Leucine-zipper-like transcriptional regulator 1

Overview
NameLeucine-zipper-like transcriptional regulator 1
Smed IDSMED30023199
Length (bp)1570
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine-zipper-like transcriptional regulator 1 (SMED30023199) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine-zipper-like transcriptional regulator 1 (SMED30023199) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine-zipper-like transcriptional regulator 1 (SMED30023199) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine-zipper-like transcriptional regulator 1 (SMED30023199) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30023199SMESG000007049.1 Contig3743GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30023199SMESG000007049.1 Contig3743GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30023199SMESG000074654.1 Contig3743GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30023199SMESG000074654.1 Contig3743GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30023199SMESG000074654.1 dd_Smed_v4_6387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023199SMESG000074654.1 dd_Smed_v4_6387_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Human
Match: LZTR1 (leucine zipper like transcription regulator 1 [Source:HGNC Symbol;Acc:HGNC:6742])

HSP 1 Score: 74.7146 bits (182), Expect = 1.786e-13
Identity = 67/250 (26.80%), Postives = 107/250 (42.80%), Query Frame = 2
Query:  326 NFG--NNVNLWEDLS---KFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     + +   W ++   G+I  S   +   V  +  ++F G +  +     F + F    WT
Sbjct:   44 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFKDKTWT 266          

HSP 2 Score: 62.003 bits (149), Expect = 1.994e-9
Identity = 51/240 (21.25%), Postives = 93/240 (38.75%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCP-------FWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            R KH  V Y + +Y+ GG +    L DL R ++ + +            W      G                +P   H+ V Y + +++FGG +T D+ +          + Y        +WK   +   +P  R  H   +Y   L IF G+ D    L D+W    +  +    W     + ++  S   +           + ++ +F+F G  G +I N+L+Q+ F +  WT++
Sbjct:   68 RSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCS------------WCRAFTTGT-------------PPAPRYHHSAVVYGSSMFVFGG-YTGDIYSNSNLKNKNDLFEYKFATGQWTEWK---IEGRLPVARSAHGATVYSDKLWIFAGY-DGNARLNDMWTIGLQDREL-TCWEEVAQSGEIPPSCCNFP--------VAVCRDKMFVFSGQSGAKITNNLFQFEFKDKTWTRI 268          

HSP 3 Score: 60.077 bits (144), Expect = 8.159e-9
Identity = 53/245 (21.63%), Postives = 101/245 (41.22%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD 877
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ +  +  IP    N    + R  + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D
Sbjct:  115 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGQWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFKDKTWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDFQTWEVVQPSSD 329          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Human
Match: KLHDC10 (kelch domain containing 10 [Source:HGNC Symbol;Acc:HGNC:22194])

HSP 1 Score: 61.2326 bits (147), Expect = 2.235e-9
Identity = 73/290 (25.17%), Postives = 109/290 (37.59%), Query Frame = 2
Query:  137 QIPNRY------PVARWKHATVIYDNYLYLMGGYSWT------------NTLKDLWRLNLSE-------LNRIMTNQFKSIGLWSSIGNF--------------GNNVNL-------WEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGD-VRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYG-PRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            +IPNR+      P AR  H  V  +  LY+ GGY+                 ++LWR + +         +  M  +  S+ L     N               GN+V++       W  LS    K S +    M      LY+FGG   Y + +      ++  +   + KP +++  +P  R  H        + I GG       SL  + A++ ET  W  I    +          K G P AR  H  V  KN +FI GG  G  I  D+W+ N   +QW KL
Sbjct:   77 RIPNRFLRGHRPPPARSGHRCVADNTNLYVFGGYNPDYDESGGPDNEDYPLFRELWRYHFATGVWHQMGTDGYMPRELASMSLVLHGNNLLVFGGTGIPFGESNGNDVHVCNVKYKRWALLSCRGKKPSRIYGQAMAIINGSLYVFGGTTGY-IYSTDLHKLDLNTREWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPH---------EKIGFPAARRCHSCVQIKNDVFICGGYNGEVILGDIWKLNLQTFQWVKL 356          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Human
Match: LZTR1 (leucine zipper like transcription regulator 1 [Source:HGNC Symbol;Acc:HGNC:6742])

HSP 1 Score: 54.299 bits (129), Expect = 7.091e-8
Identity = 48/189 (25.40%), Postives = 83/189 (43.92%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKW---------HLIWCTQYLNKQLK--RSIVKYG--PRARHDHRAVIHKNHLFIFGG 793
            NFG    V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W         + +W     +++L     + + G  P +  +    + ++ +F+F G
Sbjct:   13 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQWTEWKIEGRLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSG 186          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Human
Match: KLHDC2 (kelch domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20231])

HSP 1 Score: 55.4546 bits (132), Expect = 1.211e-7
Identity = 70/300 (23.33%), Postives = 120/300 (40.00%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHT-MVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDF-ETGKW------------HLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAY----ITDVKINNHWLFFGI-NDTRRKTEKFIYSFSQNKW 997
            P  R  H  V    ++++ GGY  +N ++ L+   L      + N     G W  I   G+              + P  S +  V     LY+FGG  +    N  + + +     + +W+ ID     P  +      +Y++ L+ FGG+G +      L  F+F ET  W            H++    +   Q   +     PRA H    V   N  F+FGG       NDL   N + ++W +L+ +G I  +      +T V  ++ +LF G   D +  ++ + Y  S+N+W
Sbjct:   29 PAERSGHVAVSDGRHMFVWGGYK-SNQVRGLYDFYLPREELWIYNM--ETGRWKKINTEGD--------------VPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYMLDSRSTDRVLQWERIDCQGIPPSSKDKLGVWVYKNKLIFFGGYGYLPED-KVLGTFEFDETSFWNSSHPRGWNDHVHILDTETFTWSQPITTGKAPSPRAAHACATV--GNRGFVFGGRYRDARMNDLHYLNLDTWEWNELIPQG-ICPVGRSWHSLTPVSSDHLFLFGGFTTDKQPLSDAWTYCISKNEW 307          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Human
Match: KLHDC2 (kelch domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20231])

HSP 1 Score: 55.4546 bits (132), Expect = 1.353e-7
Identity = 70/300 (23.33%), Postives = 120/300 (40.00%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHT-MVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDF-ETGKW------------HLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAY----ITDVKINNHWLFFGI-NDTRRKTEKFIYSFSQNKW 997
            P  R  H  V    ++++ GGY  +N ++ L+   L      + N     G W  I   G+              + P  S +  V     LY+FGG  +    N  + + +     + +W+ ID     P  +      +Y++ L+ FGG+G +      L  F+F ET  W            H++    +   Q   +     PRA H    V   N  F+FGG       NDL   N + ++W +L+ +G I  +      +T V  ++ +LF G   D +  ++ + Y  S+N+W
Sbjct:   29 PAERSGHVAVSDGRHMFVWGGYK-SNQVRGLYDFYLPREELWIYNM--ETGRWKKINTEGD--------------VPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYMLDSRSTDRVLQWERIDCQGIPPSSKDKLGVWVYKNKLIFFGGYGYLPEDK-VLGTFEFDETSFWNSSHPRGWNDHVHILDTETFTWSQPITTGKAPSPRAAHACATV--GNRGFVFGGRYRDARMNDLHYLNLDTWEWNELIPQG-ICPVGRSWHSLTPVSSDHLFLFGGFTTDKQPLSDAWTYCISKNEW 307          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Celegans
Match: atrn-1 (pep chromosome:WBcel235:X:14711579:14718787:1 gene:WBGene00006432.1 transcript:F33C8.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:atrn-1)

HSP 1 Score: 62.003 bits (149), Expect = 8.518e-10
Identity = 63/255 (24.71%), Postives = 110/255 (43.14%), Query Frame = 2
Query:  146 NRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNC-------PFWIYNIGNQIMQKW-KPIDVNAPI---PFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGG-MCGLEICNDLWQWNFNEYQWTKLMYKG 874
            N  P  +  HA++  D+ ++ +GG  +  +         S+ N I      S  +WS        V +  D+ K      P   HT+V YKN LY+FGG     VR+          WI+++G+   +KW + I  N  I   PF    HS  + RS + +  G+  + G +  +  ++FET +W +   + ++  + K S V+Y                + ++GG M    I + L Q++ +  +W+ L   G
Sbjct:  262 NNAPTGKASHASIAIDDVVWSIGGEFFDGS---------SDPNNIDVYNVTS-RIWS-------KVEVSGDMPK------PRFDHTVVKYKNKLYMFGGVTKTQVRHQTTQAATNELWIFDMGS---KKWAQQIHKNETIIAAPFAVAGHSAHVIRSEMFVIFGYNPLFGFMHHVQIYNFETEEWTVANTSDHVYGRFKHSAVEY--------TTPTGATAILVYGGSMWNNTITDSLMQFDTSTKKWSNLPQSG 482          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Celegans
Match: hcf-1 (HCF1 related; Host cell factor 1 [Source:UniProtKB/TrEMBL;Acc:G5EC23])

HSP 1 Score: 55.0694 bits (131), Expect = 9.912e-8
Identity = 45/177 (25.42%), Postives = 76/177 (42.94%), Query Frame = 2
Query:  383 SPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKP-IDVNAPIPFPRRNHSCCIYRSA--LVIFGGFGD--------VRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHK----NHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMY 868
            +P  +   ++  N +Y FGG   Y       +         ++  P +  N  +P PR  HS  + + +    +FGG  +        V   L DL+  +  +G  HLIW         K +    GP +R  H AVI++    + + ++GGM G+ +  DLW  N N   WT++ +
Sbjct:   91 TPAAAFGAISLGNKIYRFGGMTEYGKYTNDLYELQSTRWEWRRLNPRVHSNGHLPCPRIGHSFVVSQKSQKAYVFGGLSNDLNDPKRNVPHYLDDLYVINL-SGPQHLIW--------EKLNATGPGPISRESHTAVIYEKDSISRMVVYGGMNGVRL-GDLWYLNLNTLHWTEIKF 257          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Celegans
Match: F53E4.1 (pep chromosome:WBcel235:V:15652438:15659079:-1 gene:WBGene00009978.1 transcript:F53E4.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53E4.1)

HSP 1 Score: 52.7582 bits (125), Expect = 3.789e-7
Identity = 58/245 (23.67%), Postives = 96/245 (39.18%), Query Frame = 2
Query:  137 QIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFK-SIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGA--------FTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFN 841
            +I    P +R  H  V+++N +++ GGY      +D  R +        T  F  +   W  + +  N+   W D             HT       +YIFGG           +D  +      N+      + K +  N   P  RR+HS  +Y   + +FGG+ G +     +L+ FD +T  W +I            S+    P AR  H +V+    +++FGG   L  C+ L   N+N
Sbjct:  135 EIEGFVPPSRDGHTAVVWNNQMFVFGGYE-----EDAQRFSQE------TYVFDFATSTWREM-HTKNDPPRWRDF------------HTASVIDGMMYIFGGRSDESGQFHTIHDQYDDTLMALNLATGAWTRTK-VPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTINVHYNELYCFDPKTSMWSVI------------SVRGTYPSARRRHCSVVSNGKVYLFGGTMPLP-CHPLSTTNYN 341          

HSP 2 Score: 50.0618 bits (118), Expect = 3.020e-6
Identity = 53/224 (23.66%), Postives = 93/224 (41.52%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNN--------VNLWEDLSKFVGKISPLQ--SHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQK---WKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGG 793
            R  HA++   + +Y  GGY           L++  LN   T  ++ I +  + G   NN         + + D  K  G + P Q   HT+V Y+   Y++GG      RN  +   N+ ++   +   WK +++   +P  R  H+  ++ + + +FGG+  D +    + + FDF T  W  +                  PR R  H A +    ++IFGG
Sbjct:   14 RVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLN---TENYRWIKM--NPGYVYNNRIITKATIESPYSDSDKMFGAV-PYQRYGHTVVEYQGKAYVWGG------RNDDYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKNDP------------PRWRDFHTASVIDGMMYIFGG 213          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Celegans
Match: F53E4.1 (pep chromosome:WBcel235:V:15652438:15659067:-1 gene:WBGene00009978.1 transcript:F53E4.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53E4.1)

HSP 1 Score: 52.7582 bits (125), Expect = 3.789e-7
Identity = 58/245 (23.67%), Postives = 96/245 (39.18%), Query Frame = 2
Query:  137 QIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFK-SIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGA--------FTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFN 841
            +I    P +R  H  V+++N +++ GGY      +D  R +        T  F  +   W  + +  N+   W D             HT       +YIFGG           +D  +      N+      + K +  N   P  RR+HS  +Y   + +FGG+ G +     +L+ FD +T  W +I            S+    P AR  H +V+    +++FGG   L  C+ L   N+N
Sbjct:  135 EIEGFVPPSRDGHTAVVWNNQMFVFGGYE-----EDAQRFSQE------TYVFDFATSTWREM-HTKNDPPRWRDF------------HTASVIDGMMYIFGGRSDESGQFHTIHDQYDDTLMALNLATGAWTRTK-VPENTMKPGGRRSHSTWVYDGKMYMFGGYLGTINVHYNELYCFDPKTSMWSVI------------SVRGTYPSARRRHCSVVSNGKVYLFGGTMPLP-CHPLSTTNYN 341          

HSP 2 Score: 50.0618 bits (118), Expect = 3.020e-6
Identity = 53/224 (23.66%), Postives = 93/224 (41.52%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNN--------VNLWEDLSKFVGKISPLQ--SHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQK---WKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGG 793
            R  HA++   + +Y  GGY           L++  LN   T  ++ I +  + G   NN         + + D  K  G + P Q   HT+V Y+   Y++GG      RN  +   N+ ++   +   WK +++   +P  R  H+  ++ + + +FGG+  D +    + + FDF T  W  +                  PR R  H A +    ++IFGG
Sbjct:   14 RVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLN---TENYRWIKM--NPGYVYNNRIITKATIESPYSDSDKMFGAV-PYQRYGHTVVEYQGKAYVWGG------RNDDYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKNDP------------PRWRDFHTASVIDGMMYIFGG 213          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Celegans
Match: F53E4.1 (pep chromosome:WBcel235:V:15652438:15659079:-1 gene:WBGene00009978.1 transcript:F53E4.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53E4.1)

HSP 1 Score: 49.6766 bits (117), Expect = 3.361e-6
Identity = 53/224 (23.66%), Postives = 93/224 (41.52%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNN--------VNLWEDLSKFVGKISPLQ--SHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQK---WKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGG 793
            R  HA++   + +Y  GGY           L++  LN   T  ++ I +  + G   NN         + + D  K  G + P Q   HT+V Y+   Y++GG      RN  +   N+ ++   +   WK +++   +P  R  H+  ++ + + +FGG+  D +    + + FDF T  W  +                  PR R  H A +    ++IFGG
Sbjct:   14 RVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLN---TENYRWIKM--NPGYVYNNRIITKATIESPYSDSDKMFGAV-PYQRYGHTVVEYQGKAYVWGG------RNDDYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKNDP------------PRWRDFHTASVIDGMMYIFGG 213          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Fly
Match: Lztr1 (gene:FBgn0040344 transcript:FBtr0331303)

