LQILGFIILLLGTAMYNGLHKPLMAKMP-CFAREQ--ITEEGNVPERERLLGGEKAEEN 374          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Zebrafish
Match: slc35f6 (solute carrier family 35 member F6 [Source:ZFIN;Acc:ZDB-GENE-040718-297])

HSP 1 Score: 182.185 bits (461), Expect = 2.524e-52
Identity = 134/395 (33.92%), Postives = 226/395 (57.22%), Query Frame = 2
Query:  188 LFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTR-NSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXS-LISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGH--DNGS--YENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMN--LNFIPFCYVEDQTPIKPVDNIINEERVDADDSEEDD 1345
            LF+ G ML TG++NT+S K      A G  G      S  H+F+ P++Q + MFLGE  CL+ F I+    +++        PE ++    S+   +F+ P + D+LGTS+  ++L    AS +QM+RG++IIF G+LS+ FL R L    W G+  T++GL++VGL+  +      S   ++++   L+++ + +I A+QMVLEE  + K   HPL+ VG+EG+ G +I  L+++P+ +   G   DN     E+ LD   QIG  P++L+ ++   +SIAF+N+ G+S++K ++A  R ++D+LRT+++W V+L L +       E F      +QI GF  L++GT MYN +    +  +P C+  +Q  I    N+   ER+   +  E++
Sbjct:    8 LFLAGLMLTTGSLNTLSAKWADMFSAPGCHG------SPDHDFSHPFVQAVGMFLGELSCLVVFYILLCHDRRR--------PEPTMDPGESFNPLVFLPPALCDMLGTSIMYVALNMTSASSFQMLRGAVIIFTGLLSVAFLGRRLKPSQWFGILITILGLVVVGLADFVSGHGDDSHKLSEIITGDLLIIMAQIIVAVQMVLEEKFVYKHNVHPLKAVGTEGVFGFVILSLLLIPMFFIHVGSFADNPRQVLEDTLDAFCQIGHKPLILLALLGNTVSIAFFNFAGISVTKEISATTRMVLDSLRTLVIWVVSLALGW-------EKFQG----LQILGFIILLLGTAMYNGLHKPLMAKMP-CFAREQ--ITEEGNVPERERLLGGEKAEEN 374          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Mouse
Match: Slc35f6 (solute carrier family 35, member F6 [Source:MGI Symbol;Acc:MGI:1922169])

HSP 1 Score: 172.94 bits (437), Expect = 6.840e-49
Identity = 123/351 (35.04%), Postives = 202/351 (57.55%), Query Frame = 2
Query:  188 LFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYF----IKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYN 1225
            LF+ G ML+TG+INT+S K   +  A G  G      S+ H+F  P++Q + MFLGE  CL  F +++ + +++       S  S   +  + + +F+ P + D+ GTS+  ++L    AS +QM+RG++IIF G+ S+ FL R L    W G+  T+ GL++VGL+ +L   D   +    + G +L+++  +I A+QMVLEE  + K   HPLQ VG EG  G +I  L+++P+ Y       G+  G  E+ LD   Q+G+ P++ + ++  I SIAF+N+ G+S++K L+A  R ++D LRTI++W   L L + +           +  +QI GF  L++GT +YN
Sbjct:    8 LFLAGLMLVTGSINTLSAKWADNFVAEGCGG------SQEHSFKHPFVQAVGMFLGEFSCLAAFYLLKCQGRRQ-------SASSVEPQQPFNTLLFLPPALCDMTGTSIMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLDRRLAPSQWLGILITIAGLVVVGLADLLSKHDSQHKLSEVITGDLLIIMAQIIIAIQMVLEEKFVYKHNIHPLQAVGIEGFFGFVILSLLLVPMFYIPTASFSGNPRGVLEDALDAFCQVGRQPLIALALLGNISSIAFFNFSGISVTKELSATTRMVLDTLRTIVIWAFTLALGWEI-----------FYPLQILGFLILLMGTALYN 334          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Mouse
Match: Slc35f6 (solute carrier family 35, member F6 [Source:MGI Symbol;Acc:MGI:1922169])

HSP 1 Score: 147.517 bits (371), Expect = 6.373e-40
Identity = 103/299 (34.45%), Postives = 172/299 (57.53%), Query Frame = 2
Query:  341 MFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYF----IKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYN 1225
            MFLGE  CL  F +++ + +++       S  S   +  + + +F+ P + D+ GTS+  ++L    AS +QM+RG++IIF G+ S+ FL R L    W G+  T+ GL++VGL+ +L   D   +    + G +L+++  +I A+QMVLEE  + K   HPLQ VG EG  G +I  L+++P+ Y       G+  G  E+ LD   Q+G+ P++ + ++  I SIAF+N+ G+S++K L+A  R ++D LRTI++W   L L + +           +  +QI GF  L++GT +YN
