Ectopic P-granules autophagy protein 5 homolog

Overview
NameEctopic P-granules autophagy protein 5 homolog
Smed IDSMED30023198
Length (bp)7521
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ectopic P-granules autophagy protein 5 homolog (SMED30023198) t-SNE clustered cells

Violin plots show distribution of expression levels for Ectopic P-granules autophagy protein 5 homolog (SMED30023198) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ectopic P-granules autophagy protein 5 homolog (SMED30023198) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ectopic P-granules autophagy protein 5 homolog (SMED30023198) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023198

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023198SMESG000080031.1 Contig4471GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023198SMESG000027516.1 Contig4471GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30023198SMESG000027516.1 dd_Smed_v4_3273_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023198SMESG000027516.1 Contig49973newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023198SMESG000027516.1 Contig49973uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023198SMESG000027516.1 Contig36483newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023198SMESG000027516.1 Contig36483uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30023198SMESG000027516.1 dd_Smed_v4_3273_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Human
Match: EPG5 (ectopic P-granules autophagy protein 5 homolog [Source:HGNC Symbol;Acc:HGNC:29331])

HSP 1 Score: 358.992 bits (920), Expect = 9.927e-99
Identity = 525/2443 (21.49%), Postives = 998/2443 (40.85%), Query Frame = 1
Query:  544 PLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEH-----ALAKYEVGINRQQIENFLAGIVTN--------VRDNG--------------PIRTALTILFRFLRQ----PPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI----GRDEVELAITSLAMLLGSRKARDQFLEAWNPGLSKEEAG------WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEML-AQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--------------IDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPSTR------PKVVDPEYLKPSSIT----NTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQ--NLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNL---IAKQFPGP-------VLNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGL---GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR-------------QSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVR----QANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSI---FSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSL--ESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNI---------TEHNELVLNIDEI---RMELETIGAWLN----KSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALA-FKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTN----NDARSYLLHCVLIWIANGLLVVKELPAMPYHDIYCLK--FRLITWELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEV------ANP---IESDVAAQMFQLV-----VTFICKTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAM-SLLTEVSQLFKNPHISTLAI--EPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSANPEQWQTRIV----DCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLL-------KISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P  + ++++    + L+N+E     F   M + D H   +L+  Y R  + L   E+ L     DC  A+  LW+ +      +  C D   V   + +     N +       +L +L DA   EH     AL  Y   ++R Q+E+++  ++++        +   G               ++  +++LF F R+       H D++  +   ++ L R         D L+LL  +L  PAG+++W  P  +QI        V   + SLA+L+   K R +F+    P   K  +       W LVD  GE+D+    SW LL E DL+  L Q P   +F+  L         +   DY P     P +++ + AF   ++ +L  GL+ +++ RY+   KRI  +I+ T+  ++DH    +S +   Q   L      +E L  +++ ++   +  +LK +R G    + ++P+  LS    W     +              + P Q +    +    TN +  +  M+  + I LLT  + +A   R   N +   +  I   ++++ YV   TR +FSKVGRELL +I+  HP+ +S++L+  +     VG + L+LF++LP  L  PS +E  ++  WLL+     V N+LA  +   LNWGFA   +  ++L  ++H  +A +++ +++++ +  K     ++ES+K V+YL     + + P  E SF+ W  +LI+RL+LH +        P V       P S+T      S    P+  A   +   P+  Y+A++     +  +    + I    ++V+ +  R  + ++ +I+      Q  LL   +   ++   +         + + +   +A+   G        +LN +  +     V    N+V     ++F++ ++ +Q  WY +Q  L+L+D L +    L  +   ++      +       D S  S L      G    + +  L     +W    +L  +   E +  L   +    ++       T   A+      L L +  ++   +I + A        D+  L  I   FF  YL           GL   G +G + FQ       L++ +  +    ++H +   ++R                P  +   +  ++L     + +LW+++      D  + +LP  Y  D+  L +    Q ++  E  N  R   +    Q   G  T+  L+      + S+   F+ P +     +    K +     L L    P  P+ I S  L +     + V   L+ + Q A      ++    L+ + L  + +QY ++       + C     + C   AV+ + +    K   ++ ++   R++  +L  E  +  +L+ +V+  +  ++LI +L    +LQ      K+       ++LF+ +   ++ ETQ++PP R F ++ +  +G  F+     +   +L+ +L+N  L  +  P F PN+  ++   +Y  V++          ++  +L+KF++KQ+L ++ P L  +  +++ +  A+     E    + +  NL      ++  LL   F      ++           L    W   L    C           TE   L  + D +   +  +ETI  WL+    K R S    K  GLF K+ P+   +    G L+  L   ++   A +   S   V++    + ++++ PWI      E+++Q     PWL  D  +A ++V +  + ++ +     +     DA +  LH +    A         P MP   +Y     +R + W+ L   D M +   F       + C      +  ++ W+ V      ++P     S +   +F ++     V  + +T S      +  L+     L+W  +    Y+  +    S+  P IIL   S  E  I+K L  +AG +S   D+   +D  + K   + + +V+ LS     T  +N K   +  +    KL    I     +M+S          ++ MA+ SL  EV  +  N  I T       +  W+ +     ++LP L    QS + +  +   +E  I  +      +   + W  I   +++     +++ +EC+   S L +   +L  + S    + + +++      LEQ+ P     E+   L ++++  L LS IQ         ++ I+ LL        ++E + SSG  G +G G+KS LS  FR+  RS++ FL VQ+P  +  R+    PG   H               T K  Q L+ L+S  SSK+       ++ +   FI +P HC+ D  +FL  +   L+P+    + I