HSP 1 Score: 68.1662 bits (165), Expect = 1.289e-11
Identity = 66/296 (22.30%), Postives = 129/296 (43.58%), Query Frame = 2
Query:  128 CSHQIPNRYPVARWKHATVIYDNYLYLMGGYSW---TNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKIS-PLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLA-----YITDVKINNHWLFFG-INDTRRKTEKFIYSFS 985
            C+   P   P  R+ H+ V+  + +++ GGY+    +N+       NL+  N +   +F+S  +W            W    KF G+   P  +H    Y N ++I+ G +  + R    W  N+  +   +W+ +D     P    N    + R A+ +F G   ++ +   L+ F F+T  W  I      N+ + R      P  R+ H  V H   L++FGG     + NDL  ++ +   W+ +  + + SD+      + + V  +  ++F G ++++ R+ + + + FS
Sbjct:  293 CATGTP---PAPRYHHSAVVAGSSMFIFGGYTGDIHSNS-------NLTNKNDLFEYKFQS-AMWVE----------W----KFSGRQPVPRSAHGAAVYDNKMWIYAG-YDGNARLNDMWTLNLTGE--NQWEEVDQLGDRPPTCCNFPVAVARDAMYVFSGQSGLQIT-NSLFEFHFKTRTWRRIS-----NEPVLRGATSAPPSRRYGHTMVHHDRFLYVFGGSADSTLPNDLHCYDLDSQVWSVIQPEQN-SDVPSGRVFHASAVICDAMYIFGGTVDNSVRRGDTYRFQFS 553          

HSP 2 Score: 62.3882 bits (150), Expect = 6.643e-10
Identity = 52/205 (25.37%), Postives = 83/205 (40.49%), Query Frame = 2
Query:  146 NRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNR---------------------------IMTNQFKSIGLWSSIGNFGNNVNLWEDLSK---FVGKISPLQS----HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFET 658
             R PV R  H   +YDN +++  GY     L D+W LNL+  N+                           + + Q   + + +S+  F      W  +S      G  S   S    HTMV +   LY+FGG+    + N     Y++ +Q+    +P + N+ +P  R  H+  +   A+ IFGG  D     GD + F F +
Sbjct:  353 GRQPVPRSAHGAAVYDNKMWIYAGYDGNARLNDMWTLNLTGENQWEEVDQLGDRPPTCCNFPVAVARDAMYVFSGQ-SGLQITNSLFEFHFKTRTWRRISNEPVLRGATSAPPSRRYGHTMVHHDRFLYVFGGSADSTLPN-DLHCYDLDSQVWSVIQP-EQNSDVPSGRVFHASAVICDAMYIFGGTVDNSVRRGDTYRFQFSS 554          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Fly
Match: Lztr1 (gene:FBgn0040344 transcript:FBtr0343361)

HSP 1 Score: 68.1662 bits (165), Expect = 1.289e-11
Identity = 66/296 (22.30%), Postives = 129/296 (43.58%), Query Frame = 2
Query:  128 CSHQIPNRYPVARWKHATVIYDNYLYLMGGYSW---TNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKIS-PLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLA-----YITDVKINNHWLFFG-INDTRRKTEKFIYSFS 985
            C+   P   P  R+ H+ V+  + +++ GGY+    +N+       NL+  N +   +F+S  +W            W    KF G+   P  +H    Y N ++I+ G +  + R    W  N+  +   +W+ +D     P    N    + R A+ +F G   ++ +   L+ F F+T  W  I      N+ + R      P  R+ H  V H   L++FGG     + NDL  ++ +   W+ +  + + SD+      + + V  +  ++F G ++++ R+ + + + FS
Sbjct:  293 CATGTP---PAPRYHHSAVVAGSSMFIFGGYTGDIHSNS-------NLTNKNDLFEYKFQS-AMWVE----------W----KFSGRQPVPRSAHGAAVYDNKMWIYAG-YDGNARLNDMWTLNLTGE--NQWEEVDQLGDRPPTCCNFPVAVARDAMYVFSGQSGLQIT-NSLFEFHFKTRTWRRIS-----NEPVLRGATSAPPSRRYGHTMVHHDRFLYVFGGSADSTLPNDLHCYDLDSQVWSVIQPEQN-SDVPSGRVFHASAVICDAMYIFGGTVDNSVRRGDTYRFQFS 553          

HSP 2 Score: 62.7734 bits (151), Expect = 6.207e-10
Identity = 52/205 (25.37%), Postives = 83/205 (40.49%), Query Frame = 2
Query:  146 NRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNR---------------------------IMTNQFKSIGLWSSIGNFGNNVNLWEDLSK---FVGKISPLQS----HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFET 658
             R PV R  H   +YDN +++  GY     L D+W LNL+  N+                           + + Q   + + +S+  F      W  +S      G  S   S    HTMV +   LY+FGG+    + N     Y++ +Q+    +P + N+ +P  R  H+  +   A+ IFGG  D     GD + F F +
Sbjct:  353 GRQPVPRSAHGAAVYDNKMWIYAGYDGNARLNDMWTLNLTGENQWEEVDQLGDRPPTCCNFPVAVARDAMYVFSGQ-SGLQITNSLFEFHFKTRTWRRISNEPVLRGATSAPPSRRYGHTMVHHDRFLYVFGGSADSTLPN-DLHCYDLDSQVWSVIQP-EQNSDVPSGRVFHASAVICDAMYIFGGTVDNSVRRGDTYRFQFSS 554          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Fly
Match: CG6758 (gene:FBgn0034704 transcript:FBtr0071767)

HSP 1 Score: 63.1586 bits (152), Expect = 3.603e-10
Identity = 58/245 (23.67%), Postives = 98/245 (40.00%), Query Frame = 2
Query:  158 VARWKHATVIYDNYLYLMGGYSWTNT-LKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQI------MQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF---GDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCG----------LEICNDLWQW 832
              R+ H+ V  DN +Y+ GG S ++T   DLWR +L+ +                          W          SP  S +MVA++N L +FGG + Y   + P+  + + +++        +W  +  +   P P   HS  ++   +V+FGG+    D   +  D W  D    +W   W   ++     R   +YG       +  + +NHL I GG  G          L++  D+W W
Sbjct:  101 AGRFAHSAVRQDNSMYVFGGGSSSDTTFNDLWRFDLTHMR-------------------------WARPVATGTYPSPKGSASMVAWRNQLILFGG-WRYPSLHPPYQPWCLFDELHYYDLGKNRWL-LRSSLSSPPPMAGHSATVHGDRMVVFGGYQIKDDFNVNSNDTWVLDLPEQRW---WQPLFVGN--TRPSPRYG-----QIQVELGRNHLLIVGGCGGANRVYTDAWLLDMTRDVWSW 308          

HSP 2 Score: 49.2914 bits (116), Expect = 7.222e-6
Identity = 46/217 (21.20%), Postives = 89/217 (41.01%), Query Frame = 2
Query:  395 SHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGG--FGDVRGSLGDLWAFD----FETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEI----CNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKIN---NHWLFFG--INDTRRKTEKFIYSFSQNKWT 1000
            +H+ V   N +Y+FGG  + D      W +++ +    +W         P P+ + S   +R+ L++FGG  +  +         FD    ++ GK          N+ L RS +   P     H A +H + + +FGG    +      ND W  +  E +W + ++ G+         +++    NH L  G      R  T+ ++   +++ W+
Sbjct:  105 AHSAVRQDNSMYVFGGGSSSDTTFNDLWRFDLTH---MRWARPVATGTYPSPKGSASMVAWRNQLILFGGWRYPSLHPPYQPWCLFDELHYYDLGK----------NRWLLRSSLS-SPPPMAGHSATVHGDRMVVFGGYQIKDDFNVNSNDTWVLDLPEQRWWQPLFVGNTRPSPRYGQIQVELGRNHLLIVGGCGGANRVYTDAWLLDMTRDVWS 307          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Fly
Match: CG12081 (gene:FBgn0030053 transcript:FBtr0332626)

HSP 1 Score: 50.8322 bits (120), Expect = 2.041e-6
Identity = 46/167 (27.54%), Postives = 69/167 (41.32%), Query Frame = 2
Query:  395 SHTMVAYKNHLYIFGGAFT-YDVR-NCPFWIYNIGNQIMQKWKPI-----DVNAP-----IPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGL--EICNDLWQWNFNEYQW 853
            +H  V   + +Y FGG  T YD R N P  ++ +    M +W  +     D   P     +PF R  H+   Y+  + I+GG  D       L+ FD +T +W     T  L            P AR  H A +  N ++IFGG      E  +D+   N +  +W
Sbjct:   15 NHAAVGVGDFIYSFGGYCTGYDYRYNEPIDVHALNAHTM-RWTLVPQQLDDAGVPLKYPLVPFQRYGHTVVAYKDRIYIWGGRND-ENLCNTLYCFDPKTAQWSRPQVTGCL------------PGARDGHSACVIGNSMYIFGGFVDEINEFSSDVHSLNLDTMEW 167          

HSP 2 Score: 48.9062 bits (115), Expect = 8.596e-6
Identity = 55/222 (24.77%), Postives = 90/222 (40.54%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWT-----NTLKDLWRLNLSELN-RIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQ--SHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGD-VRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYG--PRARHDHRAVIH-KNHLFIFGG 793
            R  HA V   +++Y  GGY        N   D+  LN   +   ++  Q    G+                       + P Q   HT+VAYK+ +YI+GG    ++ N    +Y    +  Q W    V   +P  R  HS C+  +++ IFGGF D +     D+ + + +T +W              R +  +G  P  R  H +V + +  ++IFGG
Sbjct:   13 RVNHAAVGVGDFIYSFGGYCTGYDYRYNEPIDVHALNAHTMRWTLVPQQLDDAGV------------------PLKYPLVPFQRYGHTVVAYKDRIYIWGGRNDENLCNT---LYCFDPKTAQ-WSRPQVTGCLPGARDGHSACVIGNSMYIFGGFVDEINEFSSDVHSLNLDTMEW--------------RYVQTFGVPPSYRDFHASVAYEQERMYIFGG 198          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Fly
Match: CG12081 (gene:FBgn0030053 transcript:FBtr0071218)

HSP 1 Score: 50.8322 bits (120), Expect = 2.041e-6
Identity = 46/167 (27.54%), Postives = 69/167 (41.32%), Query Frame = 2
Query:  395 SHTMVAYKNHLYIFGGAFT-YDVR-NCPFWIYNIGNQIMQKWKPI-----DVNAP-----IPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGL--EICNDLWQWNFNEYQW 853
            +H  V   + +Y FGG  T YD R N P  ++ +    M +W  +     D   P     +PF R  H+   Y+  + I+GG  D       L+ FD +T +W     T  L            P AR  H A +  N ++IFGG      E  +D+   N +  +W
Sbjct:   15 NHAAVGVGDFIYSFGGYCTGYDYRYNEPIDVHALNAHTM-RWTLVPQQLDDAGVPLKYPLVPFQRYGHTVVAYKDRIYIWGGRND-ENLCNTLYCFDPKTAQWSRPQVTGCL------------PGARDGHSACVIGNSMYIFGGFVDEINEFSSDVHSLNLDTMEW 167          

HSP 2 Score: 48.9062 bits (115), Expect = 8.596e-6
Identity = 55/222 (24.77%), Postives = 90/222 (40.54%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWT-----NTLKDLWRLNLSELN-RIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQ--SHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGD-VRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYG--PRARHDHRAVIH-KNHLFIFGG 793
            R  HA V   +++Y  GGY        N   D+  LN   +   ++  Q    G+                       + P Q   HT+VAYK+ +YI+GG    ++ N    +Y    +  Q W    V   +P  R  HS C+  +++ IFGGF D +     D+ + + +T +W              R +  +G  P  R  H +V + +  ++IFGG
Sbjct:   13 RVNHAAVGVGDFIYSFGGYCTGYDYRYNEPIDVHALNAHTMRWTLVPQQLDDAGV------------------PLKYPLVPFQRYGHTVVAYKDRIYIWGGRNDENLCNT---LYCFDPKTAQ-WSRPQVTGCLPGARDGHSACVIGNSMYIFGGFVDEINEFSSDVHSLNLDTMEW--------------RYVQTFGVPPSYRDFHASVAYEQERMYIFGG 198          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Zebrafish
Match: si:dkey-3d4.3 (si:dkey-3d4.3 [Source:ZFIN;Acc:ZDB-GENE-070912-527])

HSP 1 Score: 82.0333 bits (201), Expect = 1.084e-17
Identity = 52/178 (29.21%), Postives = 82/178 (46.07%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLS-KFVGKISPLQSHTMVAYKNHLYIFGGA--FTYDVRNCPFWIYNIGNQIMQKWKPIDV--NAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHL 673
            P  R+KHA+  +  ++YL+GG     +L+D W+ N+                           N W +L          ++ HTMVA++  LY+FGG    +Y     P W+++ G +    WK   V      P  R+ HS  I  S++ I+GG+ D++GS  + W FDFE+  W L
Sbjct:   20 PCDRYKHASCAHRGHVYLLGGRE-KCSLRDFWKYNVV-------------------------CNDWVELPCDSEEAPEEVEEHTMVAHQGFLYVFGGLRDSSYSNSKTPLWVFDTGKECWINWKAASVALQGVTPGNRKGHSAVILGSSMYIYGGYIDIKGSTKEFWKFDFESRLWSL 171          

HSP 2 Score: 48.521 bits (114), Expect = 3.572e-6
Identity = 45/182 (24.73%), Postives = 78/182 (42.86%), Query Frame = 2
Query:  326 NFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNA-PIPFPRRNHSCCIYRSALVIFGGFGD--VRGSLGDLWAFDFETGKWHLIWCTQYLN-KQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLE-ICNDLWQWNFNEYQWT 856
            N G+   LW  + +          H   A++ H+Y+ GG     +R+  FW YN+   +   W  +  ++   P     H+   ++  L +FGG  D     S   LW FD  TGK        ++N K    ++    P  R  H AVI  + ++I+GG   ++    + W+++F    W+
Sbjct:    2 NQGSGACLWTPVPQQCPAPCDRYKHASCAHRGHVYLLGGREKCSLRD--FWKYNV---VCNDWVELPCDSEEAPEEVEEHTMVAHQGFLYVFGGLRDSSYSNSKTPLWVFD--TGK------ECWINWKAASVALQGVTPGNRKGHSAVILGSSMYIYGGYIDIKGSTKEFWKFDFESRLWS 170          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Zebrafish
Match: lztr1 (leucine-zipper-like transcription regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9564])

HSP 1 Score: 70.4774 bits (171), Expect = 2.386e-12
Identity = 65/250 (26.00%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAY++ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++   +++  +V     AR  H A ++ + L+IF G  G    ND+W     + +   W ++   G+I  S   +   V  +  ++F G +  +     F + F  + WT
Sbjct:   34 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYRDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW---KVEGRLV-----ARSAHGATVYNDKLWIFAGYDGNARLNDMWTIGLQDREQAYWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFKGHIWT 255          