Sbjct:    1 MFLGEFSCLAAFYLLKCQGRRQ-------SASSVEPQQPFNTLLFLPPALCDMTGTSIMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLDRRLAPSQWLGILITIAGLVVVGLADLLSKHDSQHKLSEVITGDLLIIMAQIIIAIQMVLEEKFVYKHNIHPLQAVGIEGFFGFVILSLLLVPMFYIPTASFSGNPRGVLEDALDAFCQVGRQPLIALALLGNISSIAFFNFSGISVTKELSATTRMVLDTLRTIVIWAFTLALGWEI-----------FYPLQILGFLILLMGTALYN 281          
BLAST of Solute carrier family 35 member F6 vs. UniProt/SwissProt
Match: sp|Q8N357|S35F6_HUMAN (Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 7.625e-56
Identity = 135/390 (34.62%), Postives = 220/390 (56.41%), Query Frame = 2
Query:  188 LFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYF----IKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIINEERVDADDSEED 1342
            LF+ G ML+TG+INT+S K   +  A G  G K       H+F  P+LQ + MFLGE  CL  F ++R R   +       S  S   +  +   +F+ P + D+ GTS+  ++L    AS +QM+RG++IIF G+ S+ FL R L L  W G+  T+ GL++VGL+ +L   D   +    + G +L+++  +I A+QMVLEE  + K   HPL+ VG+EG+ G +I  L+++P+ Y       G+  G+ E+ LD   Q+GQ P++ V ++  I SIAF+N+ G+S++K L+A  R ++D+LRT+++W ++L L +       E+F      +QI GF  L+IGT +YN +                 +P+   ++  R  A++SE++
Sbjct:    8 LFLAGLMLVTGSINTLSAKWADNFMAEGCGGSKE------HSFQHPFLQAVGMFLGEFSCLAAFYLLRCRAAGQ-------SDSSVDPQQPFNPLLFLPPALCDMTGTSLMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLGRRLVLSQWLGILATIAGLVVVGLADLLSKHDSQHKLSEVITGDLLIIMAQIIVAIQMVLEEKFVYKHNVHPLRAVGTEGLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVALLGNISSIAFFNFAGISVTKELSATTRMVLDSLRTVVIWALSLALGW-------EAFHA----LQILGFLILLIGTALYNGLH----------------RPLLGRLSRGRPLAEESEQE 357          
BLAST of Solute carrier family 35 member F6 vs. UniProt/SwissProt
Match: sp|Q5RFT1|S35F6_PONAB (Solute carrier family 35 member F6 OS=Pongo abelii OX=9601 GN=SLC35F6 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.125e-55
Identity = 134/393 (34.10%), Postives = 221/393 (56.23%), Query Frame = 2
Query:  179 RDYLFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYF----IKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIINEERVDADDSEED 1342
            +  LF+ G ML+TG+INT+S K   +  A G  G K       H+F  P+LQ + MFLGE  CL  F ++R R   +       S  S   +  +   +F+ P + D+ GTS+  ++L    AS +QM+RG++IIF G+ S+ FL R L L  W G+  T+ GL++VGL+ +L   D   +    + G +L+++  +I A+QMVLEE  + K   HPL+ VG+EG+ G +I  L+++P+ Y       G+  G+ E+ LD   Q+G+ P++ V ++  I SIAF+N+ G+S++K L+A  R ++D+LRT+++W ++L L +       E+F      +QI GF  L+IGT +YN +                 +P+   ++  R  A++SE++
Sbjct:    5 KHQLFLAGLMLVTGSINTLSAKWADNFMAEGCGGSKE------HSFQHPFLQAVGMFLGEFSCLAAFYLLRCRATGQ-------SDSSVDPQQPFNPLLFLPPALCDMTGTSLMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLGRRLVLSQWLGILATIAGLVVVGLADLLSKHDSQHKLSEVITGDLLIIMAQIIVAIQMVLEEKFVYKHNVHPLRAVGTEGLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGRQPLIAVALLGNISSIAFFNFAGISVTKELSATTRMVLDSLRTVVIWALSLALGW-------EAFHA----LQILGFLILLIGTALYNGLH----------------RPLLGRLSRGRPPAEESEQE 357          
BLAST of Solute carrier family 35 member F6 vs. UniProt/SwissProt
Match: sp|Q5RKH7|S35F6_RAT (Solute carrier family 35 member F6 OS=Rattus norvegicus OX=10116 GN=Slc35f6 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 7.927e-50
Identity = 125/351 (35.61%), Postives = 203/351 (57.83%), Query Frame = 2
Query:  188 LFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYF----IKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYN 1225
            LF+ G ML+TG+INT+S K   + +A G  G      S+ H+F  P++Q + MFLGE  CL  F +++ R +++       S  S   R  + + +F+ P + D+ GTS+  ++L    AS +QM+RG++IIF G+ S+ FL R L    W G+  T+ GL++VGL+ +L   D   +    + G +L+++  +I A+QMVLEE  + K   HPLQ VG EG  G +I  L+++P+ Y       G+  G  E+ LD   Q+G+ P++ + ++  I SIAF+N+ G+S++K L+A  R ++D LRT+++W   L L + V           +  +QI GF  L++GT +YN