Sbjct:  254 PFTKEQLKILEPGSWLENVESYLEEF-DSMAHQDRHEFYELLLNYSRCRKQLLLAEAELLTLTSDCQNAKSRLWQFKEEQMSVQGICADQVKVFSYHRYQRVEMNENAL----VELKKLFDAK-SEHLHQTLALHSYTSVLSRLQVESYIYALLSSSAVLRSSAIHQQGRASKQTESIPSDLCQLKECISVLFMFTRRVNEDTQFHDDILLWLQKLVSVLQRVGCPG----DHLFLLNHILRCPAGVSKWAVP-FIQIKVLHNPSGVFHFMQSLALLMSPVKNRAEFMCHMKPSERKPSSSGPGSGTWTLVDEGGEEDEDPETSWILLNEDDLVTILAQFPFHELFQHLLGF-------KAKGDYLP-ETTRPQEMMKIFAFANSLVELLAVGLETFNRARYRQFVKRIGYMIRMTLGYVSDHWAQYVSHN---QGSGLAQQPYSMEKLQVEFDELFLRAVLHVLKAKRLGIWLFMSEMPFGTLSVQMLWKLFYLMHQVESENLQQLSSSLQPAQCKQQLQDPEHFTNFEKCLSSMNSSEEICLLTTFAQMAQARR--TNVDEDFIKIIVLEIYEVSYVTLSTRETFSKVGRELLGTITAVHPEIISVLLDRVQETIDQVGMVSLYLFKELPLYLWQPSASEIAVIRDWLLNYNLTVVKNKLACVILEGLNWGFAK--QATLHLDQAVHAEVALMVLEAYQKY-LAQKPYAGILSESMKQVSYLASIVRYGETP--ETSFNQWAWNLILRLKLHKNDYGIQPNCPAV-------PFSVTVPDMTESPTFHPLLKAV--KAGMPIGCYLALSMTAVGHSIEKFCAEGIPLLGILVQSRHLRTVVHVLDKILPLFYPCQYYLLKNEQFLSHLLLFLHLDSGVPQGVTQQVTHKVAQHLTGASHGDNVKLLNSMIQAHIS--VSTQPNEVGPVAVLEFWVQALISQHLWYREQPILFLMDHLCKAAFQLMQEDCIQKLLYQQHKNALGYHCDRSLLSSLVSWIVAGNITPSFVEGLATPTQVWFAWTVLNMESIFEEDSQLRRVIEGELVINSA---FTPDQALKKAQTQLKLPIVPSLQRLLIYRWAHQALVTPSDHPLLPLIWQKFFLLYLHRP----GPQYGLPIDGCIGRRFFQSPAHINLLKEMKRRLTEVADFHHAASKALRVPAEGSEGLPESHSGTPGYLTSPELHKELVRLFNVYILWLEDENFQKGDTYIPSLPKHY--DIHRLAKVMQNQQDLWMEYLNMER---IYHEFQETVGLWTQAKLESHSTPCSLSVQLDFTDPLLAKERVLSNLRKHEAPQPPLALHPTKPPVPV-ISSAVLLSQKDATQLVCTDLNLLQQQARTAALRESQQVALDGELLDTMPKQYVNREEQTTLHLECRGSSGKKCQGAAVVTVQFEGMHKNEAISQQLHVLRKEVKQLQAEAAKPPSLN-IVEAAVHAENLITALVNAYKLQPTPGIQKV------GISLFFTIVDYVSDETQRHPPTRQFFTSCIEILGQVFISGIKSECRKVLETILKNSRLCSLLSPFFTPNAAPAEFIQLYEQVVKFLSED--NSDMIFMLLTKFDLKQWLSATKPPLSDRTRLLESIHLALTAWGLEPDEDILMPFNL---FCKHWTYLLLYQFPDQYSDILRLLMQSSAEQLLSPECWKATLRALGCCAPSCQQGAASTEGAVLPSSSDALLSDKQVMETI-QWLSDFFYKLRLSKMDFKSFGLFSKWSPYMADVKTFLGYLVKRLIDLEMTCLAQDPTASRKTVLKSLHSVIIQLFKPWILVLEDNESSQQR--HYPWLESDTVVASSIVQLFTDCIDSLHESFKDKLLPGDAGALWLHLMHYCEACT------APKMPEFILYAFHSTYRKLPWKDLHP-DQMLMEAFFKVERGSPKSCFLFLGSVLCEVNWVSVLSDAWNSSPHPETRSMIVCLLFMMILLAKEVQLVDQTDS-----PLLSLLGQTSSLSWHLVDIVSYQSVLSYFSSHYPPSIILAKESYAE-LIMKLLKVSAG-LSIPTDSQKHLD-AVPKCQAFTHQMVQFLS-----TLEQNGKITLAVLEQEMSKLLDDIIVFNPPDMDS---------QTRHMALSSLFMEVLMMMNNATIPTAEFLRGSIRTWIGQKMHGLVVLPLLTAACQSLASVRHMAETTEACITAYFKESPLNQN-SGWGPILVSLQVPELTMEEFLQECLTLGSYLTLYVYLLQCLNSEQTLRNEMKVLLILSKWLEQVYPSSV--EEEAKLFLWWHQVLQLSLIQTEQNDSVLTESVIRILLLVQSRQNLVAEERLSSGILGAIGFGRKSPLSNRFRVVARSMAAFLSVQVPMEDQIRLR---PGSELH--------------LTPKAQQALNALESMASSKQYVEYQDQILQAT-QFIRHPGHCLQDGKSFLALLVNCLYPEVHYLDHI 2578          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Human
Match: EPG5 (ectopic P-granules autophagy protein 5 homolog [Source:HGNC Symbol;Acc:HGNC:29331])

HSP 1 Score: 92.4337 bits (228), Expect = 3.179e-18
Identity = 113/466 (24.25%), Postives = 198/466 (42.49%), Query Frame = 1