HSP 2 Score: 65.855 bits (159), Expect = 8.471e-11
Identity = 61/285 (21.40%), Postives = 116/285 (40.70%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD---ISDLAYITDVKINNHWLFFG--INDTRRKTEKFIYSFS 985
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W    K  G++    +H    Y + L+IF G +  + R    W   + ++    W+ I+ +  IP    N    + R  + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D    S   +     I++    FG  +++  R  E + + FS
Sbjct:  105 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGQWTE----------W----KVEGRLVARSAHGATVYNDKLWIFAG-YDGNARLNDMWTIGLQDREQAYWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFKGHIWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQTWEVIQPSIDSEMPSGRLFHAAAVIHDAMYIFGGTVDNNVRSGEMYRFQFS 359          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Zebrafish
Match: lztr1 (leucine-zipper-like transcription regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9564])

HSP 1 Score: 70.4774 bits (171), Expect = 2.614e-12
Identity = 65/250 (26.00%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAY++ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++   +++  +V     AR  H A ++ + L+IF G  G    ND+W     + +   W ++   G+I  S   +   V  +  ++F G +  +     F + F  + WT
Sbjct:   27 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYRDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW---KVEGRLV-----ARSAHGATVYNDKLWIFAGYDGNARLNDMWTIGLQDREQAYWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFKGHIWT 248          

HSP 2 Score: 65.855 bits (159), Expect = 8.008e-11
Identity = 61/285 (21.40%), Postives = 116/285 (40.70%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD---ISDLAYITDVKINNHWLFFG--INDTRRKTEKFIYSFS 985
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W    K  G++    +H    Y + L+IF G +  + R    W   + ++    W+ I+ +  IP    N    + R  + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D    S   +     I++    FG  +++  R  E + + FS
Sbjct:   98 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGQWTE----------W----KVEGRLVARSAHGATVYNDKLWIFAG-YDGNARLNDMWTIGLQDREQAYWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFKGHIWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQTWEVIQPSIDSEMPSGRLFHAAAVIHDAMYIFGGTVDNNVRSGEMYRFQFS 352          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Zebrafish
Match: lztr1 (leucine-zipper-like transcription regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9564])

HSP 1 Score: 70.4774 bits (171), Expect = 2.659e-12
Identity = 65/250 (26.00%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAY++ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++   +++  +V     AR  H A ++ + L+IF G  G    ND+W     + +   W ++   G+I  S   +   V  +  ++F G +  +     F + F  + WT
Sbjct:   27 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYRDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW---KVEGRLV-----ARSAHGATVYNDKLWIFAGYDGNARLNDMWTIGLQDREQAYWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFKGHIWT 248          

HSP 2 Score: 66.6254 bits (161), Expect = 4.676e-11
Identity = 61/285 (21.40%), Postives = 116/285 (40.70%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD---ISDLAYITDVKINNHWLFFG--INDTRRKTEKFIYSFS 985
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W    K  G++    +H    Y + L+IF G +  + R    W   + ++    W+ I+ +  IP    N    + R  + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D    S   +     I++    FG  +++  R  E + + FS
Sbjct:   98 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGQWTE----------W----KVEGRLVARSAHGATVYNDKLWIFAG-YDGNARLNDMWTIGLQDREQAYWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFKGHIWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQTWEVIQPSTDSEMPSGRLFHAAAVIHDAMYIFGGTVDNNVRSGEMYRFQFS 352          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Zebrafish
Match: krcp (kelch repeat-containing protein [Source:ZFIN;Acc:ZDB-GENE-030131-2126])

HSP 1 Score: 61.2326 bits (147), Expect = 1.792e-9
Identity = 45/171 (26.32%), Postives = 76/171 (44.44%), Query Frame = 2
Query:  359 LSKFVGKISPLQSHTMVAYKNHLYIFGGAFTY---DVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            L +  GK+ PL  H+   ++  L++FGG F     +   C   IY    ++   ++PI VN   P PR  HS C+ +  + +FGG+ D      D++  D    ++  +          K S     PR+ H   AV+ ++   I GG  G    +D + +N +   W+ L
Sbjct:  312 LVEAQGKVPPLAYHSCSMFRGELFVFGGVFPRPHPEPDGCSDSIYIFNPEMAIWYQPI-VNGEKPAPRSGHSACVMQGRIFVFGGW-DTPVCFNDMFMLDLGLMEFSPV----------KTSGTAPSPRSWHGC-AVLSESSFLIHGGYNGNNALSDAFIFNTDTSCWSSL 469          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Xenopus
Match: ENSXETT00000007272.1 (tip elongation aberrant protein 1-like [Source:NCBI gene;Acc:100491804])

HSP 1 Score: 121.324 bits (303), Expect = 2.789e-29
Identity = 75/285 (26.32%), Postives = 127/285 (44.56%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAF--TYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL-MYKGDISDLAYITDVKINNHWLFFGINDTRRKTEKF-IYSFSQNKW 997
            P  R+KH+  +Y+ ++Y+ GG    N L D WR ++                           N WE L+        L+ H+MVA++  LY+FGG      +  + P W+Y I  ++    KP       P  R+ HS  +++S++ I+GG+ D++G++G+ WAF  +T  W            L  S    GP  RH H A  +   +++FGG+  +   NDLW+++F  + W  +    G    + + + V  N  W+  G   +R  +     Y F+   W
Sbjct:   20 PCDRFKHSCALYNGHIYIYGGRQDCN-LGDFWRYSIDH-------------------------NEWEQLAGSKEAPDRLEGHSMVAHEGVLYVFGGMIDSAANQESTPLWMYAIDARMWYMGKPPRCKGKSPTNRKGHSAVLHQSSMFIYGGYFDLKGAVGEFWAFALDTENW----------SALSPSTRGSGPGPRHGHTAATYNGAMYLFGGLKHMAEQNDLWRFDFRRHNWASIRTSSGPPKLVGHGSLVHQNCLWVVGGGLASRNPSSHLWKYHFNSRTW 268          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Xenopus
Match: lztr1 (leucine-zipper-like transcription regulator 1 [Source:NCBI gene;Acc:100158621])

HSP 1 Score: 75.0998 bits (183), Expect = 1.322e-13
Identity = 68/250 (27.20%), Postives = 108/250 (43.20%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG   +V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     +     W ++   G+I  S   +   V  +  ++F G +  +     F + FS+  WT
Sbjct:   34 NFGPFESVHRWRRLLPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGSPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGLW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFSEKVWT 256          

HSP 2 Score: 68.5514 bits (166), Expect = 1.715e-11
Identity = 63/286 (22.03%), Postives = 119/286 (41.61%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDIS----DLAYITDVKINNHWLFFG-INDTRRKTEKFIYSFS 985
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + GLW+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ I+ +  IP    N    + R  + +F G    + +  +L+ F+F    W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D       L +   V  +  ++F G +++  R  E + + FS
Sbjct:  105 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGLWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFSEKVWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQSWEVIQASPDSELPSGRLFHAAAVIADAMYIFGGTVDNNVRSGEMYRFQFS 360          

HSP 3 Score: 65.4698 bits (158), Expect = 1.251e-10
Identity = 56/208 (26.92%), Postives = 88/208 (42.31%), Query Frame = 2
Query:  137 QIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIG-LWSSIGNFGNNV------------------NLWE-DLSKFV-----------GKISPLQ---SHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDV--NAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDF 652
            +I  R PVAR  H   +Y + L++  GY     L D+W + L + +     + +  G +  S  NF   V                  NL++ + S+ V           G   P Q    HTMVA+  HLY+FGGA    + N     Y++ +   Q W+ I    ++ +P  R  H+  +   A+ IFGG  D     G+++ F F
Sbjct:  156 KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFSEKVWTRIPTEHLLRGSPPPPQRRYGHTMVAFDRHLYVFGGAADNTLPN-ELHCYDVDS---QSWEVIQASPDSELPSGRLFHAAAVIADAMYIFGGTVDNNVRSGEMYRFQF 359          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Xenopus
Match: lztr1 (leucine-zipper-like transcription regulator 1 [Source:NCBI gene;Acc:100158621])

HSP 1 Score: 75.0998 bits (183), Expect = 1.398e-13
Identity = 68/250 (27.20%), Postives = 108/250 (43.20%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG   +V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     +     W ++   G+I  S   +   V  +  ++F G +  +     F + FS+  WT
Sbjct:   27 NFGPFESVHRWRRLLPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGSPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGLW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFSEKVWT 249          

HSP 2 Score: 68.1662 bits (165), Expect = 1.846e-11
Identity = 63/286 (22.03%), Postives = 119/286 (41.61%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDIS----DLAYITDVKINNHWLFFG-INDTRRKTEKFIYSFS 985
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + GLW+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ I+ +  IP    N    + R  + +F G    + +  +L+ F+F    W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D       L +   V  +  ++F G +++  R  E + + FS
Sbjct:   98 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGLWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFSEKVWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQSWEVIQASPDSELPSGRLFHAAAVIADAMYIFGGTVDNNVRSGEMYRFQFS 353          

HSP 3 Score: 65.855 bits (159), Expect = 1.183e-10
Identity = 56/208 (26.92%), Postives = 88/208 (42.31%), Query Frame = 2
Query:  137 QIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIG-LWSSIGNFGNNV------------------NLWE-DLSKFV-----------GKISPLQ---SHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDV--NAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDF 652
            +I  R PVAR  H   +Y + L++  GY     L D+W + L + +     + +  G +  S  NF   V                  NL++ + S+ V           G   P Q    HTMVA+  HLY+FGGA    + N     Y++ +   Q W+ I    ++ +P  R  H+  +   A+ IFGG  D     G+++ F F
Sbjct:  149 KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFSEKVWTRIPTEHLLRGSPPPPQRRYGHTMVAFDRHLYVFGGAADNTLPN-ELHCYDVDS---QSWEVIQASPDSELPSGRLFHAAAVIADAMYIFGGTVDNNVRSGEMYRFQF 352          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Xenopus
Match: lztr1 (leucine-zipper-like transcription regulator 1 [Source:NCBI gene;Acc:100158621])

HSP 1 Score: 74.7146 bits (182), Expect = 1.582e-13
Identity = 68/250 (27.20%), Postives = 108/250 (43.20%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG   +V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     +     W ++   G+I  S   +   V  +  ++F G +  +     F + FS+  WT
Sbjct:   40 NFGPFESVHRWRRLLPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGSPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGLW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFSEKVWT 262          

HSP 2 Score: 65.4698 bits (158), Expect = 1.404e-10
Identity = 55/245 (22.45%), Postives = 102/245 (41.63%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD 877
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + GLW+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ I+ +  IP    N    + R  + +F G    + +  +L+ F+F    W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D
Sbjct:  111 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGLWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFSEKVWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQSWEVIQASPD 325          

HSP 3 Score: 55.8398 bits (133), Expect = 1.575e-7
Identity = 65/332 (19.58%), Postives = 126/332 (37.95%), Query Frame = 2
Query:  137 QIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAY-KNHLYIFGGAFTYDVRNCPFWI-------YNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCT-----------QYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEI-CNDLWQWNFNEY-------QWTKLMYKGDISDLAYI---TDVKINNH---------WLFFGINDTRRKTEKFIYSFSQNKWTTSAYC 1015
            +I  R PVAR  H   +Y + L++  GY     L D+W + L +                       ++  WE++ +  G+I P   +  VA  ++ +++F G     + N  F           I  + + +  P     P P  R  H+   +   L +FGG  D      +L  +D ++  W +I  +            +L   +K+S  +YG   R  H A +  + ++IFGG     +   +++++ F+ Y        + +L       D+ +I    + ++  H         WL   I   R + ++       ++  T + C
Sbjct:  162 KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQD----------------------RDLTCWEEIEQ-SGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFSEKVWTRIPTEHLLRGSP-----PPPQRRYGHTMVAFDRHLYVFGGAAD-NTLPNELHCYDVDSQSWEVIQASPDSEHCKENAHNWLLDLMKKS--RYG-DGRLFHAAAVIADAMYIFGGTVDNNVRSGEMYRFQFSCYPKCTLHEDYGRLFENQQFCDVEFILGEKEERVRGHTAIVTARCKWLRKKIMQARERQKQVKDEMQNSQQKTESAC 461          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Xenopus
Match: lztr1 (leucine-zipper-like transcription regulator 1 [Source:NCBI gene;Acc:100158621])

HSP 1 Score: 74.7146 bits (182), Expect = 1.609e-13
Identity = 68/250 (27.20%), Postives = 108/250 (43.20%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG   +V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     +     W ++   G+I  S   +   V  +  ++F G +  +     F + FS+  WT
Sbjct:   27 NFGPFESVHRWRRLLPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGSPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGLW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFSEKVWT 249          

HSP 2 Score: 65.855 bits (159), Expect = 1.056e-10
Identity = 61/270 (22.59%), Postives = 114/270 (42.22%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGINDTR 952
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + GLW+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ I+ +  IP    N    + R  + +F G    + +  +L+ F+F    W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D S++ Y    K  ++WL   +  +R
Sbjct:   98 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGLWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFSEKVWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQSWEVIQASPD-SEVMY----KNAHNWLLDLMKKSR 332          

HSP 3 Score: 55.8398 bits (133), Expect = 1.487e-7
Identity = 66/332 (19.88%), Postives = 126/332 (37.95%), Query Frame = 2
Query:  137 QIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAY-KNHLYIFGGAFTYDVRNCPFWI-------YNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCT-----QYLNKQ------LKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEI-CNDLWQWNFNEY-------QWTKLMYKGDISDLAYI---TDVKINNH---------WLFFGINDTRRKTEKFIYSFSQNKWTTSAYC 1015
            +I  R PVAR  H   +Y + L++  GY     L D+W + L +                       ++  WE++ +  G+I P   +  VA  ++ +++F G     + N  F           I  + + +  P     P P  R  H+   +   L +FGG  D      +L  +D ++  W +I  +      Y N        +K+S  +YG   R  H A +  + ++IFGG     +   +++++ F+ Y        + +L       D+ +I    + ++  H         WL   I   R + ++       ++  T + C
Sbjct:  149 KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQD----------------------RDLTCWEEIEQ-SGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFSEKVWTRIPTEHLLRGSP-----PPPQRRYGHTMVAFDRHLYVFGGAAD-NTLPNELHCYDVDSQSWEVIQASPDSEVMYKNAHNWLLDLMKKS--RYGD-GRLFHAAAVIADAMYIFGGTVDNNVRSGEMYRFQFSCYPKCTLHEDYGRLFENQQFCDVEFILGEKEERVRGHTAIVTARCKWLRKKIMQARERQKQVKDEMQNSQQKTESAC 448          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Mouse
Match: Lztr1 (leucine-zipper-like transcriptional regulator, 1 [Source:MGI Symbol;Acc:MGI:1914113])

HSP 1 Score: 75.0998 bits (183), Expect = 9.262e-14
Identity = 67/250 (26.80%), Postives = 107/250 (42.80%), Query Frame = 2
Query:  326 NFG--NNVNLWEDLS---KFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     + +   W ++   G+I  S   +   V  +  ++F G +  +     F + F    WT
Sbjct:   41 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFKDKTWT 263          