Sbjct:    8 LFLAGLMLVTGSINTLSAKWADNFEAEGCGG------SQEHSFKHPFVQAVGMFLGEFSCLAAFYLLKCRARRQ-------SDSSVEPRQPFNALLFLPPALCDMTGTSIMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLDRRLVPSQWLGILITIAGLVVVGLADLLSKHDSQHKLSEVITGDLLIIMAQIIIAIQMVLEEKFVYKHNIHPLQAVGIEGFFGFVILSLLLVPMYYIPTASFSGNPRGVLEDALDAFCQVGRQPLIALALLGNISSIAFFNFSGISVTKELSATTRMVLDTLRTVVIWAFTLALGWEV-----------FHPLQILGFLILLMGTALYN 334          
BLAST of Solute carrier family 35 member F6 vs. UniProt/SwissProt
Match: sp|Q8VE96|S35F6_MOUSE (Solute carrier family 35 member F6 OS=Mus musculus OX=10090 GN=Slc35f6 PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 4.785e-48
Identity = 123/351 (35.04%), Postives = 202/351 (57.55%), Query Frame = 2
Query:  188 LFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYF----IKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYN 1225
            LF+ G ML+TG+INT+S K   +  A G  G      S+ H+F  P++Q + MFLGE  CL  F +++ + +++       S  S   +  + + +F+ P + D+ GTS+  ++L    AS +QM+RG++IIF G+ S+ FL R L    W G+  T+ GL++VGL+ +L   D   +    + G +L+++  +I A+QMVLEE  + K   HPLQ VG EG  G +I  L+++P+ Y       G+  G  E+ LD   Q+G+ P++ + ++  I SIAF+N+ G+S++K L+A  R ++D LRTI++W   L L + +           +  +QI GF  L++GT +YN
Sbjct:    8 LFLAGLMLVTGSINTLSAKWADNFVAEGCGG------SQEHSFKHPFVQAVGMFLGEFSCLAAFYLLKCQGRRQ-------SASSVEPQQPFNTLLFLPPALCDMTGTSIMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLDRRLAPSQWLGILITIAGLVVVGLADLLSKHDSQHKLSEVITGDLLIIMAQIIIAIQMVLEEKFVYKHNIHPLQAVGIEGFFGFVILSLLLVPMFYIPTASFSGNPRGVLEDALDAFCQVGRQPLIALALLGNISSIAFFNFSGISVTKELSATTRMVLDTLRTIVIWAFTLALGWEI-----------FYPLQILGFLILLMGTALYN 334          
BLAST of Solute carrier family 35 member F6 vs. UniProt/SwissProt
Match: sp|Q09875|YAGC_SCHPO (Uncharacterized protein C12G12.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12G12.12 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.074e-21
Identity = 111/350 (31.71%), Postives = 168/350 (48.00%), Query Frame = 2
Query:  203 MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPES-SLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHDNGSYENVLDG---ILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFG-ESFDTTYGLMQIDGFAFLMIGTMMYNRVMN 1237
            ML +G  NT+  K Q D  A          ESE    +   LQ+L +FLGE+ CL  + + +R  Q      G +S +   L    +++    +P I D+ G+++  + LL   AS++QM RGSLIIFV + +   LKR +    W  +SF V+G+ +VG SG   +        N +LG+  VL+G    A Q  +EE +L      P ++V  EG  G     L ++   YFI G     Y    D    I +  + P L V   + ++SIAF+N  GL+I+K  +A  R+L+D  RT  +W         +A   G ESF     L+Q  GF  L+ G   Y+ ++ 
Sbjct:    7 MLTSGVANTVLSKYQ-DSIA---------EESEPIK-SMAVLQSLNIFLGEA-CLWFYVLYKRHSQGP----GYESLDHLPLKHKVFMA----LPAIMDICGSTLMNVGLLYTSASIYQMTRGSLIIFVALFATTLLKRTIGQLQWLSLSFVVLGVAIVGYSGSSSSI-----GSNPILGITAVLIGQFFLATQFTIEEYILSFIQVDPSELVAYEGTYGVFFVLLGMIISYYFI-GSTTAGYHGWFDYSHVISRFNEVPALYVISGVILVSIAFFNVSGLAITKLHSATTRSLLDIARTFGIW--------IIAMAMGMESFH----LLQFLGFVLLIYGIFTYHSIIK 318          
BLAST of Solute carrier family 35 member F6 vs. TrEMBL
Match: A0A4E0RAQ1 (Solute carrier family 35 member F6 OS=Fasciola hepatica OX=6192 GN=D915_005976 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 1.731e-125
Identity = 211/399 (52.88%), Postives = 275/399 (68.92%), Query Frame = 2
Query:  164 MGLKLRDYLFMCGMLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGL-----KSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHD-NGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFC--YVEDQTPIKPVDNIINEERVDADDSE 1336