Query: 6037 LNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMS-LLTEVSQLFKNPHISTLAI--EPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSANPEQWQTRIV----DCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKI-------SESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            L+W  +    Y+  +    S+  P IIL   S  E  I+K L  +AG +S   D+   +D  + K   + + +V+ LS     T  +N K   +  +    KL    I     +M+S          ++ MA+S L  EV  +  N  I T       +  W+ +     ++LP L    QS + +  +   +E  I  +   +      + W  I   +++     +++ +EC+   S L +   +L  + S    + + +++      LEQ+ P     E+   L ++++  L LS IQ         ++ I+ LL +       +E + SSG  G +G G+KS LS  FR+  RS++ FL VQ+P  +  R+    PG   H               T K  Q L+ L+S  SSK+       ++ +   FI +P HC+ D  +FL  +   L+P+    + I
Sbjct:   77 LSWHLVDIVSYQSVLSYFSSHYPPSIILAKESYAE-LIMKLLKVSAG-LSIPTDSQKHLD-AVPKCQAFTHQMVQFLS-----TLEQNGKITLAVLEQEMSKLLDDIIVFNPPDMDS---------QTRHMALSSLFMEVLMMMNNATIPTAEFLRGSIRTWIGQKMHGLVVLPLLTAACQSLASVRHMAETTEACITAY-FKESPLNQNSGWGPILVSLQVPELTMEEFLQECLTLGSYLTLYVYLLQCLNSEQTLRNEMKVLLILSKWLEQVYPSSV--EEEAKLFLWWHQVLQLSLIQTEQNDSVLTESVIRILLLVQSRQNLVAEERLSSGILGAIGFGRKSPLSNRFRVVARSMAAFLSVQVPMEDQIRLR---PGSELH--------------LTPKAQQALNALESMASSKQYVEYQDQILQAT-QFIRHPGHCLQDGKSFLALLVNCLYPEVHYLDHI 504          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Human
Match: EPG5 (ectopic P-granules autophagy protein 5 homolog [Source:HGNC Symbol;Acc:HGNC:29331])

HSP 1 Score: 93.5893 bits (231), Expect = 3.595e-18
Identity = 164/864 (18.98%), Postives = 332/864 (38.43%), Query Frame = 1
Query: 3055 VIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR-------------QSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVR----QANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSI---FSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSL--ESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNI---------TEHNELVLNIDEI---RMELETIGAWLN----KSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALA-FKLARSATENICSWHEVVEKSWDLYLKVYIPWI 5523
            V    N+V     ++F++ ++ +Q  WY +Q  L+L+D L +    L  +   ++      +       D S  S L      G    + +  L     +W    +L  +   E +  L   +    ++       T   A+      L L +  ++   +I + A        D+  L  I   FF  YL         L   G +G + FQ       L++ +  +    ++H +   ++R                P  +   +  ++L     + +LW+++      D  + +LP  Y  D+  L +    Q ++  E  N  R   +    Q   G  T+  L+      + S+   F+ P +     +    K +     L L    P  P+ I S  L +     + V   L+ + Q A      ++    L+ + L  + +QY ++       + C     + C   AV+ + +    K   ++ ++   R++  +L  E  +  +L+ +V+  +  ++LI +L    +LQ      K+       ++LF+ +   ++ ETQ++PP R F ++ +  +G  F+     +   +L+ +L+N  L  +  P F PN+  ++   +Y  V++          ++  +L+KF++KQ+L ++ P L  +  +++ +  A+     E    + +  NL      ++  LL   F      ++           L    W   L    C           TE   L  + D +   +  +ETI  WL+    K R S    K  GLF K+ P+   +    G L+  L   ++   A +   S   V++    + ++++ PWI