HSP 2 Score: 62.003 bits (149), Expect = 1.298e-9
Identity = 51/240 (21.25%), Postives = 93/240 (38.75%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCP-------FWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            R KH  V Y + +Y+ GG +    L DL R ++ + +            W      G                +P   H+ V Y + +++FGG +T D+ +          + Y        +WK   +   +P  R  H   +Y   L IF G+ D    L D+W    +  +    W     + ++  S   +           + ++ +F+F G  G +I N+L+Q+ F +  WT++
Sbjct:   65 RSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCS------------WCRAFTTGT-------------PPAPRYHHSAVVYGSSMFVFGG-YTGDIYSNSNLKNKNDLFEYKFATGQWTEWK---IEGRLPVARSAHGATVYSDKLWIFAGY-DGNARLNDMWTIGLQDREL-TCWEEVAQSGEIPPSCCNFP--------VAVCRDKMFVFSGQSGAKITNNLFQFEFKDKTWTRI 265          

HSP 3 Score: 60.077 bits (144), Expect = 5.043e-9
Identity = 53/245 (21.63%), Postives = 101/245 (41.22%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD 877
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ +  +  IP    N    + R  + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D
Sbjct:  112 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGQWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFKDKTWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDFQTWEVVQPSSD 326          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Mouse
Match: Lztr1 (leucine-zipper-like transcriptional regulator, 1 [Source:MGI Symbol;Acc:MGI:1914113])

HSP 1 Score: 67.3958 bits (163), Expect = 3.093e-12
Identity = 57/197 (28.93%), Postives = 87/197 (44.16%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRGS-----LGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWT 856
            NFG    V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+  +       DL+ + F TG+W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     + + T
Sbjct:   41 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRELT 210          

HSP 2 Score: 53.5286 bits (127), Expect = 1.232e-7
Identity = 39/144 (27.08%), Postives = 65/144 (45.14%), Query Frame = 2
Query:  551 RRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCG-------LEICNDLWQWNFNEYQWTKLMYKG--DISDLAYITDVKINNHWLFFGINDTRR 955
            R  H+   Y+ A+ +FGG  + +  L DL  FD +       WC  +             P  R+ H AV++ + +F+FGG  G       L+  NDL+++ F   QWT+   +G   ++  A+   V  +  W+F G +   R
Sbjct:   65 RSKHTVVAYKDAIYVFGG-DNGKTMLNDLLRFDVK----DCSWCRAFTTGTP--------PAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQWTEWKIEGRLPVARSAHGATVYSDKLWIFAGYDGNAR 195          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Mouse
Match: Lztr1 (leucine-zipper-like transcriptional regulator, 1 [Source:MGI Symbol;Acc:MGI:1914113])

HSP 1 Score: 69.707 bits (169), Expect = 5.097e-12
Identity = 66/244 (27.05%), Postives = 103/244 (42.21%), Query Frame = 2
Query:  326 NFG--NNVNLWEDLS---KFVGKISPLQSHTMVAYKNHLYIFG---GAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAYK+ +Y+FG   GAFT                              P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     + +   W ++   G+I  S   +   V  +  ++F G +  +     F + F    WT
Sbjct:   41 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGAFT--------------------------TGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFKDKTWT 244          

HSP 2 Score: 59.6918 bits (143), Expect = 6.259e-9
Identity = 53/245 (21.63%), Postives = 101/245 (41.22%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD 877
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ +  +  IP    N    + R  + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D
Sbjct:   93 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGQWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFKDKTWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDFQTWEVVQPSSD 307          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Mouse
Match: Klhdc10 (kelch domain containing 10 [Source:MGI Symbol;Acc:MGI:1924038])

HSP 1 Score: 62.003 bits (149), Expect = 9.381e-10
Identity = 72/290 (24.83%), Postives = 109/290 (37.59%), Query Frame = 2
Query:  137 QIPNRY------PVARWKHATVIYDNYLYLMGGYSWT------------NTLKDLWRLNLSE-------LNRIMTNQFKSIGLWSSIGNF--------------GNNVNL-------WEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGD-VRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYG-PRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            +IPNR+      P AR  H  V  +  LY+ GGY+                 ++LWR + +         +  M  +  S+ L     N               GN+V++       W  LS    + S +    M      LY+FGG   Y + +      ++   +  + KP +++  +P  R  H        + I GG       SL  + A++ ET  W  I    +          K G P AR  H  V  KN +FI GG  G  I  D+W+ N   +QW KL
Sbjct:   74 RIPNRFLRGHRPPPARSGHRCVADNTNLYVFGGYNPDYDESGGPDNEDYPLFRELWRYHFATGVWHQMGTDGYMPRELASMSLVLHGNNLLVFGGTGIPFGESNGNDVHVCNVKYKRWALLSCRGKRPSRIYGQAMALINGSLYVFGGTTGY-IYSTDLHKLDLNTMVWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPH---------EKIGFPAARRCHSCVQIKNDVFICGGYNGEVILGDIWKLNLQTFQWVKL 353          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Mouse
Match: Lztr1 (leucine-zipper-like transcriptional regulator, 1 [Source:MGI Symbol;Acc:MGI:1914113])

HSP 1 Score: 60.4622 bits (145), Expect = 1.119e-9
Identity = 56/243 (23.05%), Postives = 106/243 (43.62%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWR-LNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD 877
            P  R+ H+ V+Y + +++ GGY+      D++   NL   N +   +F + G W+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ +  +  IP    N    + R  + +F G    + +  +L+ F+F+   W  I  T++L   L+ S     P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D
Sbjct:   25 PAPRYHHSAVVYGSSMFVFGGYT-----GDIYSNSNLKNKNDLFEYKF-ATGQWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFKDKTWTRI-PTEHL---LRGSPPP--PQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDFQTWEVVQPSSD 239          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. UniProt/SwissProt
Match: sp|Q8RWD9|ACBP5_ARATH (Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=ACBP5 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.192e-14
Identity = 98/430 (22.79%), Postives = 159/430 (36.98%), Query Frame = 2
Query:   92 DTLSTYKSNIEICSHQIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIH-KNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDI-SDLAYITDVKINNHWLFFGINDTRRKTEK-FIYSFSQNKWTTSAYCIPEFHPFST--LSWFSNS-NDTDIFCDKVSQKG----KLNKIHPIFIDSFEN---------DTFESINLQSCCIQSSAVKVRSFENY------RQLNSVE-SLSKETISTDLTDNSLCE 1303
            DT+S Y    +  + +   + P AR++H   +  + +Y+ GG      L DL  L+L                WS +      V      +    K++    H+++ + N L   GG       + P  ++++       W  +      P  R   S  +   +LVIFGG    R  L DL   D +T  W  I              V   P  R DH A +H + +L IFGG       +DL   +    +W++   +GD  +  A    V I  +W   G  D +    K  + + S   W+     + E  P ++  LS   +S N  DI        G    ++N + P    S ++         D+F ++N  +     S +KV    +        +   VE SL+KE I T      L E
Sbjct:  164 DTVSVYN---QWTAPRTSGQPPKARYQHGAAVIQDKMYMYGGNHNGRYLGDLHVLDLKNWT------------WSRVET---KVVTGSQETSSPAKLTHCAGHSLIPWDNQLLSIGGHTKDPSESMPVMVFDLH---CCSWSILKTYGKPPISRGGQSVTLVGKSLVIFGGQDAKRSLLNDLHILDLDTMTWEEI------------DAVGSPPTPRSDHAAAVHAERYLLIFGGGSHATCFDDLHVLDLQTMEWSRHTQQGDAPTPRAGHAGVTIGENWYIVGGGDNKSGASKTVVLNMSTLAWSV-VTSVQEHVPLASEGLSLVVSSYNGEDIVVAFGGYNGHYNNEVNVLKPSHKSSLKSKIMGASAVPDSFSAVNNATTRDIESEIKVEGKADRIITTLKSEKEEVEASLNKEKIQTLQLKEELAE 559          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. UniProt/SwissProt
Match: sp|Q9MA55|ACBP4_ARATH (Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.247e-13
Identity = 71/314 (22.61%), Postives = 113/314 (35.99%), Query Frame = 2
Query:   89 KDTLSTYKSNIEI----CSHQIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNH-LFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDI-SDLAYITDVKINNHWLFFGINDTRR-KTEKFIYSFSQNKWTTSA 1009
            KD +S   + + +     + Q   + P AR++H   +  + +Y+ GG      L DL  L+L                WS +      V      +     ++P   H+++A+ N L   GG       +    +++        W  +      P  R   S  +    LVIFGG    R  L DL   D +T  W  I              V   P  R DH A +H    L IFGG       +DL   +    +W++   +GD  +  A    V I  +W   G  D +   +E  + + S   W+  A
Sbjct:  155 KDVVSEDSNTVSVYNQWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWT------------WSRVET---KVATESQETSTPTLLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTIT---WSMLKTYGKPPVSRGGQSVTMVGKTLVIFGGQDAKRSLLNDLHILDLDTMTWDEI------------DAVGVSPSPRSDHAAAVHAERFLLIFGGGSHATCFDDLHVLDLQTMEWSRPAQQGDAPTPRAGHAGVTIGENWFIVGGGDNKSGASESVVLNMSTLAWSVVA 438          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. UniProt/SwissProt
Match: sp|Q5R4Q7|LZTR1_PONAB (Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii OX=9601 GN=LZTR1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.260e-13
Identity = 67/250 (26.80%), Postives = 108/250 (43.20%), Query Frame = 2
Query:  326 NFG--NNVNLWEDLS---KFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     + +   W ++   G+I  S   +   V+ +  ++F G +  +     F + F    WT
Sbjct:   44 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYAGDIYSNSNLKNKNDLFEYKFATGQW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVRRDKMFVFSGQSGAKITNNLFQFEFKDKTWT 266          

HSP 2 Score: 62.003 bits (149), Expect = 1.008e-8
Identity = 50/240 (20.83%), Postives = 92/240 (38.33%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCP-------FWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            R KH  V Y + +Y+ GG +    L DL R ++ + +            W      G                +P   H+ V Y + +++FGG +  D+ +          + Y        +WK   +   +P  R  H   +Y   L IF G+ D    L D+W    +  +    W     + ++  S   +           + ++ +F+F G  G +I N+L+Q+ F +  WT++
Sbjct:   68 RSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCS------------WCRAFTTGT-------------PPAPRYHHSAVVYGSSMFVFGG-YAGDIYSNSNLKNKNDLFEYKFATGQWTEWK---IEGRLPVARSAHGATVYSDKLWIFAGY-DGNARLNDMWTIGLQDREL-TCWEEVAQSGEIPPSCCNFP--------VAVRRDKMFVFSGQSGAKITNNLFQFEFKDKTWTRI 268          

HSP 3 Score: 60.8474 bits (146), Expect = 2.273e-8
Identity = 53/245 (21.63%), Postives = 101/245 (41.22%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD 877
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ +  +  IP    N    + R  + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D
Sbjct:  115 PAPRYHHSAVVYGSSMFVFGGYAGDIYSNS-------NLKNKNDLFEYKF-ATGQWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVRRDKMFVFSGQSGAKIT-NNLFQFEFKDKTWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDFQTWEVVQPSSD 329          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. UniProt/SwissProt
Match: sp|Q9CQ33|LZTR1_MOUSE (Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus OX=10090 GN=Lztr1 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 6.478e-13
Identity = 67/250 (26.80%), Postives = 107/250 (42.80%), Query Frame = 2
Query:  326 NFG--NNVNLWEDLS---KFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++        I    P AR  H A ++ + L+IF G  G    ND+W     + +   W ++   G+I  S   +   V  +  ++F G +  +     F + F    WT
Sbjct:   41 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW-------KIEGRLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFKDKTWT 263          

HSP 2 Score: 62.003 bits (149), Expect = 9.078e-9
Identity = 51/240 (21.25%), Postives = 93/240 (38.75%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCP-------FWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            R KH  V Y + +Y+ GG +    L DL R ++ + +            W      G                +P   H+ V Y + +++FGG +T D+ +          + Y        +WK   +   +P  R  H   +Y   L IF G+ D    L D+W    +  +    W     + ++  S   +           + ++ +F+F G  G +I N+L+Q+ F +  WT++
Sbjct:   65 RSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCS------------WCRAFTTGT-------------PPAPRYHHSAVVYGSSMFVFGG-YTGDIYSNSNLKNKNDLFEYKFATGQWTEWK---IEGRLPVARSAHGATVYSDKLWIFAGY-DGNARLNDMWTIGLQDREL-TCWEEVAQSGEIPPSCCNFP--------VAVCRDKMFVFSGQSGAKITNNLFQFEFKDKTWTRI 265          