            MG   +  + + GMLLTGTINT+SKK+QLDC ++G   +  ++    H FNKPW QTL MFLGE++CL GF IIR +K+++  +        +S    +      +W F+IP   DLLGT++AGI LL +DAS+WQMMRGSLIIF GILS+IFLKR L  +HWTGM FTV+GL LVG   V              LGV LVLVG+  SA QM++EE  +K RGFHPLQ VG EG+ G+L+  ++ LP ++FI G D NGS+ENVLD + QIG N +LLVN ILYI+SIAF+NYFGLSI++ L+AVHRTLIDA+RT  VW V+L LYY+   +FGE F+  +GL+QIDGFA L+IGT++YN+VM+L+FI  C    ED+   KP+  +  +E   AD  E
Sbjct:    1 MGFTPKQLVLIFGMLLTGTINTVSKKLQLDCSSVGYFNYSANNTQTEHKFNKPWFQTLLMFLGETLCLFGFFIIRFKKRRRLERESAYREIDESERGGILNTPLFNWFFLIPAFCDLLGTTIAGIGLLFVDASIWQMMRGSLIIFAGILSIIFLKRRLRGYHWTGMCFTVVGLALVGTKSVFSGHSLDHSGAQSALGVALVLVGAFTSACQMIVEEVFIKNRGFHPLQAVGMEGLFGSLMMIVIALPAVHFIPGSDLNGSFENVLDALYQIGNNTLLLVNCILYILSIAFFNYFGLSITRYLSAVHRTLIDAMRTTFVWLVSLILYYSTNAQFGEPFEPAWGLIQIDGFACLIIGTLIYNKVMDLSFIRGCGDPPEDE---KPILTVTADEPGVADGGE 396          
BLAST of Solute carrier family 35 member F6 vs. TrEMBL
Match: A0A4V3SGS2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001552 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 4.430e-125
Identity = 202/402 (50.25%), Postives = 271/402 (67.41%), Query Frame = 2
Query:  164 MGLKLRDYLFMCGMLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLK------SPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHD-NGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIINEERVDADDSEEDDE 1348
            MG   +  + + GML+TGTINT+SKK+QLDC A G      +     H FNKPW QTL MFLGES+CL GF ++R RK+++    GL+           +      +W F++P   DLLGT++AGI LL +DAS+WQMMRGSLIIF GILS+IFLKR L+++HW GM  TV+GL LVG   V              +G+ LVL G+  +A QM++EE  LK+RGFHPLQ VG EG+ G+L+   + LP ++FI G+D NGSYENVLD + Q+  +P+LLVN ILYI+SIA +NYFGLSI++ L+AVHRTLIDALRT LVW ++L LYY+ + RFGE FD ++GL+QIDGFA L+IGT++YN+VM+++FIP C   D       ++   E   +  D +   +
Sbjct:    1 MGFTSKQLVLIFGMLITGTINTVSKKLQLDCTAFGYYNHSANYTRTEHAFNKPWFQTLLMFLGESLCLFGFFVVRYRKRRQLENDGLRRQLLVDPTRPGIADTPLFNWYFLLPASCDLLGTTLAGIGLLFVDASIWQMMRGSLIIFAGILSIIFLKRKLYVYHWFGMLCTVVGLALVGTKSVFSGHSLSHTGAQSAIGIGLVLAGAFTTACQMIVEEVFLKRRGFHPLQAVGMEGVFGSLMMICIALPAVHFIPGNDLNGSYENVLDALYQLVDSPLLLVNCILYILSIALFNYFGLSITRYLSAVHRTLIDALRTTLVWCISLLLYYSTSGRFGELFDVSWGLIQIDGFACLIIGTLIYNKVMDVSFIPCCAEPDSVGEPEFNSEFTETSQEQPDEQRTSQ 402          
BLAST of Solute carrier family 35 member F6 vs. TrEMBL
Match: A0A504YP65 (Solute carrier family 35 member F6 OS=Fasciola gigantica OX=46835 GN=FGIG_07166 PE=4 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 5.179e-124
Identity = 210/399 (52.63%), Postives = 274/399 (68.67%), Query Frame = 2
Query:  164 MGLKLRDYLFMCGMLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGL-----KSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHD-NGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFC--YVEDQTPIKPVDNIINEERVDADDSE 1336
            MG   +  + + GMLLTGTINT+SKK+QLDC ++G   +  ++    H FNKPW QTL MFLGE++CL GF IIR +K+++  +        +S    +      +W F++P   DLLGT++AGI LL +DAS+WQMMRGSLIIF GILS+IFLKR L  +HWTGM FTV+GL LVG   V              LGV LVLVG+  SA QM++EE  +K RGFHPLQ VG EG+ G+L+  +V LP ++FI G D NGS+ENVLD + QI  N +LLVN ILYI+SIAF+NYFGLSI++ L+AVHRTLIDA+RT  VW V+L LYY+   +FGE F+  +GL+QIDGFA L+IGT++YN+VM+L+FI  C    ED+   KP+  +  +E   AD  E
Sbjct:    1 MGFTPKQLVLIFGMLLTGTINTVSKKLQLDCSSVGYFNYSANNTQTEHKFNKPWFQTLLMFLGETLCLFGFFIIRFKKRRRLERESAYREIDESERGGILNTPLFNWFFLLPAFCDLLGTTIAGIGLLFVDASIWQMMRGSLIIFAGILSIIFLKRRLRGYHWTGMCFTVVGLALVGTKSVFSGHSLDHSGAQSALGVALVLVGAFTSACQMIVEEVFIKNRGFHPLQAVGMEGLFGSLMMIVVALPAVHFIPGSDLNGSFENVLDALYQIVNNTLLLVNCILYILSIAFFNYFGLSITRYLSAVHRTLIDAMRTTFVWLVSLILYYSTNAQFGEPFEPAWGLIQIDGFACLIIGTLIYNKVMDLSFIRGCGDPPEDE---KPILTVTADEPGVADGGE 396          
BLAST of Solute carrier family 35 member F6 vs. TrEMBL