Sbjct:    8 VSTQPNEVGPVAVLEFWVQALISQHLWYREQPILFLMDHLCKAAFQLMQEDCIQKLLYQQHKNALGYHCDRSLLSSLVSWIVAGNITPSFVEGLATPTQVWFAWTVLNMESIFEEDSQLRRVIEGELVINSAF---TPDQALKKAQTQLKLPIVPSLQRLLIYRWAHQALVTPSDHPLLPLIWQKFFLLYLHRPGP-QYGLPIDGCIGRRFFQSPAHINLLKEMKRRLTEVADFHHAASKALRVPAEGSEGLPESHSGTPGYLTSPELHKELVRLFNVYILWLEDENFQKGDTYIPSLPKHY--DIHRLAKVMQNQQDLWMEYLNMER---IYHEFQETVGLWTQAKLESHSTPCSLSVQLDFTDPLLAKERVLSNLRKHEAPQPPLALHPTKPPVPV-ISSAVLLSQKDATQLVCTDLNLLQQQARTAALRESQQVALDGELLDTMPKQYVNREEQTTLHLECRGSSGKKCQGAAVVTVQFEGMHKNEAISQQLHVLRKEVKQLQAEAAKPPSLN-IVEAAVHAENLITALVNAYKLQPTPGIQKV------GISLFFTIVDYVSDETQRHPPTRQFFTSCIEILGQVFISGIKSECRKVLETILKNSRLCSLLSPFFTPNAAPAEFIQLYEQVVKFLSED--NSDMIFMLLTKFDLKQWLSATKPPLSDRTRLLESIHLALTAWGLEPDEDILMPFNL---FCKHWTYLLLYQFPDQYSDILRLLMQSSAEQLLSPECWKATLRALGCCAPSCQQGAASTEGAVLPSSSDALLSDKQVMETI-QWLSDFFYKLRLSKMDFKSFGLFSKWSPYMADVKTFLGYLVKRLIDLEMTCLAQDPTASRKTVLKSLHSVIIQLFKPWI 848          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Human
Match: EPG5 (ectopic P-granules autophagy protein 5 homolog [Source:HGNC Symbol;Acc:HGNC:29331])

HSP 1 Score: 74.3294 bits (181), Expect = 2.105e-12
Identity = 118/637 (18.52%), Postives = 246/637 (38.62%), Query Frame = 1
Query: 3055 VIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR-------------QSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVR----QANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSI---FSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSL--ESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQ 4896
            V    N+V     ++F++ ++ +Q  WY +Q  L+L+D L +    L  +   ++      +       D S  S L      G    + +  L     +W    +L  +   E +  L   +    ++       T   A+      L L +  ++   +I + A        D+  L  I   FF  YL         L   G +G + FQ       L++ +  +    ++H +   ++R                P  +   +  ++L     + +LW+++      D  + +LP  Y  D+  L +    Q ++  E  N  R   +    Q   G  T+  L+      + S+   F+ P +     +    K +     L L    P  P+ I S  L +     + V   L+ + Q A      ++    L+ + L  + +QY ++       + C     + C   AV+ + +    K   ++ ++   R++  +L  E  +  +L+ +V+  +  ++LI +L    +LQ      K+       ++LF+ +   ++ ETQ++PP R F ++ +  +G  F+     +   +L+ +L+N  L  +  P F PN+  ++   +Y  V++
Sbjct:    8 VSTQPNEVGPVAVLEFWVQALISQHLWYREQPILFLMDHLCKAAFQLMQEDCIQKLLYQQHKNALGYHCDRSLLSSLVSWIVAGNITPSFVEGLATPTQVWFAWTVLNMESIFEEDSQLRRVIEGELVINSAF---TPDQALKKAQTQLKLPIVPSLQRLLIYRWAHQALVTPSDHPLLPLIWQKFFLLYLHRPGP-QYGLPIDGCIGRRFFQSPAHINLLKEMKRRLTEVADFHHAASKALRVPAEGSEGLPESHSGTPGYLTSPELHKELVRLFNVYILWLEDENFQKGDTYIPSLPKHY--DIHRLAKVMQNQQDLWMEYLNMER---IYHEFQETVGLWTQAKLESHSTPCSLSVQLDFTDPLLAKERVLSNLRKHEAPQPPLALHPTKPPVPV-ISSAVLLSQKDATQLVCTDLNLLQQQARTAALRESQQVALDGELLDTMPKQYVNREEQTTLHLECRGSSGKKCQGAAVVTVQFEGMHKNEAISQQLHVLRKEVKQLQAEAAKPPSLN-IVEAAVHAENLITALVNAYKLQPTPGIQKV------GISLFFTIVDYVSDETQRHPPTRQFFTSCIEILGQVFISGIKSECRKVLETILKNSRLCSLLSPFFTPNAAPAEFIQLYEQVVK 627          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Celegans
Match: epg-5 (Ectopic P granules protein 5 [Source:UniProtKB/Swiss-Prot;Acc:Q18892])

HSP 1 Score: 140.969 bits (354), Expect = 7.883e-33
Identity = 179/742 (24.12%), Postives = 322/742 (43.40%), Query Frame = 1