HSP 3 Score: 60.077 bits (144), Expect = 3.527e-8
Identity = 53/245 (21.63%), Postives = 101/245 (41.22%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQS-HTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD 877
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W    K  G++   +S H    Y + L+IF G +  + R    W   + ++ +  W+ +  +  IP    N    + R  + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D
Sbjct:  112 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGQWTE----------W----KIEGRLPVARSAHGATVYSDKLWIFAG-YDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFKDKTWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDFQTWEVVQPSSD 326          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. UniProt/SwissProt
Match: sp|Q9C8K7|FBK21_ARATH (F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana OX=3702 GN=At1g51550 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.385e-13
Identity = 74/312 (23.72%), Postives = 124/312 (39.74%), Query Frame = 2
Query:   83 FKKDTLSTYKSNIEICSHQIPNRYPVARWKHATVIYDNYLYLMGGYSWTNT-LKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNA---PIPFPRRNHS-CCIYRSALVIFGGFGDVRGSLGDLWAF----DFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHR-AVIHKNHLFIFGGM-CGLEICNDLWQWNFN---EYQWTKLMYK-GDISDLAYITDVK------INNHWLFFGINDTRR 955
            +K D++  +K +      +  + +P+ R  H+    +++L L GG       L D W   + + N+ +  ++K +   +  G FG                     HT +    +L +FGG      R    WI  +       WK ++V +   P P PR  HS CCI    +V+ GG G     LGD W      DF +G WH++   Q              P  R  H    I +N + +FGG   G ++ +D+W  +     E +W ++ Y   D+ + A +  V       +    L +G  D+ R
Sbjct:   96 YKMDSVCCHKISDPDDDDEESSSFPIPRASHSLNFVNDHLVLFGGGCQGGRHLDDTWTSYVDKSNQSIL-KWKKVKSGTPSGRFG---------------------HTCIVIGEYLLLFGGINDRGERLNDTWIGQVFCHEGLSWKLLNVGSLQRPRPPPRGAHSACCIAEKKMVVHGGIGLNGVRLGDTWILELSEDFSSGTWHMVESPQL-------------PPPRSGHTLTCIRENQVVLFGGRGLGYDVLDDVWILDIQEPCEEKWIQIFYDFQDVPEYASLPRVGHSATLVLGGRILIYGGEDSYR 372          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. TrEMBL
Match: C3Y4D4 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_89663 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.133e-40
Identity = 93/278 (33.45%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFT-YDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFS 985
            P  R KHA  ++D  L+L GG     T KDLW+ +L       TNQ      WSS+   G+  ++             LQ H+MVAYK  LY+FGG+    D R  P WIY+I  ++ +   P +    IP  RR+H+  I  +++ I+GG+ D++GS G+LW F FETG WHL    Q            + P  RH H  V+H  +++++GG+  L    DLW+WNF +  W+++ ++    +L+  + VK  +  L FG  D+     + ++ FS
Sbjct:   67 PCNRSKHAACVHDGSLFLYGGRDVRATRKDLWQCDL------RTNQ------WSSVQTHGDAPSM-------------LQEHSMVAYKGRLYLFGGSLGCSDDREKPLWIYDIEGEVWRNHLP-ESEVKIPIGRRSHTAVISHNSMHIYGGYIDLKGSSGELWTFVFETGHWHLSSDGQ----------TNHSPLPRHSHSTVVHDGNMWVYGGLNNLHPLGDLWKWNFEKRAWSRIRFRSGPPELSGHSAVKAAHCMLVFGGQDSSGTLRQDMWRFS 308          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. TrEMBL
Match: E2B0W6 (Tip elongation aberrant protein 1 OS=Camponotus floridanus OX=104421 GN=EAG_14887 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.222e-39
Identity = 91/295 (30.85%), Postives = 140/295 (47.46%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDV-RNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGINDTRRKT-EKFIYSFSQNKWTTSAYCIPEFHP 1033
            P +R KH+  +   ++YL+GG +    LKDLWR +L+E                         + WE+L     +   LQ H+ VAYK+ LY+FGG   +      P W+YN+   + +K +       +P  RR H+  ++R  ++I+GG+ D+RGS  +LWAF FET  WHL+            S  + GP ARH H AV+H + ++I+GGM  L+  ND W+W+ N   W+ L  K     L      ++ +  L FG       T E + + F    W   +   P+  P
Sbjct:   16 PPSRSKHSATLLAGHVYLLGGRNGNLPLKDLWRYSLAE-------------------------SKWEELYPGGERPPALQEHSAVAYKDCLYVFGGELGFSAGTETPLWVYNVKTNVWRKVR-AQRGCAVPRGRRGHTALVHRGQMLIYGGYQDLRGSSSELWAFHFETESWHLL------------SSSESGPAARHKHSAVLHGDAMYIYGGMTDLQERNDCWRWDVNSASWSMLKNKPGPGPLHGHAACRLPSCMLIFGGESGGLATNELWRFHFGTETWEKLSVPGPKPQP 272          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. TrEMBL
Match: A0A158NFK4 (Uncharacterized protein OS=Atta cephalotes OX=12957 GN=105619401 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.256e-38
Identity = 91/295 (30.85%), Postives = 140/295 (47.46%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDV-RNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGINDTRRKT-EKFIYSFSQNKWTTSAYCIPEFHP 1033
            P +R KH+  +   ++YL+GG +    LKDLWR +L+E                         + WE+L     +   LQ H+ VAYK+ LY+FGG   +      P W+YN+   + +K +       IP  RR H+  ++R  ++I+GG+ D+RGS  +LW+F FET  WHL+            S  + GP ARH H AV+H + ++I+GGM  L+  ND W+W+ N   W+ L  K     L      ++ +  L FG       T E + + F    W   +   P+  P
Sbjct:   16 PPSRSKHSATLLAGHVYLLGGRNGNLPLKDLWRYSLAE-------------------------SKWEELHPGGERPPALQEHSAVAYKDCLYVFGGELGFSAGTETPLWVYNVKTNVWRKVR-AQRGCVIPRGRRGHTALVHRGQMLIYGGYQDLRGSSSELWSFHFETESWHLL------------SSSESGPAARHKHSAVLHGDAMYIYGGMTDLQERNDCWRWDVNSASWSMLKNKPGPGPLHGHAACRLPSCMLIFGGESGGLATNELWRFHFGTETWEKLSVPGPKPQP 272          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. TrEMBL
Match: F4X1B3 (Transcription factor Sp4 OS=Acromyrmex echinatior OX=103372 GN=G5I_12072 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.720e-38
Identity = 91/295 (30.85%), Postives = 140/295 (47.46%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDV-RNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGINDTRRKT-EKFIYSFSQNKWTTSAYCIPEFHP 1033
            P +R KH+  +   ++YL+GG +    LKDLWR +L+E                         + WE+L     +   LQ H+ VAYK+ LY+FGG   +      P W+YN+   + +K +       IP  RR H+  ++R  ++I+GG+ D+RGS  +LW+F FET  WHL+            S  + GP ARH H AV+H + ++I+GGM  L+  ND W+W+ N   W+ L  K     L      ++ +  L FG       T E + + F    W   +   P+  P
Sbjct:   16 PPSRSKHSATLLAGHVYLLGGRNGNLPLKDLWRYSLAE-------------------------SKWEELHPGGERPPALQEHSAVAYKDCLYVFGGELGFSAGTETPLWVYNVKTNVWRKVR-AQRGCVIPRGRRGHTALVHRGQMLIYGGYQDLRGSSSELWSFHFETESWHLL------------SSSESGPAARHKHSAVLHGDAMYIYGGMTDLQERNDCWRWDVNSASWSMLKNKPGPGPLHGHAACRLPSCMLIFGGESGGLATNELWRFHFGTETWEKLSVSGPKPQP 272          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. TrEMBL
Match: A0A3L8DC03 (Uncharacterized protein (Fragment) OS=Ooceraea biroi OX=2015173 GN=DMN91_010123 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.840e-38
Identity = 85/262 (32.44%), Postives = 129/262 (49.24%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDV-RNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFG 937
            P +R KH+  +   ++YL+GG +    LKDLWR +L+E                         + WE+L     +   LQ H+ VAYK+ LY+FGG   +      P W+YN+     +K +       +P  RR H+  ++R  ++I+GG+ D+RGS  +LWAF FET  WHL+            S  + GP ARH H AV+H + ++I+GGM  L+  ND W+W+ N   W+ L  K     L      ++ +  L FG
Sbjct:   18 PPSRSKHSATLLAGHVYLLGGRNGNLPLKDLWRYSLAE-------------------------SKWEELHPGGERPPALQEHSAVAYKDCLYVFGGELGFSAGTETPLWVYNVKTNTWRKVR-AQRGCAVPRGRRGHTALVHRGQMLIYGGYQDLRGSSPELWAFHFETESWHLL------------SSSENGPAARHKHSAVLHGDAMYIYGGMTDLQERNDCWRWDVNSASWSMLKNKPGPGPLHGHAACRLPSCMLIFG 241          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Cavefish
Match: si:dkey-3d4.3 (si:dkey-3d4.3 [Source:ZFIN;Acc:ZDB-GENE-070912-527])

HSP 1 Score: 68.9366 bits (167), Expect = 1.690e-13
Identity = 50/178 (28.09%), Postives = 79/178 (44.38%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISP--LQSHTMVAYKNHLYIFGGAF--TYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLI 676
            P  R+KHA+  +   +YL+GG    ++L+D W+ N+                           N W +L    G  +P  L+ H+MVA++  LY+FGG     Y     P W             P D +  +P  R+ HS  +  S++ I+GG+ D+RG+  + W  D  TG W L+
Sbjct:   20 PCDRYKHASCAFRGNIYLLGGRK-KHSLRDFWKYNVR--------------------------NEWIEL-DCGGDQAPEELEEHSMVAHQGVLYVFGGLIDSAYSNSKSPLW-------------PFDTHV-MPSNRKGHSAVVMESSMYIYGGYIDMRGTSQEFWRLDL-TGTWSLL 154          

HSP 2 Score: 48.521 bits (114), Expect = 2.240e-6
Identity = 38/156 (24.36%), Postives = 63/156 (40.38%), Query Frame = 2
Query:  335 NNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNA-PIPFPRRNHSCCIYRSALVIFGGFGD--VRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGG 793
            N+  LW  + +          H   A++ ++Y+ GG   + +R+  FW YN+ N+    W  +D      P     HS   ++  L +FGG  D     S   LW FD      H++                  P  R  H AV+ ++ ++I+GG
Sbjct:    5 NSPCLWTSVPQVCPAPCDRYKHASCAFRGNIYLLGGRKKHSLRD--FWKYNVRNE----WIELDCGGDQAPEELEEHSMVAHQGVLYVFGGLIDSAYSNSKSPLWPFDT-----HVM------------------PSNRKGHSAVVMESSMYIYGG 131          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Cavefish
Match: lztr1 (leucine zipper like transcription regulator 1 [Source:NCBI gene;Acc:103040653])

HSP 1 Score: 70.4774 bits (171), Expect = 2.287e-12
Identity = 65/250 (26.00%), Postives = 112/250 (44.80%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAY++ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++   +++  +V     AR  H A ++ + L+IF G  G    ND+W     + +   W ++   G+I  S   +   V  +  ++F G +  +     F + F+ + WT
Sbjct:   34 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYRDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW---KVEGRLV-----ARSAHGATVYNDKLWIFAGYDGNARLNDMWTIGLQDREQACWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQFEFNGHIWT 255          

HSP 2 Score: 65.0846 bits (157), Expect = 9.907e-11
Identity = 61/285 (21.40%), Postives = 115/285 (40.35%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD---ISDLAYITDVKINNHWLFFG--INDTRRKTEKFIYSFS 985
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W    K  G++    +H    Y + L+IF G +  + R    W   + ++    W+ I+ +  IP    N    + R  + +F G    + +  +L+ F+F    W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D    S   +     I++    FG  +++  R  E + + FS
Sbjct:  105 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKF-ATGQWTE----------W----KVEGRLVARSAHGATVYNDKLWIFAG-YDGNARLNDMWTIGLQDREQACWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKIT-NNLFQFEFNGHIWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQTWEVIQPSTDSEMPSGRLFHAAAVIHDAMYIFGGTVDNNVRSGEMYRFQFS 359          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Cavefish
Match: hcfc2 (host cell factor C2 [Source:NCBI gene;Acc:103047617])

HSP 1 Score: 60.077 bits (144), Expect = 3.583e-9
Identity = 52/211 (24.64%), Postives = 79/211 (37.44%), Query Frame = 2
Query:  359 LSKFVGKISP-LQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDV-NAPIPFPRRNHSCCIYRSALVIFGGF--------GDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKN------HLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKG--DISDLAYITDVKINNHWLFFG 937
            L    G I P   +H  V     + +FGG   +       +       + +K KP    NAP P PR  HS  ++ +   +FGG         G+V   L D +  + +       W       +        GP AR  H  V +         L+IFGGMCG  + +DLWQ +     W+     G   +    +  +V  N  ++F G
Sbjct:   60 LPAVRGDIPPGCAAHGFVCEGTRILVFGGMVEFGKYTSSLYELQASRWLWKKLKPRSPRNAPPPCPRLGHSFTLHGNKCYLFGGLANDSEDPNGNVPRYLDDFYELELQAQSGVKGWSVPETRGR--------GPSARESHTCVAYGGKGGGSPKLYIFGGMCGKRL-SDLWQLDIETMTWSIPQATGPCPLPRSLHSANVIGNQMYVFGG 261          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Cavefish
Match: krcp (rab9 effector protein with kelch motifs-like [Source:NCBI gene;Acc:103045721])

HSP 1 Score: 58.151 bits (139), Expect = 1.360e-8
Identity = 42/166 (25.30%), Postives = 73/166 (43.98%), Query Frame = 2
Query:  374 GKISPLQSHTMVAYKNHLYIFGGAFTY---DVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            GK+ PL  H+   ++  L++FGG F     +   C   +Y    ++   ++PI VN   P PR  HS C+ +  + IF G+ D      D++  D          C    +  ++ S     PR+ HD  A ++     + GG  G +  +D + ++ +   WT L
Sbjct:  314 GKVPPLAYHSCTLFRGELFVFGGVFPRPHPEPDGCSDSLYIFNPEMAIWYQPI-VNGNKPAPRSGHSACVMQGKIFIFAGW-DTPVCFNDMFQLDL---------CLMEFSA-VQTSGSAPSPRSWHDC-AALNDTRFLVHGGYNGNDALSDTFIFDTDTSCWTSL 466          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Cavefish
Match: klhdc2 (kelch domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-070410-69])

HSP 1 Score: 56.225 bits (134), Expect = 3.878e-8
Identity = 71/315 (22.54%), Postives = 118/315 (37.46%), Query Frame = 2
Query:  131 SHQIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTL---------KDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTM-VAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPI-DVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQL-----------KRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMY--KGDISDLAYITDVKINNHWLFFGINDTRRKT--EKFIYSFSQNKW 997
            S   P   P  R  H  V+  N +Y+ GGY  T            K++W  N+              G W               LSK  G++    S +  V     LY+FGG +     N  + +    + ++  W+ + D+    P  +    C +Y++ LV FGG+G V    G L AF+ +          +  N  +           + +     P  R  H      N  F+FGG       NDL+  N + ++W+++    +G +    +      N+H   FG   T R+T  + ++Y  S N+W
Sbjct:   55 SKSCPGDTPAERSGHVAVVDRNCMYVWGGYKVTTATAFVDLYLPKKEVWIYNME------------TGRWRM------------QLSK--GELPAAMSGSCGVCIDGILYVFGGHYARGNTNLVYRLPLRSSSLV--WERMKDLKGLAPTCKDKLGCWVYKNRLVYFGGYGHV-AQAGHLGAFELDENSLMGNHAARGWNNHIHILNLETSTWSQPATKGNAPTPRAAHACATIGNRGFVFGGRYMDHRLNDLYCINMDSWEWSEMSVPQQGPVGRSWHSFIPVSNDHIFLFGGFTTNRETLSDAWLYCVSTNEW 340          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Sea Lamprey
Match: lztr1 (leucine-zipper-like transcription regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9564])

HSP 1 Score: 65.855 bits (159), Expect = 1.288e-11
Identity = 55/221 (24.89%), Postives = 96/221 (43.44%), Query Frame = 2
Query:  398 HTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRGS-----LGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQ---WNFNEYQWTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            HT+VAYK+ +Y+FGG            +DV++C              W         P PR +HS  ++ S++ +FGG+ GD+  +       D++ + F TG+W     T++        +    P AR  H A ++++ L+IF G  G    ND+W     N     W ++   G+I  S   +   V  +  ++F G +  +     F + F+Q  + 
Sbjct:    6 HTVVAYKDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWGRAFTMGVPPAPRYHHSAVVHGSSMFVFGGYTGDIYSNSNLKNKNDMFEYKFATGQW-----TEW-------KVEGRLPVARSAHGATVYEDKLWIFAGYDGNARLNDMWTICLLNREAACWEEIEQSGEIPPSCCNFPVAVCRDRMFVFSGQSGAKITNSLFQFHFTQRMYA 201          

HSP 2 Score: 56.225 bits (134), Expect = 1.419e-8
Identity = 38/144 (26.39%), Postives = 65/144 (45.14%), Query Frame = 2
Query:  551 RRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCG-------LEICNDLWQWNFNEYQWTKLMYKG--DISDLAYITDVKINNHWLFFGINDTRR 955
            R  H+   Y+ A+ +FGG  + +  L DL  FD +   W   +             +   P  R+ H AV+H + +F+FGG  G       L+  ND++++ F   QWT+   +G   ++  A+   V  +  W+F G +   R
Sbjct:    3 RSKHTVVAYKDAIYVFGG-DNGKNMLNDLLRFDVKDCSWGRAF------------TMGVPPAPRYHHSAVVHGSSMFVFGGYTGDIYSNSNLKNKNDMFEYKFATGQWTEWKVEGRLPVARSAHGATVYEDKLWIFAGYDGNAR 133          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Sea Lamprey
Match: zgc:163014 (zgc:163014 [Source:ZFIN;Acc:ZDB-GENE-070424-100])