Match: A0A3R7C5E4 (Solute carrier family 35 member F6 OS=Clonorchis sinensis OX=79923 GN=SLC35F6 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 2.306e-122
Identity = 203/402 (50.50%), Postives = 272/402 (67.66%), Query Frame = 2
Query:  164 MGLKLRDYLFMCGMLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLK------SPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHD-NGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIINEERVDADDSEEDDE 1348
            MG   +  + + GML+TGTINT+SKKVQLDC A G      +     H FNKPW QTL MFLGE +CL GF +IR RK+++    GL+           +      +W F++P   DLLGT++AGI LL +DAS+WQMMRGSLIIF G+LS+IFLKR L+++HW GM  TV+GL LVG   V              +G+ LVL G+  +A QM++EE  LK+RGFHPLQ VG EG+ G+L+   + LP ++FI G+D NGSYENVLD + Q+  +P+LLVN ILYI+SIA +NYFGLSI++ L+AVHRTLIDALRT LVW ++L LYY+ + RFGESFD ++GL+QIDGFA L+IGT++YN+VM+++FIP C   D       ++ + E   +  D +   +
Sbjct:  246 MGFTSKQLVLIFGMLITGTINTVSKKVQLDCTAFGYYNHSANDTRTEHAFNKPWFQTLLMFLGEFLCLFGFFVIRYRKRRRLENDGLRHQLLVDPTRPGIVDIPLFNWYFLLPASCDLLGTTLAGIGLLFVDASIWQMMRGSLIIFAGLLSVIFLKRKLYVYHWFGMLCTVVGLALVGTKSVFSGHSLSHTGAQSAIGIGLVLAGAFTTACQMIVEEVFLKRRGFHPLQAVGMEGVFGSLMMICIALPAVHFIPGNDLNGSYENVLDALYQVVDSPLLLVNCILYILSIALFNYFGLSITRYLSAVHRTLIDALRTTLVWCISLLLYYSTSGRFGESFDVSWGLIQIDGFACLIIGTLVYNKVMDVSFIPCCAEPDSIGEPEFNSEVTETSQEQADEQRTSQ 647          
BLAST of Solute carrier family 35 member F6 vs. TrEMBL
Match: A0A210PQ39 (Solute carrier family 35 member F6 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09937 PE=4 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.010e-120
Identity = 204/402 (50.75%), Postives = 276/402 (68.66%), Query Frame = 2
Query:  158 KEMGLKLRDYLFMCGMLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHD-NGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVE--DQTPIKPVDNIINEERVDADDSEEDDENK 1354
            K M L  R  L M GML+TG+INT+SKK Q DC+A G    K +  +  H+FN PW QTL MF+GE+ICLIGF ++R+R + +       +       N  +  +   PT+ DL+GTS+AGI L+ +DASVWQM+RGS+IIF GILS IFLKR L    WTGM FT+ GL+LVG S + K        GN +LG++L++   ++SA QM++EE  LKK+  HPLQVVG EG  G +   ++VLP +Y+I G D N SYEN LD + QI  +  LLV  +LY++SIAFYNYFGL+++K+LTAVHRTLIDA RTI+VWG++LF+YYA  K FGE FD TYGL+Q+DGF FL+IGT +YN +++L++IP C      Q+  +P+++  N +  +A DSE +DE K
Sbjct:    3 KNMALSCRQILLMIGMLVTGSINTLSKKAQNDCRAPGYPDHKANGTTSPHDFNHPWFQTLIMFIGETICLIGFCVVRKRDRDRWRAESHINAAEMPHPNRLIQLVVAFPTVCDLVGTSLAGIGLVYVDASVWQMLRGSIIIFAGILSRIFLKRQLGCIKWTGMFFTMGGLVLVGCSSIFKADSSNRNAGNTILGIILIISSQIVSASQMIIEETFLKKKSLHPLQVVGLEGSYGVIFMSVIVLPAMYYIPGSDVNNSYENSLDALYQIANDSRLLVFCLLYLLSIAFYNYFGLAVTKSLTAVHRTLIDACRTIIVWGIDLFVYYAFDKGFGEPFDKTYGLLQVDGFLFLLIGTALYNNLVDLSWIP-CLRSCVSQSTTQPLNHQGNIQ--EASDSESEDEYK 401          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Cavefish
Match: slc35f6 (solute carrier family 35 member F6 [Source:NCBI gene;Acc:103035088])

HSP 1 Score: 171.785 bits (434), Expect = 1.765e-48
Identity = 135/395 (34.18%), Postives = 221/395 (55.95%), Query Frame = 2
Query:  188 LFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTR-NSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKG--HDNGS--YENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMN--LNFIPFCYVEDQTPIKPVDNIINEERVDADDSEEDDE 1348
            LF+ G ML TG++NT+S K   D  + G  G  +  E     F+ P+LQ + MFLGE  CL  F ++    ++K        PE ++    S+   +F+ P + D+ GTS+  ++L    AS +QM+RG++IIF G+LS+ FL R L    W G+  T++GL++VGL+  +       +    + G +L+++  +I ++QMVLEE  + K   HPL+ VG+EG  G +I  L+++P+ Y       DN     E+ LD   QIG NPV+LV ++   +SIAF+N+ G+S++K ++A  R ++D+LRT+++W V+L L +       E F   +GL QI GF  L++GT +YN +    +  +P C+   Q   + V + +  ER+       +D 