HSP 1 Score: 65.0846 bits (157), Expect = 1.708e-11
Identity = 69/270 (25.56%), Postives = 108/270 (40.00%), Query Frame = 2
Query:  155 PVARWKHATVIYD-NYLYLMGGYSWTNTL-KD-LWRLNL----------------------------SELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTY---DVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            P ARW H+  + D   + L+GG     T  KD +W+L++                            SE+ RI        G W S  +  +       L +  GK+ PL  H+   +++ L++FGG F         C   +Y    Q    ++PI V   +P PR  HS  + ++ LVIFGG+ D      DL   D        +   +Y   Q++ ++    PR  H   A +  N + I GG  G     D   +N +  +WT+L
Sbjct:  178 PSARWGHSLCLIDPQTVILIGGQGHRMTFCKDPIWKLHIENNSWLPAETVATGKTPECRIGHTATFDSEMRRIYVFGGSKNGKWFSDMHILDMATWKWQLVEAKGKVPPLAYHSSTLFRHELFVFGGVFPLPNPQPDGCSNQLYIFNPQHSIWYQPIVVGD-LPCPRSGHSMILLKNKLVIFGGW-DAPMCFSDLHVLD--------LGFMEYAPVQVQGAVPS--PRCWHA-SAPVSDNRMIIHGGYNGQRALTDTHIFNVDTSEWTQL 434          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Sea Lamprey
Match: zgc:163014 (zgc:163014 [Source:ZFIN;Acc:ZDB-GENE-070424-100])

HSP 1 Score: 64.6994 bits (156), Expect = 2.366e-11
Identity = 69/270 (25.56%), Postives = 108/270 (40.00%), Query Frame = 2
Query:  155 PVARWKHATVIYD-NYLYLMGGYSWTNTL-KD-LWRLNL----------------------------SELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTY---DVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            P ARW H+  + D   + L+GG     T  KD +W+L++                            SE+ RI        G W S  +  +       L +  GK+ PL  H+   +++ L++FGG F         C   +Y    Q    ++PI V   +P PR  HS  + ++ LVIFGG+ D      DL   D        +   +Y   Q++ ++    PR  H   A +  N + I GG  G     D   +N +  +WT+L
Sbjct:  170 PSARWGHSLCLIDPQTVILIGGQGHRMTFCKDPIWKLHIENNSWLPAETVATGKTPECRIGHTATFDSEMRRIYVFGGSKNGKWFSDMHILDMATWKWQLVEAKGKVPPLAYHSSTLFRHELFVFGGVFPLPNPQPDGCSNQLYIFNPQHSIWYQPIVVGD-LPCPRSGHSMILLKNKLVIFGGW-DAPMCFSDLHVLD--------LGFMEYAPVQVQGAVPS--PRCWHA-SAPVSDNRMIIHGGYNGQRALTDTHIFNVDTSEWTQL 426          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001771.1 (pep scaffold:Pmarinus_7.0:GL480830:19416:31634:1 gene:ENSPMAG00000001606.1 transcript:ENSPMAT00000001771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 3.374e-9
Identity = 40/159 (25.16%), Postives = 69/159 (43.40%), Query Frame = 2
Query:  398 HTMVAYKNHLYIFGGAFTYD----VRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEIC--NDLWQWNFNEYQWT 856
            H  VA  + +Y FGG  + +    +R     I+N+ +    K  P+     +P+ R  H+  +   A+ ++GG  D  G+   L++FD  T +W            ++  +    P AR  H A   +  ++IFGG   L  C  ND+ + +     WT
Sbjct:   17 HAAVAVGHKVYSFGGYCSGEDYETLRQIDVHIFNLVSMRWSKLPPVIGPKQMPYMRYGHTAVLVEDAIYVWGGRNDTDGACNVLYSFDIYTHRW------------VRPHVSGPVPGARDGHSAAALRKCMYIFGGYEQLADCFSNDVHKMDTTTMTWT 163          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Sea Lamprey
Match: klhdc10 (kelch domain containing 10 [Source:ZFIN;Acc:ZDB-GENE-040426-776])

HSP 1 Score: 46.2098 bits (108), Expect = 3.773e-6
Identity = 39/146 (26.71%), Postives = 54/146 (36.99%), Query Frame = 2
Query:  536 PIPFPRRNHSCCIYRSALVIFGGFG---DVRGSLG--------DLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMC---GLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLF 931
            P P  R  H C    + L +FGG+    D  G  G        +LW +   TG WH +    Y  K+L    V            V+H + L  FGG     G    ND+   N     WT+L  +G      Y   + I +  L+
Sbjct:   15 PEPPARSGHRCIADSANLYVFGGYNPDFDESGGPGNAEYPLFRELWRYHLATGTWHRVPTDGYTPKELASMSV------------VLHGSSLLTFGGTGVPFGESSGNDVNVCNLRSRCWTRLPSRGRKPSKIYGQAMAIIHGALY 148          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Yeast
Match: KEL2 (Protein that negatively regulates mitotic exit; forms a complex with Kel1p and Bud14p that regulates Bnr1p (formin) to affect actin cable assembly, cytokinesis, and polarized growth; functions in a complex with Kel1p, interacts with Tem1p and Lte1p; localizes to regions of polarized growth; potential Cdc28p substrate [Source:SGD;Acc:S000003470])

HSP 1 Score: 63.5438 bits (153), Expect = 4.684e-11
Identity = 54/221 (24.43%), Postives = 85/221 (38.46%), Query Frame = 2
Query:  149 RYPVARWKHA-TVIYDN----YLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNH-LFIFGG 793
            R P+ R+ H  ++I  N     LYL GG        DL   +LS   R  ++                    WE L        PL +HTMVAY N L++FGG     + N  +      +    +W  +      P P + H+  +Y+  + + GG         D++  +  + KW+ +        ++K  I    P+ R  H   + KN  L I GG
Sbjct:  192 RRPLGRYGHKISIIASNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSH--------------------WEFLEPVGDLPPPLTNHTMVAYDNKLWVFGGETPKTISNDTYRY----DPAQSEWSKVKTTGEKPPPIQEHASVVYKHLMCVLGGKDTHNAYSNDVYFLNLLSLKWYKL-------PRMKEGI----PQERSGHSLTLMKNEKLLIMGG 377          

HSP 2 Score: 46.9802 bits (110), Expect = 6.571e-6
Identity = 52/215 (24.19%), Postives = 90/215 (41.86%), Query Frame = 2
Query:  404 MVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLG----DLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHR-AVIHKN----HLFIFGGMCGLEICNDLWQWNFNEYQ-----WTKLMYKGDI-SDLAYITDVKINNH-WLFFGINDTRRKTEKFIYSFSQNKWT 1000
            +V   N +++ GG     V    + I    +      K ID++   P PR  H+  I  +A V+FGG        G    DL+ F+  + KW +    Q + ++         P  R+ H+ ++I  N     L++FGG       NDL  ++ + ++     W  L   GD+   L   T V  +N  W+F G        + + Y  +Q++W+
Sbjct:   93 IVTNDNRIFVTGGLHDQSVYGDVWQIAANADGTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWTI---PQPIGRR---------PLGRYGHKISIIASNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGGETPKTISNDTYRYDPAQSEWS 295          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Yeast
Match: KEL3 (Cytoplasmic protein of unknown function [Source:SGD;Acc:S000006184])

HSP 1 Score: 58.151 bits (139), Expect = 2.034e-9
Identity = 47/165 (28.48%), Postives = 72/165 (43.64%), Query Frame = 2
Query:  416 KNHLYIFGGAFTYDVRNCP-----FWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIF--GGFGDVRGS----LGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGL-----EICNDLWQWNFNEYQWTKL 862
            K+ L+IFGG FT             + Y+I N   +K+  +  NAP+P  R + +  ++ S + +   G F   + S      D W FD          C +    +L+       P AR  HR +  KN+  +FGG   L        NDLW ++ + Y+WTKL
Sbjct:   92 KHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKY--VSQNAPLP--RSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFD----------CVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKL 242          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Yeast
Match: KEL1 (Protein required for proper cell fusion and cell morphology; forms a complex with Bud14p and Kel2p that regulates Bnr1p (formin) to affect actin cable assembly, cytokinesis, and polarized growth; functions in a complex with Kel2p to negatively regulate mitotic exit, interacts with Tem1p and Lte1p; localizes to regions of polarized growth; potential Cdc28p substrate [Source:SGD;Acc:S000001201])

HSP 1 Score: 49.6766 bits (117), Expect = 9.592e-7
Identity = 50/220 (22.73%), Postives = 82/220 (37.27%), Query Frame = 2
Query:  155 PVARWKH-----ATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYG-PRARHDHRAVIHKN-HLFIFGG 793
            P+ R+ H     AT      LY+ GG        DL   +LS   R  ++                    WE L        P+ + TM++Y + L++FGG     + N  F +Y+     +  W  ID     P P + H+  +Y   + + GG  +    L  ++  + ++ KW             K  +   G P+ R  H   + KN  + I GG
Sbjct:  234 PLGRYGHKISIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRRPDSH--------------------WEFLKPRTFTPPPITNFTMISYDSKLWVFGGDTLQGLVNDVF-MYDPA---INDWFIIDTTGEKPPPVQEHATVVYNDLMCVVGGKDEHDAYLNSVYFLNLKSRKW------------FKLPVFTAGIPQGRSGHSLTLLKNDKILIMGG 417          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Nematostella
Match: EDO44793 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR7])

HSP 1 Score: 128.257 bits (321), Expect = 2.476e-31
Identity = 79/265 (29.81%), Postives = 119/265 (44.91%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGINDT 949
            P +R K A  +  + LY+ GG    ++LKDLWR ++ +              W S+ + G+N            +   LQ HTM A+K  L IFGG FT      P W+++  +     W       P+   R++HS  +    L IFGG+ D+RG+  +LW +D  T KW             +RS     P  R+ H A +    + +FGG+  L+  NDLW WN    +WT++  KG    +   T  K+ +  L FG   T
Sbjct:  290 PRSRSKLAACLLHDSLYMYGGRGACSSLKDLWRYDIGD------------NAWMSVPSSGDN------------RPPSLQEHTMTAFKEKLIIFGGEFTSSTET-PLWMFDTTSL---SWSRSFQRGPVN--RKSHSAVVCGDCLFIFGGYIDIRGATNELWKYDIGTDKW-----------SRERSRSSQWPSPRYSHSAAVFDKSMVVFGGLEELQCKNDLWLWNIAAKKWTRIKAKGSPPPIFGHTAAKVGDGMLVFGGEST 513          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Nematostella
Match: EDO48221 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKB8])

HSP 1 Score: 79.7221 bits (195), Expect = 6.890e-16
Identity = 75/273 (27.47%), Postives = 112/273 (41.03%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWS-SIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGG----MCGLEICNDLWQWNFNEYQWTKLMYKGDISD--LAYITDVKINNHWLFFGINDTR 952
            P  R  H+     + LYL GG             N  E    +       GL++  IG        WE L    G+       T VA ++ LY+FGG +  +  N   ++ N GN     W P+  +  IP PR +H+C +      I GG G  +    DL+ FD  T  WH      Y+N Q         PR+ H   A  H   +++FGG      G    ND++++N ++ +W KL  +G   D  L +   +      +F G+ND R
Sbjct:   76 PCGRDGHSLNAVGSVLYLFGGS------------NFPEAEDCLD------GLYAYDIGTLS-----WE-LCPTQGRQPKTLGQTTVAIRDTLYVFGGIYRGEANN-KLYMLNTGNLT---WTPLVTSGQIPPPRCDHACTVIGEKFYISGGSGGEKTWFNDLYCFDTVTLIWH------YINAQGHLPF----PRSLHTICAY-HDKDIYLFGGTNDSAKGRSPFNDVFKFNLSKSKWKKLHCEGPTPDSRLGHCAIIIYGQMIVFGGMNDER 309          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Nematostella
Match: EDO28608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T602])

HSP 1 Score: 78.9518 bits (193), Expect = 1.454e-15
Identity = 61/207 (29.47%), Postives = 94/207 (45.41%), Query Frame = 2
Query:  350 WEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGG----MCGLEICNDLWQWNFNEYQWTKLMYKGDISD--LAYITDVKINNHWLFFGINDTR 952
            WE L    G+   +   T VA  + LY+FGG +  +  N   ++ N GN     W P+  +  IP PR +H+C +      I GG G  +    DL+ FD  T  WH      Y+N Q         PR+ H   A  H   +++FGG      G    ND++++N ++ +W KL  +G + D  L +   +      +F G+ND R
Sbjct:  408 WE-LCPTQGRQPKMLGQTTVAIGDTLYVFGGIYRGEANN-KLYMLNTGNLT---WTPLVTSGQIPPPRCDHACTVIGEKFYISGGSGGEKTWFNDLYCFDTVTLIWH------YINAQGHLPF----PRSLHTICAY-HDKDIYLFGGTNDSAKGRSPFNDVFKFNLSKSKWKKLHCEGPMPDRRLGHCAIIIYGQMIVFGGMNDER 598          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Nematostella
Match: EDO31221 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYI0])

HSP 1 Score: 71.2478 bits (173), Expect = 1.921e-13
Identity = 78/282 (27.66%), Postives = 116/282 (41.13%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS--WTNTL-KDLWRLNLSEL---NRIMTNQFKSIGLWSSI----GN----------FG--NNVNL---------WEDLSKFVGKIS--------PLQSHTMVAYKNH-LYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDV-NAPIPFPRRNHSCCIYRSAL-VIFGGFGDVRGS----LGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            P+ R  H  V  D  +Y+ GGYS  ++  L ++LWR N++       I T  F S    S +    GN          FG  N+  L         W +L    G +         P    +MV   +  LY+F G  T  + NC    ++   +   +WK +   N  +PFPR  H    Y+ +  VI GG G         L  + AF ++T KW +  C       +        P  R  H  V++K+ ++I GG  G  I ND+W  +   +QWTKL
Sbjct:   23 PLPRSGHRCVADDRNVYVFGGYSPHYSEKLFRELWRFNIASQCWSRVITTGPFPSSVCSSCVLLNKGNLIVYGGSGIPFGQSNSAQLHICLLSKKEWIELETTTGYLYDKKPSLPIPGYGQSMVLSPDQDLYVFAGT-TGHMFNCYLSKFSFKTK---EWKYVSTQNESVPFPRYRHEAVDYKGSFYVIGGGMGSTDPQEFYNLDKVHAFCYQTNKWQVYECLVSQEHGI--------PPRRRCHGCVLYKDAVYICGGYDGQTIYNDVWSLDLVRFQWTKL 292          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Nematostella
Match: EDO44170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWH7])