Sbjct:    8 LFLAGLMLTTGSLNTLSAKWA-DMFSAG--GCHDPKE---RPFSHPFLQAVCMFLGELSCLAVFYMLLCHDRRK--------PEPTMEPGQSFNPLLFLPPALCDMTGTSIMYVALNMTSASSFQMLRGAVIIFTGLLSVAFLGRRLLASQWLGILITIVGLIVVGLADFVSGNKDSHKLSEVITGDLLIIMAQIIVSVQMVLEEKFVYKHNVHPLKAVGTEGFFGFVILSLLLIPMYYIPASGFSDNPRQVLEDALDAFCQIGHNPVILVALLGNTVSIAFFNFAGISVTKEISATTRMVLDSLRTLVIWVVSLALGW-------EQF---HGL-QILGFIILLLGTALYNGLHKPLMARLP-CWAGAQG--EDVGDSVERERLLGGGRTAEDS 374          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Medaka
Match: slc35f6 (solute carrier family 35 member F6 [Source:NCBI gene;Acc:101167415])

HSP 1 Score: 159.073 bits (401), Expect = 1.117e-43
Identity = 112/322 (34.78%), Postives = 190/322 (59.01%), Query Frame = 2
Query:  188 LFMCG-MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTR-NSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXK-TKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHDNGSY--------ENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFL 1120
            LF+ G ML TG+INT+S K         +   K   +   H+F+ P++Q + MFLGE  CL+ F I+    + +        PE  +    S+   +F  P + D++ TS+  ++L    AS +QM+RGS+IIF G+LS+ FL R L    W G+  T++GL++VGL+  +   +D   +  + + G +L+++  +I ++QMVLEE  + K   HPL+ VG+EG+ G ++  L+++P +YFI     GS+        E+ LD   QIG  P++L+ ++   +SIAF+N+ G+S++K ++A  R ++D+LRT+++W V+L L
Sbjct:    8 LFLAGLMLTTGSINTLSAKWA------DLFSAKGCHDDPEHDFSHPFVQAVGMFLGEFSCLVVFYILLFHDKSR--------PEPRMNPGQSFNPLLFFPPAMCDMMATSIMYVALNMTSASSFQMLRGSVIIFTGLLSVAFLGRRLLPSQWFGICVTILGLVVVGLADFISGHRDDTHKLSDVITGDLLIIMAQIIVSVQMVLEEKFVYKHDVHPLRAVGTEGLFGFVVLSLLLIP-MYFIH---VGSFSNTPRQVLEDALDAFCQIGHKPLILLALLGNTVSIAFFNFAGISVTKEISATTRMVLDSLRTLVIWVVSLAL 311          
BLAST of Solute carrier family 35 member F6 vs. Ensembl Medaka
Match: slc35f6 (solute carrier family 35 member F6 [Source:NCBI gene;Acc:101167415])

HSP 1 Score: 150.214 bits (378), Expect = 1.416e-40
Identity = 103/305 (33.77%), Postives = 179/305 (58.69%), Query Frame = 2
Query:  236 KKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTR-NSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXK-TKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHDNGSY--------ENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFL 1120
            K V L  +   +   K   +   H+F+ P++Q + MFLGE  CL+ F I+    + +        PE  +    S+   +F  P + D++ TS+  ++L    AS +QM+RGS+IIF G+LS+ FL R L    W G+  T++GL++VGL+  +   +D   +  + + G +L+++  +I ++QMVLEE  + K   HPL+ VG+EG+ G ++  L+++P +YFI     GS+        E+ LD   QIG  P++L+ ++   +SIAF+N+ G+S++K ++A  R ++D+LRT+++W V+L L
Sbjct:    6 KNVFLSDRWADLFSAKGCHDDPEHDFSHPFVQAVGMFLGEFSCLVVFYILLFHDKSR--------PEPRMNPGQSFNPLLFFPPAMCDMMATSIMYVALNMTSASSFQMLRGSVIIFTGLLSVAFLGRRLLPSQWFGICVTILGLVVVGLADFISGHRDDTHKLSDVITGDLLIIMAQIIVSVQMVLEEKFVYKHDVHPLRAVGTEGLFGFVVLSLLLIP-MYFIH---VGSFSNTPRQVLEDALDAFCQIGHKPLILLALLGNTVSIAFFNFAGISVTKEISATTRMVLDSLRTLVIWVVSLAL 298          
BLAST of Solute carrier family 35 member F6 vs. Planmine SMEST
Match: SMESG000054692.1 (SMESG000054692.1)

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 370/371 (99.73%), Postives = 371/371 (100.00%), Query Frame = 2
Query:  194 MCGMLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIIN 1306
            MCGMLLTGTINTISKKVQLDCKAIGITGWKNSSES+IHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTVIGLLLVGLSGVLKTKDPGSENGNKVLGVVLVLVGSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIIN
Sbjct:    1 MCGMLLTGTINTISKKVQLDCKAIGITGWKNSSESKIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTVIGLLLVGLSGVLKTKDPGSENGNKVLGVVLVLVGSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIIN 371          
BLAST of Solute carrier family 35 member F6 vs. Planmine SMEST
Match: SMESG000054692.1 (SMESG000054692.1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 367/368 (99.73%), Postives = 368/368 (100.00%), Query Frame = 2
Query:  203 MLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTXXXXXXXXXXXXXKTKDPGSENGNKXXXXXXXXXXSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIIN 1306
            MLLTGTINTISKKVQLDCKAIGITGWKNSSES+IHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTVIGLLLVGLSGVLKTKDPGSENGNKVLGVVLVLVGSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIIN
Sbjct:    1 MLLTGTINTISKKVQLDCKAIGITGWKNSSESKIHNFNKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYLSWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLKRVLHLFHWTGMSFTVIGLLLVGLSGVLKTKDPGSENGNKVLGVVLVLVGSLISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGHDNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVHRTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGTMMYNRVMNLNFIPFCYVEDQTPIKPVDNIIN 368          
The following BLAST results are available for this feature:
BLAST of Solute carrier family 35 member F6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SLC35F61.588e-5634.62solute carrier family 35 member F6 [Source:HGNC Sy... [more]
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C29H12.23.059e-3930.73pep chromosome:WBcel235:II:6123809:6125438:1 gene:... [more]
C29H12.23.059e-3930.73pep chromosome:WBcel235:II:6123815:6125424:1 gene:... [more]
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tango91.127e-2226.39gene:FBgn0260744 transcript:FBtr0082508[more]
Tango91.127e-2226.39gene:FBgn0260744 transcript:FBtr0347147[more]
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc35f62.524e-5233.92solute carrier family 35 member F6 [Source:ZFIN;Ac... [more]
slc35f62.524e-5233.92solute carrier family 35 member F6 [Source:ZFIN;Ac... [more]
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Slc35f66.840e-4935.04solute carrier family 35, member F6 [Source:MGI Sy... [more]
Slc35f66.373e-4034.45solute carrier family 35, member F6 [Source:MGI Sy... [more]
back to top
BLAST of Solute carrier family 35 member F6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N357|S35F6_HUMAN7.625e-5634.62Solute carrier family 35 member F6 OS=Homo sapiens... [more]
sp|Q5RFT1|S35F6_PONAB1.125e-5534.10Solute carrier family 35 member F6 OS=Pongo abelii... [more]
sp|Q5RKH7|S35F6_RAT7.927e-5035.61Solute carrier family 35 member F6 OS=Rattus norve... [more]
sp|Q8VE96|S35F6_MOUSE4.785e-4835.04Solute carrier family 35 member F6 OS=Mus musculus... [more]
sp|Q09875|YAGC_SCHPO8.074e-2131.71Uncharacterized protein C12G12.12 OS=Schizosacchar... [more]
back to top
BLAST of Solute carrier family 35 member F6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RAQ11.731e-12552.88Solute carrier family 35 member F6 OS=Fasciola hep... [more]
A0A4V3SGS24.430e-12550.25Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YP655.179e-12452.63Solute carrier family 35 member F6 OS=Fasciola gig... [more]
A0A3R7C5E42.306e-12250.50Solute carrier family 35 member F6 OS=Clonorchis s... [more]
A0A210PQ391.010e-12050.75Solute carrier family 35 member F6 OS=Mizuhopecten... [more]
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35f61.765e-4834.18solute carrier family 35 member F6 [Source:NCBI ge... [more]
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Solute carrier family 35 member F6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc35f61.117e-4334.78solute carrier family 35 member F6 [Source:NCBI ge... [more]
slc35f61.416e-4033.77solute carrier family 35 member F6 [Source:NCBI ge... [more]