HSP 1 Score: 69.707 bits (169), Expect = 1.512e-12
Identity = 53/211 (25.12%), Postives = 90/211 (42.65%), Query Frame = 2
Query:  356 DLSKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRGS-----LGDLWAFDFETGKW--------------------------HLIWCTQYLNKQLKRSIVK-YGPRARH--DHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWT 856
            D  +FVG  +    HT+VA+ + LY+FGG            +D++ C              W         P PR +HS  IY  +++IFGG+ GD+  +       DL+ + F  G+W                           L+W  +    +L R +V+ YG R     +    + ++ +F+F G  G +I ND++Q++F E +W+
Sbjct:   29 DCDEFVG--AKRSKHTIVAWSDALYVFGGDNGKRMLNDMLRFDIKEC-------------SWSRAVTKGAPPAPRYHHSAVIYGQSMLIFGGYTGDLYSNSNLQNKNDLFEYRFNAGQWIEWNVEGRSVTRKATQGKHDNIYPVIPLMWKGEEGKFRLFRGVVQQYGDRPPTCCNFPVAVARDSMFVFSGQSGAKITNDMFQFSFKENRWS 224          

HSP 2 Score: 52.373 bits (124), Expect = 3.323e-7
Identity = 38/126 (30.16%), Postives = 57/126 (45.24%), Query Frame = 2
Query:  509 KWKPI-DVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRA-RHDHRAVIHKNHLFIFGGMCG-------LEICNDLWQWNFNEYQWTK 859
            +WK + D +  +   R  H+   +  AL +FGG    R  L D+  FD +   W              R++ K  P A R+ H AVI+   + IFGG  G       L+  NDL+++ FN  QW +
Sbjct:   23 RWKKMPDCDEFVGAKRSKHTIVAWSDALYVFGGDNGKR-MLNDMLRFDIKECSW-------------SRAVTKGAPPAPRYHHSAVIYGQSMLIFGGYTGDLYSNSNLQNKNDLFEYRFNAGQWIE 134          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Medaka
Match: lztr1 (leucine zipper like transcription regulator 1 [Source:NCBI gene;Acc:101172338])

HSP 1 Score: 73.1738 bits (178), Expect = 3.535e-13
Identity = 67/250 (26.80%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  326 NFG--NNVNLWEDLS---KFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAY++ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++   ++  S+    P AR  H A ++ + L+IF G  G    ND+W  +  +     W ++   G+I  S   +   V  N  ++F G +  +     F + F  + WT
Sbjct:   28 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYRDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW---KVDGSL----PVARSAHGATVYSDKLWIFAGYDGNARLNDMWTISLQDRDHACWEEIDQSGEIPPSCCNFPVAVCRNKMFVFSGQSGAKITNNLFQFEFKGHMWT 250          

HSP 2 Score: 68.9366 bits (167), Expect = 7.159e-12
Identity = 55/240 (22.92%), Postives = 96/240 (40.00%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCP-------FWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            R KH  V Y + +Y+ GG +  N L DL R ++ + +            W      G                +P   H+ V Y + +++FGG +T D+ +          + Y        +WK   V+  +P  R  H   +Y   L IF G+ D    L D+W    +  + H  W     + ++  S   +           + +N +F+F G  G +I N+L+Q+ F  + WT++
Sbjct:   52 RSKHTVVAYRDAIYVFGGDNGKNMLNDLLRFDVKDCS------------WCRAFTTGT-------------PPAPRYHHSAVVYGSSMFVFGG-YTGDIYSNSNLKNKNDLFEYKFATGQWTEWK---VDGSLPVARSAHGATVYSDKLWIFAGY-DGNARLNDMWTISLQD-RDHACWEEIDQSGEIPPSCCNFP--------VAVCRNKMFVFSGQSGAKITNNLFQFEFKGHMWTRI 252          

HSP 3 Score: 62.003 bits (149), Expect = 9.587e-10
Identity = 57/253 (22.53%), Postives = 105/253 (41.50%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWE-DLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYIT 901
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W+ D S  V +     +H    Y + L+IF G +  + R    W  ++ ++    W+ ID +  IP    N    + R+ + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D     Y T
Sbjct:   99 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKFAT-GQWTE----------WKVDGSLPVAR----SAHGATVYSDKLWIFAG-YDGNARLNDMWTISLQDRDHACWEEIDQSGEIPPSCCNFPVAVCRNKMFVFSGQSGAKIT-NNLFQFEFKGHMWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQTWEVIQASLDSELSGYFT 321          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Medaka
Match: lztr1 (leucine zipper like transcription regulator 1 [Source:NCBI gene;Acc:101172338])

HSP 1 Score: 72.7886 bits (177), Expect = 3.894e-13
Identity = 67/250 (26.80%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  326 NFG--NNVNLWEDL---SKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGF-GDVRG-----SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQ---WTKLMYKGDI--SDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWT 1000
            NFG    V+ W  L    +FVG  +    HT+VAY++ +Y+FGG            +DV++C              W         P PR +HS  +Y S++ +FGG+ GD+       +  DL+ + F TG+W     T++   ++  S+    P AR  H A ++ + L+IF G  G    ND+W  +  +     W ++   G+I  S   +   V  N  ++F G +  +     F + F  + WT
Sbjct:   28 NFGPFETVHRWRRLPPCDEFVG--ARRSKHTVVAYRDAIYVFGGDNGKNMLNDLLRFDVKDC-------------SWCRAFTTGTPPAPRYHHSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQW-----TEW---KVDGSL----PVARSAHGATVYSDKLWIFAGYDGNARLNDMWTISLQDRDHACWEEIDQSGEIPPSCCNFPVAVCRNKMFVFSGQSGAKITNNLFQFEFKGHMWT 250          

HSP 2 Score: 68.5514 bits (166), Expect = 8.328e-12
Identity = 55/240 (22.92%), Postives = 96/240 (40.00%), Query Frame = 2
Query:  164 RWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCP-------FWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            R KH  V Y + +Y+ GG +  N L DL R ++ + +            W      G                +P   H+ V Y + +++FGG +T D+ +          + Y        +WK   V+  +P  R  H   +Y   L IF G+ D    L D+W    +  + H  W     + ++  S   +           + +N +F+F G  G +I N+L+Q+ F  + WT++
Sbjct:   52 RSKHTVVAYRDAIYVFGGDNGKNMLNDLLRFDVKDCS------------WCRAFTTGT-------------PPAPRYHHSAVVYGSSMFVFGG-YTGDIYSNSNLKNKNDLFEYKFATGQWTEWK---VDGSLPVARSAHGATVYSDKLWIFAGY-DGNARLNDMWTISLQD-RDHACWEEIDQSGEIPPSCCNFP--------VAVCRNKMFVFSGQSGAKITNNLFQFEFKGHMWTRI 252          

HSP 3 Score: 62.7734 bits (151), Expect = 5.504e-10
Identity = 63/286 (22.03%), Postives = 120/286 (41.96%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGGYS---WTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWE-DLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGD----ISDLAYITDVKINNHWLFFG-INDTRRKTEKFIYSFS 985
            P  R+ H+ V+Y + +++ GGY+   ++N+       NL   N +   +F + G W+           W+ D S  V +     +H    Y + L+IF G +  + R    W  ++ ++    W+ ID +  IP    N    + R+ + +F G    + +  +L+ F+F+   W  I     L            P+ R+ H  V    HL++FGG     + N+L  ++ +   W  +    D       L +   V  +  ++F G +++  R  E + + FS
Sbjct:   99 PAPRYHHSAVVYGSSMFVFGGYTGDIYSNS-------NLKNKNDLFEYKFAT-GQWTE----------WKVDGSLPVAR----SAHGATVYSDKLWIFAG-YDGNARLNDMWTISLQDRDHACWEEIDQSGEIPPSCCNFPVAVCRNKMFVFSGQSGAKIT-NNLFQFEFKGHMWTRIPTEHLLRGSPP------PPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDSQTWEVIQASLDSEMPSGRLFHAAAVIQDAMYIFGGTVDNNVRSGEMYRFQFS 354          

HSP 4 Score: 62.3882 bits (150), Expect = 8.561e-10
Identity = 52/210 (24.76%), Postives = 88/210 (41.90%), Query Frame = 2
Query:  137 QIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIG-LWSSIGNFG--------------------NNV-------NLWEDLSK---FVGKISPLQ---SHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPID--VNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFET 658
            ++    PVAR  H   +Y + L++  GY     L D+W ++L + +     +    G +  S  NF                     NN+       ++W  +       G   P Q    HTMVA+  HLY+FGGA    + N     Y++ +Q    W+ I   +++ +P  R  H+  + + A+ IFGG  D     G+++ F F +
Sbjct:  150 KVDGSLPVARSAHGATVYSDKLWIFAGYDGNARLNDMWTISLQDRDHACWEEIDQSGEIPPSCCNFPVAVCRNKMFVFSGQSGAKITNNLFQFEFKGHMWTRIPTEHLLRGSPPPPQRRYGHTMVAFDRHLYVFGGAADNTLPN-ELHCYDVDSQT---WEVIQASLDSEMPSGRLFHAAAVIQDAMYIFGGTVDNNVRSGEMYRFQFSS 355          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Medaka
Match: hcfc2 (host cell factor C2 [Source:NCBI gene;Acc:101161597])

HSP 1 Score: 58.151 bits (139), Expect = 1.700e-8
Identity = 58/224 (25.89%), Postives = 88/224 (39.29%), Query Frame = 2
Query:  359 LSKFVGKISP-LQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKP-IDVNAPIPFPRRNHSCCIYRSALVIFGGF--------GDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKN----HLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKI--NNHWLFFG---INDTRRKTEKFI 973
            L    G I P   +H +V     + IFGG   Y       +       + +K KP    N   P PR  HS  +  +   +FGG         G+V   L DL+  + +T      W       + K S     P AR  H AV +       L+IFGGM G  + ND+WQ + +   W+    KG  S    +    +  N  ++F G     +++R T+  +
Sbjct:   62 LPAVRGDIPPGCAAHGLVCEGTRVLIFGGMVEYGRYTNSVYELQASRWLWKKLKPRAPRNGAAPCPRIGHSFTLVGNKCYLFGGMANDSEDPNGNVPRYLDDLYELELQTLSGARAWNI----PEAKGS----APPARESHTAVAYSGLGSPKLYIFGGMQGNRL-NDIWQLDLDSMVWSTPEPKGPPSLPRSLHSANVIGNKMYIFGGWVPAPESQRHTDSAV 276          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Medaka
Match: ENSORLT00000013591.2 (kelch domain-containing protein 10-like [Source:NCBI gene;Acc:101173702])

HSP 1 Score: 54.6842 bits (130), Expect = 1.426e-7
Identity = 70/293 (23.89%), Postives = 109/293 (37.20%), Query Frame = 2
Query:  131 SHQIPNRY-------PVARWKHATVIYDNYLYLMGGYSWT------------NTLKDLWRLNLSEL--NRIMTNQFKSIGLWS-SIGNFGNNV-------------------------NLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGD-VRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYG-PRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKL 862
            S +IPNR+       P AR  H  V   + LY+ GGY+                 ++LWR + +     ++ T  +    L S S    GNN+                           W  L+    K + +    M     +LY+FGG   Y + +      ++  +     KP +  + +P  R  H        + I GG       SL  + A++ ET  W          + + +   K G P +R  H  V  K+ +FI GG  G  I +DLW+ N   +QW KL
Sbjct:   49 SLRIPNRFLREGHCIPPARSGHRCVADSSNLYVFGGYNPDFEEAGGSENEDYPLFRELWRYHFATATWQQVRTEGYMPTELASMSAVIHGNNLLVFGGTGIPFGENNSNDVHVCNVQYRRWNLLNCRGNKPNKIYGQAMAIINGYLYVFGGTTGY-LYSTDLHRLDLTTKEWTHLKPNNTPSDLPEERYRHELAHDGQRIYILGGGTSWTSYSLDKIHAYNLETNYW---------EEMVTKPHEKIGYPASRRCHSCVQVKDEVFICGGYNGESILSDLWRLNLRTFQWMKL 331          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Medaka
Match: rabepk (Rab9 effector protein with kelch motifs [Source:NCBI gene;Acc:101157141])

HSP 1 Score: 53.9138 bits (128), Expect = 1.823e-7
Identity = 53/197 (26.90%), Postives = 82/197 (41.62%), Query Frame = 2
Query:  425 LYIFGGAFTYDVRNCPFWIYNIG-NQIMQKWKPIDVNAPIPFPRRNHS--CCIYRSALVIFGG-FGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDI-SDLAYITDVKIN-NHWLFFGINDTRRKTEKFIYSFSQNKW 997
            L++FGGA      NC   + +I  N    +W  I V    P  R  HS   CI     V  GG  G    S   L  FD  +  W      +   +Q         P ARH H  V   + ++I GGM G +  ND++ ++    +W K+  KGDI   +A  + V +  N ++F G+         + ++  + +W
Sbjct:   94 LWVFGGAQQSGNHNC---LQSIDLNDEEPQWNSIVVKGEPPSARTYHSNSACIGDRLYVFSGGDLGAAPVSDSRLHVFDTASSTWSQ---PETEGRQ---------PAARHGHIVVAVGSTIYIHGGMAGEKFYNDMYSFDSLRLKWEKVRTKGDIPPGVAAHSAVPLGPNIYIFGGLTADGAINSMYKFNTERKQW 275          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Planmine SMEST
Match: SMESG000074654.1 (SMESG000074654.1)

HSP 1 Score: 941.799 bits (2433), Expect = 0.000e+0
Identity = 461/464 (99.35%), Postives = 464/464 (100.00%), Query Frame = 2
Query:   47 MQYCXXXXXXXXFKKDTLSTYKSNIEICSHQIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWTTSAYCIPEFHPFSTLSWFSNSNDTDIFCDKVSQKGKLNKIHPIFIDSFENDTFESINLQSCCIQSSAVKVRSFENYRQLNSVESLSKETISTDLTDNSLCETTFIHSANGEEVPNKPSNKELLIILGNNIDKATFDYHLNIQMLYV 1438
            MQYCVNVNDDNNFKKDTLSTYKSNIEICSHQIP+RYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWTTSAYCIPEFHPFSTLSWFSNSNDTDIFCDKVSQKGKLNKIHPIFIDSFENDTFESINLQSCCIQSSAVKVRSFENYR+LNSVESLSKETISTDLTDNSLCETTFIHSANGEEVPNKPSNKELLIILGNNIDKA+FDYHLNIQMLYV
Sbjct:    1 MQYCVNVNDDNNFKKDTLSTYKSNIEICSHQIPDRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGINDTRRKTEKFIYSFSQNKWTTSAYCIPEFHPFSTLSWFSNSNDTDIFCDKVSQKGKLNKIHPIFIDSFENDTFESINLQSCCIQSSAVKVRSFENYRRLNSVESLSKETISTDLTDNSLCETTFIHSANGEEVPNKPSNKELLIILGNNIDKASFDYHLNIQMLYV 464          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Planmine SMEST
Match: SMESG000068250.1 (SMESG000068250.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.276e-7
Identity = 62/262 (23.66%), Postives = 92/262 (35.11%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGG---------YSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKN----------HLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGG-----FGDVRGSLGDLWA-------FDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGL------EIC-NDLW 826
            P AR  H+  +  N +YL GG         ++    L DL+ L++      M                     +WE  S      +P +SH+ VAY+            L ++GG   +  R    +I N+       W    +   IP PR  HS  +  + + IFGG       D R S    W         D ET  W  + C      ++        PR R  H AV     ++I+ G  G       ++C  DLW
Sbjct:  125 PCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTM---------------------MWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKF--RYGDVYILNVD---TMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRV-CEDADEAEM--------PRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLW 351          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Planmine SMEST
Match: SMESG000068250.1 (SMESG000068250.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.814e-7
Identity = 61/258 (23.64%), Postives = 89/258 (34.50%), Query Frame = 2
Query:  155 PVARWKHATVIYDNYLYLMGG---------YSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKN----------HLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGG-----FGDVRGSLGDLWA-------FDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGLEIC---NDLW 826
            P AR  H+  +  N +YL GG         ++    L DL+ L++      M                     +WE  S      +P +SH+ VAY+            L ++GG   +  R    +I N+       W    +   IP PR  HS  +  + + IFGG       D R S    W         D ET  W  + C      ++        PR R  H AV     ++I+ G  G        DLW
Sbjct:  125 PCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTM---------------------MWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKF--RYGDVYILNVD---TMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRV-CEDADEAEM--------PRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQDLW 347          
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Planmine SMEST
Match: SMESG000077083.1 (SMESG000077083.1)