back to top
BLAST of Solute carrier family 35 member F6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000054692.10.000e+099.73SMESG000054692.1[more]
SMESG000054692.10.000e+099.73SMESG000054692.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023219 ID=SMED30023219|Name=Solute carrier family 35 member F6|organism=Schmidtea mediterranea sexual|type=transcript|length=1461bp
CTGCATATTTGTTTTAGATAATCAATTTAAGCATTTCTGAATTATATTTT
TTAATTTTTTGGATATATCTGTTACTCAATTTAATATCAATTATATAGTT
GCATTGGTCACTATTTTTATAATATATTTTATTTAAAATAATTATTTTTC
TTCATCCAAAGAAATGGGTTTAAAACTTAGAGATTATTTATTTATGTGCG
GAATGTTACTTACTGGAACAATAAATACAATTTCTAAAAAAGTTCAATTG
GATTGCAAGGCTATTGGAATAACCGGTTGGAAAAATAGTTCAGAATCTGA
AATTCATAATTTCAACAAGCCTTGGCTGCAAACACTATTTATGTTTCTTG
GAGAATCAATTTGTTTAATAGGATTTGCTATCATAAGGCGTCGAAAGCAA
AAAAAGCATACAAAATTGGGTTTGAAATCACCAGAATCGAGTTTAACTCG
AAACAGTTATTTGAGCTGGATATTTATTATACCAACGATTTTTGATTTAC
TCGGAACAAGTGTTGCCGGGATAAGCCTTTTAAATATCGATGCTTCTGTT
TGGCAAATGATGAGGGGTTCTTTGATTATCTTTGTCGGAATTTTATCATT
GATTTTTCTTAAACGCGTCCTACATTTGTTTCATTGGACTGGAATGTCTT
TTACTGTTATTGGACTTCTTTTAGTCGGATTATCCGGTGTTCTCAAAACT
AAAGATCCCGGTTCAGAAAATGGTAATAAAGTACTTGGAGTTGTGCTGGT
GTTAGTTGGATCACTCATATCAGCAATGCAAATGGTTTTAGAAGAAGGTT
TATTAAAGAAAAGAGGTTTTCATCCTTTACAGGTTGTTGGAAGTGAAGGA
ATAATAGGAACTCTTATAACAGGCTTAGTGGTTTTACCGATTTTATATTT
CATAAAAGGACATGACAATGGTTCATATGAGAACGTGCTGGATGGTATTT
TACAAATAGGCCAAAACCCAGTTCTATTAGTCAACATGATTCTGTATATA
ATCTCAATAGCTTTCTACAATTATTTCGGTCTTTCTATCTCAAAAAATCT
AACAGCTGTCCATCGAACTTTAATCGATGCTCTCCGAACAATATTAGTCT
GGGGGGTAAATTTGTTTCTTTACTACGCAGTGGCAAAAAGATTTGGTGAA
TCATTTGATACGACATATGGATTGATGCAGATTGACGGATTCGCATTCCT
AATGATAGGGACAATGATGTACAATCGGGTTATGAATTTAAATTTCATCC
CGTTTTGCTATGTGGAAGATCAGACACCTATAAAGCCGGTAGATAATATT
ATCAATGAGGAAAGAGTTGATGCAGATGACAGTGAAGAGGACGATGAGAA
CAAACCAATAATAAAATCGAAATAAATAGTTTTTATTTTTATTCATGCAA
TCTTGTGATTCGGTTTTATTTTTTTTAATTTCAATAAAATTTTTATATAT
TTGAAAAAAAA
back to top

protein sequence of SMED30023219-orf-1

>SMED30023219-orf-1 ID=SMED30023219-orf-1|Name=SMED30023219-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=404bp
MGLKLRDYLFMCGMLLTGTINTISKKVQLDCKAIGITGWKNSSESEIHNF
NKPWLQTLFMFLGESICLIGFAIIRRRKQKKHTKLGLKSPESSLTRNSYL
SWIFIIPTIFDLLGTSVAGISLLNIDASVWQMMRGSLIIFVGILSLIFLK
RVLHLFHWTGMSFTVIGLLLVGLSGVLKTKDPGSENGNKVLGVVLVLVGS
LISAMQMVLEEGLLKKRGFHPLQVVGSEGIIGTLITGLVVLPILYFIKGH
DNGSYENVLDGILQIGQNPVLLVNMILYIISIAFYNYFGLSISKNLTAVH
RTLIDALRTILVWGVNLFLYYAVAKRFGESFDTTYGLMQIDGFAFLMIGT
MMYNRVMNLNFIPFCYVEDQTPIKPVDNIINEERVDADDSEEDDENKPII
KSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015165pyrimidine nucleotide-sugar transmembrane transporter activity
GO:0005351sugar:proton symporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0090481pyrimidine nucleotide-sugar transmembrane transport
GO:0008643carbohydrate transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007271Nuc_sug_transpt
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007271Nucleotide-sugar transporterPFAMPF04142Nuc_sug_transpcoord: 51..216
e-value: 2.0E-7
score: 30.5
NoneNo IPR availablePANTHERPTHR13146:SF3coord: 3..392
NoneNo IPR availablePANTHERPTHR13146UNCHARACTERIZEDcoord: 3..392
NoneNo IPR availableSUPERFAMILYSSF103481Multidrug resistance efflux transporter EmrEcoord: 66..175
NoneNo IPR availableTMHMMTMhelixcoord: 154..176
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 55..74
NoneNo IPR availableTMHMMTMhelixcoord: 267..289
NoneNo IPR availableTMHMMTMhelixcoord: 191..213
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
NoneNo IPR availableTMHMMTMhelixcoord: 130..149
NoneNo IPR availableTMHMMTMhelixcoord: 225..247