HSP 1 Score: 48.9062 bits (115), Expect = 6.823e-6
Identity = 59/265 (22.26%), Postives = 92/265 (34.72%), Query Frame = 2
Query:  113 SNIEICSHQIPNRYPVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGL----WSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKNHLYIFGG---------AFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPI---------------------PFPRRNHSCCIYRSALVIFGGFGDVRG---SLGDLWAFDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGM 796
            SN  +    +    P  R  H+  IY + ++L GG + T               R   N+   + L    W+ I N      L  D              T+   KN LY+FGG          F  D+ +   W +++      +W  I     +                     PFPRR+H   + R  L IFGG   +      LGDLW+F+  T +W +        K++    V + P  R      ++ N   + GG+
Sbjct:  133 SNFWVLVDGVRGSIPEKRDGHSADIYYDVMFLFGGLTSTGA-------------RYFDNKLYQLDLITWQWTIIYNGDYVEPLGRDFC------------TLTTCKNSLYLFGGRSDDRFNGLTFNRDIYDTAVWKFDLVANKDNRWIKIHPGYGLVVSSSYHTSSYSSILPNCLKYPFPRRSHMTMVIRDELFIFGGLYQINSYCMHLGDLWSFNVMTYQWTM----SSPRKRMGPDYV-WPPGLRKGSLTAVNDNCGLLIGGV 367          
The following BLAST results are available for this feature:
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LZTR11.786e-1326.80leucine zipper like transcription regulator 1 [Sou... [more]
KLHDC102.235e-925.17kelch domain containing 10 [Source:HGNC Symbol;Acc... [more]
LZTR17.091e-825.40leucine zipper like transcription regulator 1 [Sou... [more]
KLHDC21.211e-723.33kelch domain containing 2 [Source:HGNC Symbol;Acc:... [more]
KLHDC21.353e-723.33kelch domain containing 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atrn-18.518e-1024.71pep chromosome:WBcel235:X:14711579:14718787:1 gene... [more]
hcf-19.912e-825.42HCF1 related; Host cell factor 1 [Source:UniProtK... [more]
F53E4.13.789e-723.67pep chromosome:WBcel235:V:15652438:15659079:-1 gen... [more]
F53E4.13.789e-723.67pep chromosome:WBcel235:V:15652438:15659067:-1 gen... [more]
F53E4.13.361e-623.66pep chromosome:WBcel235:V:15652438:15659079:-1 gen... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lztr11.289e-1122.30gene:FBgn0040344 transcript:FBtr0331303[more]
Lztr11.289e-1122.30gene:FBgn0040344 transcript:FBtr0343361[more]
CG67583.603e-1023.67gene:FBgn0034704 transcript:FBtr0071767[more]
CG120812.041e-627.54gene:FBgn0030053 transcript:FBtr0332626[more]
CG120812.041e-627.54gene:FBgn0030053 transcript:FBtr0071218[more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-3d4.31.084e-1729.21si:dkey-3d4.3 [Source:ZFIN;Acc:ZDB-GENE-070912-527... [more]
lztr12.386e-1226.00leucine-zipper-like transcription regulator 1 [Sou... [more]
lztr12.614e-1226.00leucine-zipper-like transcription regulator 1 [Sou... [more]
lztr12.659e-1226.00leucine-zipper-like transcription regulator 1 [Sou... [more]
krcp1.792e-926.32kelch repeat-containing protein [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000007272.12.789e-2926.32tip elongation aberrant protein 1-like [Source:NCB... [more]
lztr11.322e-1327.20leucine-zipper-like transcription regulator 1 [Sou... [more]
lztr11.398e-1327.20leucine-zipper-like transcription regulator 1 [Sou... [more]
lztr11.582e-1327.20leucine-zipper-like transcription regulator 1 [Sou... [more]
lztr11.609e-1327.20leucine-zipper-like transcription regulator 1 [Sou... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lztr19.262e-1426.80leucine-zipper-like transcriptional regulator, 1 [... [more]
Lztr13.093e-1228.93leucine-zipper-like transcriptional regulator, 1 [... [more]
Lztr15.097e-1227.05leucine-zipper-like transcriptional regulator, 1 [... [more]
Klhdc109.381e-1024.83kelch domain containing 10 [Source:MGI Symbol;Acc:... [more]
Lztr11.119e-923.05leucine-zipper-like transcriptional regulator, 1 [... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8RWD9|ACBP5_ARATH9.192e-1422.79Acyl-CoA-binding domain-containing protein 5 OS=Ar... [more]
sp|Q9MA55|ACBP4_ARATH1.247e-1322.61Acyl-CoA-binding domain-containing protein 4 OS=Ar... [more]
sp|Q5R4Q7|LZTR1_PONAB1.260e-1326.80Leucine-zipper-like transcriptional regulator 1 OS... [more]
sp|Q9CQ33|LZTR1_MOUSE6.478e-1326.80Leucine-zipper-like transcriptional regulator 1 OS... [more]
sp|Q9C8K7|FBK21_ARATH7.385e-1323.72F-box/kelch-repeat protein At1g51550 OS=Arabidopsi... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Y4D42.133e-4033.45Uncharacterized protein OS=Branchiostoma floridae ... [more]
E2B0W63.222e-3930.85Tip elongation aberrant protein 1 OS=Camponotus fl... [more]
A0A158NFK41.256e-3830.85Uncharacterized protein OS=Atta cephalotes OX=1295... [more]
F4X1B32.720e-3830.85Transcription factor Sp4 OS=Acromyrmex echinatior ... [more]
A0A3L8DC032.840e-3832.44Uncharacterized protein (Fragment) OS=Ooceraea bir... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-3d4.31.690e-1328.09si:dkey-3d4.3 [Source:ZFIN;Acc:ZDB-GENE-070912-527... [more]
lztr12.287e-1226.00leucine zipper like transcription regulator 1 [Sou... [more]
hcfc23.583e-924.64host cell factor C2 [Source:NCBI gene;Acc:10304761... [more]
krcp1.360e-825.30rab9 effector protein with kelch motifs-like [Sour... [more]
klhdc23.878e-822.54kelch domain containing 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lztr11.288e-1124.89leucine-zipper-like transcription regulator 1 [Sou... [more]
zgc:1630141.708e-1125.56zgc:163014 [Source:ZFIN;Acc:ZDB-GENE-070424-100][more]
zgc:1630142.366e-1125.56zgc:163014 [Source:ZFIN;Acc:ZDB-GENE-070424-100][more]
ENSPMAT00000001771.13.374e-925.16pep scaffold:Pmarinus_7.0:GL480830:19416:31634:1 g... [more]
klhdc103.773e-626.71kelch domain containing 10 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
KEL24.684e-1124.43Protein that negatively regulates mitotic exit; fo... [more]
KEL32.034e-928.48Cytoplasmic protein of unknown function [Source:SG... [more]
KEL19.592e-722.73Protein required for proper cell fusion and cell m... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447932.476e-3129.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482216.890e-1627.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286081.454e-1529.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312211.921e-1327.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441701.512e-1225.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lztr13.535e-1326.80leucine zipper like transcription regulator 1 [Sou... [more]
lztr13.894e-1326.80leucine zipper like transcription regulator 1 [Sou... [more]
hcfc21.700e-825.89host cell factor C2 [Source:NCBI gene;Acc:10116159... [more]
ENSORLT00000013591.21.426e-723.89kelch domain-containing protein 10-like [Source:NC... [more]
rabepk1.823e-726.90Rab9 effector protein with kelch motifs [Source:NC... [more]
back to top
BLAST of Leucine-zipper-like transcriptional regulator 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000074654.10.000e+099.35SMESG000074654.1[more]
SMESG000068250.11.276e-723.66SMESG000068250.1[more]
SMESG000068250.11.814e-723.64SMESG000068250.1[more]
SMESG000077083.16.823e-622.26SMESG000077083.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023199 ID=SMED30023199|Name=Leucine-zipper-like transcriptional regulator 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1570bp
CTATATAAATCTTATATGATGTCACTAAATCAATAGAATTATCAGAATGC
AATACTGTGTTAATGTAAACGATGATAATAATTTTAAAAAAGATACTCTT
TCTACTTACAAAAGTAACATTGAAATTTGTAGTCATCAGATTCCCAATCG
TTATCCAGTTGCTAGGTGGAAGCATGCAACCGTAATTTATGATAATTACC
TTTATTTAATGGGAGGATATAGTTGGACAAATACGTTAAAAGATTTATGG
CGGCTTAATCTCAGCGAATTAAATAGAATTATGACGAATCAGTTTAAATC
CATAGGCCTATGGAGTTCTATAGGTAATTTCGGCAATAATGTTAACCTAT
GGGAAGACTTGTCGAAATTTGTTGGCAAGATTTCTCCTCTTCAGTCCCAC
ACAATGGTAGCTTATAAAAATCATCTGTATATATTTGGAGGCGCTTTCAC
GTATGATGTTAGAAACTGTCCATTTTGGATTTATAACATAGGAAACCAAA
TAATGCAAAAATGGAAACCGATAGATGTAAATGCACCAATTCCATTTCCA
CGTAGGAACCATTCTTGTTGTATCTATCGCTCCGCTTTGGTAATATTTGG
TGGTTTTGGAGATGTTCGAGGATCTCTGGGAGATTTATGGGCTTTCGATT
TTGAAACTGGCAAATGGCATTTAATATGGTGTACTCAGTATCTAAATAAG
CAATTAAAGAGAAGTATTGTAAAATACGGTCCCCGTGCTAGGCACGATCA
CAGAGCCGTGATCCATAAAAATCACTTATTTATATTTGGTGGAATGTGTG
GTCTAGAAATCTGTAATGATTTGTGGCAATGGAATTTCAATGAATATCAG
TGGACTAAATTGATGTATAAAGGTGACATTAGTGACCTTGCATATATTAC
CGACGTTAAAATAAATAATCATTGGTTATTTTTTGGAATAAATGATACAA
GACGAAAAACAGAGAAATTCATATACAGTTTCAGCCAAAATAAATGGACT
ACCAGTGCATATTGTATCCCAGAATTTCATCCATTTTCTACATTGTCTTG
GTTTTCGAATAGCAACGATACCGATATCTTTTGTGACAAAGTTTCCCAGA
AAGGCAAATTGAATAAAATCCATCCAATTTTTATTGATTCCTTTGAAAAT
GACACATTTGAAAGCATTAATTTGCAGTCATGCTGCATTCAGAGTTCAGC
AGTTAAAGTAAGATCATTCGAAAACTATCGGCAGCTGAATTCCGTCGAAT
CGTTATCCAAAGAAACGATCTCTACAGACCTAACTGACAATAGTCTTTGT
GAAACGACTTTCATTCATTCCGCCAATGGGGAAGAAGTGCCAAATAAACC
GTCCAATAAAGAGTTATTGATTATTTTGGGAAATAATATTGATAAAGCCA
CTTTCGATTACCATCTTAATATTCAAATGCTTTATGTGTAATAGAGAATT
TATGGAGGTACCAGATTATATATTATATTGCAGCTTTGTTTTATTGATTT
CTTCTTTGACATTTCTCACGCAATTTATCGTTATTTTTTCTGGTTTTTAG
CCCAGTATTCCAAAAATGCC
back to top

protein sequence of SMED30023199-orf-1

>SMED30023199-orf-1 ID=SMED30023199-orf-1|Name=SMED30023199-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=465bp
MQYCVNVNDDNNFKKDTLSTYKSNIEICSHQIPNRYPVARWKHATVIYDN
YLYLMGGYSWTNTLKDLWRLNLSELNRIMTNQFKSIGLWSSIGNFGNNVN
LWEDLSKFVGKISPLQSHTMVAYKNHLYIFGGAFTYDVRNCPFWIYNIGN
QIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGGFGDVRGSLGDLWAF
DFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGM
CGLEICNDLWQWNFNEYQWTKLMYKGDISDLAYITDVKINNHWLFFGIND
TRRKTEKFIYSFSQNKWTTSAYCIPEFHPFSTLSWFSNSNDTDIFCDKVS
QKGKLNKIHPIFIDSFENDTFESINLQSCCIQSSAVKVRSFENYRQLNSV
ESLSKETISTDLTDNSLCETTFIHSANGEEVPNKPSNKELLIILGNNIDK
ATFDYHLNIQMLYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0012505endomembrane system
GO:0016020membrane
GO:0031463Cul3-RING ubiquitin ligase complex
GO:0055037recycling endosome
GO:0055038recycling endosome membrane
GO:0005794Golgi apparatus
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0046580negative regulation of Ras protein signal transduction
Vocabulary: molecular function
TermDefinition
GO:0017016Ras GTPase binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006652Kelch_1
IPR015915Kelch-typ_b-propeller
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13854Kelch_5coord: 36..72
e-value: 3.9E-7
score: 29.9
NoneNo IPR availablePFAMPF13418Kelch_4coord: 168..208
e-value: 9.3E-8
score: 32.0
NoneNo IPR availablePANTHERPTHR23244KELCH REPEAT DOMAINcoord: 114..275
NoneNo IPR availablePANTHERPTHR23244:SF423SI:DKEY-3D4.3coord: 114..275
IPR015915Kelch-type beta propellerGENE3DG3DSA:2.120.10.80coord: 9..83
e-value: 2.2E-5
score: 25.6
coord: 84..220
e-value: 2.4E-13
score: 51.7
coord: 221..329
e-value: 6.1E-8
score: 34.0
IPR015915Kelch-type beta propellerSUPERFAMILYSSF117281Kelch motifcoord: 31..321
IPR006652Kelch repeat type 1PFAMPF01344Kelch_1coord: 231..272
e-value: 5.1E-6
score: 26.0