Query:  547 LGEGEMRVHYKNALLDNLECLQARFIG-EMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDN--AIVRRTY-SFDEAIFNTDQAGKL-GAQLTELVD-AVIDEHALAKYEVGINRQQI---ENFLA--GIVTNVRDN-----------GPIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAP---SLLQ---IGRDEVELAITSLAMLLGSRKARDQFLEAWNPGLSKEEAGWALV--DSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAA-LDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGN--------CRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTDNDWFLTNLQLAIDQ---------MSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEAT--KLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRL 2622
            + E  +   Y N L ++ E    +FI  E        L  L+   +     +T +E + ++  ++        W  ++ +   + +CGDN     R +Y SF+      DQ  KL     + L+D +V +E +     + I  Q I    NF+A  G+ TN   +             +RTAL+ +F  LR P      +  +  WI  L   L   ++ +D ++LL  LL  P+ + +W +P   + +Q     + +++  +  L  LL   KAR+ FL        KEE+ W ++  D DGE ++    S+  + ESDL AFL Q PI+ ++  A L     +D   Q                 M+AF + +M ILD GL  Y Q  YK   K+I   +KH+++      EL  +W  +   D++ PG          RV +LA    +++  L         G  Q +V +P+ ++S   +      L    +  +    D  +  ++  I           +   D+ +L+ +++++   S    NS+   ++ + K L  +C+    TR    K G E +  I ++ P+ L  +L      L H     + +     L  C +  ++    ++  WL++NPP H  N+LAR V S L+WG A +D   +++ + +H   A  ++   K HS+     N  +++SI  ++ L  ++  + E  F  +C  L+++L+L
Sbjct:  215 MTEENLVTFYHNPLYEHAEMFVDQFIKTEEVPTQSGSLFPLLARLRTVCDLMTVSEVKGKENTEELQKCLRECWVQQSLSVDAKGKCGDNNDGTGRASYFSFELQQAVLDQMKKLLSTNRSNLMDHSVCEETSFRSIALQIQWQVIIINNNFMAENGLSTNCPPSLIASVPMTPGRVALRTALSDIFYHLRYPRLSKRFIDTLVGWIKELTCVLNMRQSCDDGIFLLCHLLRLPSPIDQWASPFVQTFIQSQSAPKLKLDYCVALLTHLLNPIKARESFLRHVAQS-EKEESTWEILADDDDGEANE---FSFVTINESDLTAFLDQFPISELYSIAYLAFTSYSDKGSQ--------------FTAMIAFQLLLMKILDNGLTSYSQPGYKMFCKQIGISLKHSVR------ELCSNWRLI--RDQVRPGEEHHLQKEVDRVVLLALNYLIHQDTL---------GLFQFVVSLPYAVVSEECRSRCEYALRSNKKMSIHEIYDTPICEVRARISSQGISKRIGALGAQDSEFLVNSLASIGSYS----NSD---VSQLLKELIDVCFCDEDTRDDLYKCGGEAIGQILIKRPETLHQLLTIIDRNLQHMDSYAINVLSSSRLFECRL--TEPMISIIGKWLINNPPEHGANRLARRVLSGLHWGLA-VDGHNLWIDVDVHTIAADTVV---KAHSVHCSRSNSMISKSINKISKL-ASKVGDAESLFQQFCWDLLVKLKL 907          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Fly
Match: Epg5 (gene:FBgn0038651 transcript:FBtr0305051)

HSP 1 Score: 257.684 bits (657), Expect = 3.669e-68
Identity = 397/1782 (22.28%), Postives = 729/1782 (40.91%), Query Frame = 1
Query:  631 MQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTNVRDNG-------------------PIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSL------------------LQIGRDEVELAITSLAMLLGSRKARDQFLEAW---------NPGLSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDY--DPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLS---WSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTD--NDW------------FLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMD--SKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLH------PSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADV---NMLKVIQNLVV--RHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKVQQELT-MKFFLNSITNQINWYTDQSFLWLLDKLLELNTAL-DLQT-GTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVG--HKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSC------STLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNK--GAQLCTNHAVINLNYTTWVKRPDVTS-EISRNRQDYNKLVDEMLQFSNLDRVVQGV----LCLQHLIMS-LESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPN-SDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMT-SFSSMCDNGKLGVRFWDLVLECF-RCNITEH---------NELVLNIDEIRMELETIGAWLNK----SRFSDTRCKQNGLFGKYGPHSVYIMKICGQLL---DALAFKLARSATENICSWHEVVEKS-----WDLYLKVYIPWIQSFYTCENTE------------QGELRLPW 5577
            ++  +  PL   +  Y      +T     + + R  C  ++  +W  +         CGD  +V+   ++D    +  +       LT L D V   +        I + +++  +  ++T    +G                    +R A++ILF F+R+P  + +  + + +W+  L        T ED  +LL+ +L  P G+  W A  L                  L +   E+   +  L +LL   K R+++L++           PG +     W +VDSDGED  T       L+ESDL+A L Q+P  +IF +AL +       + +DDY  +P       ++L ++ F  +++  +  GL  Y+  RYK L KR+ R+++HT+Q + D+ EL ++   + +   ++R+     +VE+ A    +       I + R  G  Q    +P+  L     W    +L        PTD  ND             F     LA   ++ +D  YLL     +A E     + +  L+ AI   +F I Y+   TR    K  R++L+  +L        +L   K+ +  V Q   +LF+ LP     PS   F++LS+WLL        +QLAR + S+LNWG     E  ++LP ++H RMA L+  +  +++ +    SG   ++ES++ V+ L  + + ++EQ F  WC  ++  LRLH       S R  +  P   +P       E ++ I     E  + P+A+Y+ +  +   +   +   +   ++Q L++  RH     CLELI  +   +       L  CE F  +   +++AD TY  + K+++     GP+L  + N     ++      +   L  +  +LN  T    W  + + L+LLD++L ++    D +    E FY   K  TE  +  A K S L   F  G    + I  + P N  WL   ILE +  + +   ++ ELL +   +        V A       L  + +   +  VI + AQ+LAS +  +     +   FF+ YL      N+ L    + G   K ++ ++  P ++  +  + +A++Y+     ++   N  +  +    +   + ++   LW+++ +++       +LPAQY  + L  +   ++   +       L ++ R  A  W        + +RL+N     P  P+  K  Q   +            ++ P     +PI  P      + QI       ++++  +A  +    + L  L+  YL  +   Y   P  +  +  C      + CT  A I L     ++  DV S + ++NR+ ++K+++++L   +++   Q +    +C+  L+++ LES             +    + +FY +   +N  T K+ P        +  +G       + Q   +L+  L+   L+E+    F P+ +D     +MY  +I S+    C  + +  + SKF++  ++E+    LS++  + +L      A  +    L     L+++   + V +   DF      VM        D   + V   DL+   F R N  E          +EL L+    R +L T+ A  +     SR        +GL G Y  H  Y    C  L+    +    L  SA   ICS+ E++        +   ++ Y PW+   YT E               Q ++ LPW
Sbjct:  181 LETSEADPLYAAVMEYYELQGKITSNLHDVEKLRKGCAESQKQIWVRQPVTRTFSGTCGDGNVVQECVTYDVIQVDPIKLEVAKTSLTGLYDLVCHAYTNNSITAKITKVKVDQIINDLLTYPNLDGHSVVSLHHTQSGEALQCVSQLRRAISILFSFVRRPSPNANFDKDLKEWLRKLIALQLLLATREDHWFLLFNILRCPNGVGSWAAQFLQLPGTRAVRRGSQQNELPLDLNSPELNHCMAVLQILLMPVKKRNEYLKSQAQAHRELSDTPGATDR---WIVVDSDGEDSHTPAGECVGLKESDLVALLNQMPFEKIFTSALRI------EKFLDDYIIEPDM-ITAQQMLAVVVFFSQLVKTIGEGLLTYNNERYKQLAKRLGRLVRHTLQYVFDYNELFINNNLYKSSEMYERI-----QVELQA----LLVRACGYIYRTRNLGTWQYFSTLPFGTLDAEVIWHLFYYL----NVGFPTDLANDLVSNAEAAFQAEDFWRKFDLANADVAPEDMYYLLQTFFEMANERNR--SKDGSLVKAICLHIFHIGYIHKSTREICYKTARDMLA--NLMDEDLFGCVLVQLKMRYGEVDQAA-YLFKALPLENWHPSMDTFEVLSNWLLHFDYQSSESQLARLIISHLNWGLDC--EGRLFLPHNIHVRMAHLVNEALNKYAPEVIGASG---ISESVRQVSSLIDSTQSSREQ-FTNWCWRMVSVLRLHLMDQGVESVRRTLQHPT--EPLLFIPELERMEMIFQGVNE--NRPLALYVGMLVSLHGHSIPLICQHGFILLQQLLLDHRHAATIRCLELIVPLFLETPET----LANCESFQRLITTLLNADRTYLKLAKDMVYANSIGPILELLDNMLHHQIISYTSYGLCSPLNLLNIWLNCFTTLPGWSQNSNLLYLLDRMLRISYQFPDCRAQAVEFFYNYYKDCTE--WKSAPKGSALKAFF--GGQSVSRIPLISPQN-CWLNLVILEIEFRLVD-TRIFPELLRQISAQP-------VEAALKKTISLSKTSAFPASQLVIFKYAQLLASMESTHALFPIVCQKFFELYLWRVPTENESLNFSHNFGVSDKFYEYNV--PLMKSIKSQLKSAESYY----SALATKNANDDAMAHFYRNCCKLMQNCALWLEDTQINRFTSDAEHLPAQYNSEKLRELLSGHVNHWTEFLCLASLRKEQRHQADQWGR------KVMRLSNQ--KAPRTPVQPKQRQPPAQHIKSLLKSYEKIVENPLHIRVEPIKTPPIDGVIVAQI----QKKMTTLNSTANNYHYKTSELNSLDLNYLERVPTLYSMIPYEETRRKECTSLLFKRNCTAPAQIKLT-PEHIRINDVISRKQAQNRERHDKIIEDILLAMSVESFAQAIEELGVCIGALLVAPLESS------------VTQIGVRVFYDIVDNLNEVTMKFQPTHDLYFQVLEKLGVFLEADQAAQGLAILRLALKRPDLLELLAGVFVPSRTDVDHFLSMYEFLIDSHLK-HCDTQTLFVLFSKFDLLGWMEAYQPKLSEINRLLLLVLQGLEAWSQPDSSL-----LQDLFRRHLVHIFGYDFPQHYGEVMQLVLDRTSDQKLMPVVLLDLLNALFVRSNCAELSLQQSEVRVHELALDFAR-RQKLFTLKAATDTLLLLSRHFQKERLHHGLHGLYPKHKDY----CQALVLWFTSFGHTLLASA---ICSYQELLADQISDIVFGSIVETYSPWLIP-YTEETVSGVAHWIRQLTPGQSKVLLPW 1861          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Fly
Match: Epg5 (gene:FBgn0038651 transcript:FBtr0273382)

HSP 1 Score: 257.684 bits (657), Expect = 3.670e-68
Identity = 397/1782 (22.28%), Postives = 729/1782 (40.91%), Query Frame = 1
Query:  631 MQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTNVRDNG-------------------PIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSL------------------LQIGRDEVELAITSLAMLLGSRKARDQFLEAW---------NPGLSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDY--DPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLS---WSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTD--NDW------------FLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMD--SKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLH------PSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADV---NMLKVIQNLVV--RHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKVQQELT-MKFFLNSITNQINWYTDQSFLWLLDKLLELNTAL-DLQT-GTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVG--HKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSC------STLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNK--GAQLCTNHAVINLNYTTWVKRPDVTS-EISRNRQDYNKLVDEMLQFSNLDRVVQGV----LCLQHLIMS-LESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPN-SDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMT-SFSSMCDNGKLGVRFWDLVLECF-RCNITEH---------NELVLNIDEIRMELETIGAWLNK----SRFSDTRCKQNGLFGKYGPHSVYIMKICGQLL---DALAFKLARSATENICSWHEVVEKS-----WDLYLKVYIPWIQSFYTCENTE------------QGELRLPW 5577
            ++  +  PL   +  Y      +T     + + R  C  ++  +W  +         CGD  +V+   ++D    +  +       LT L D V   +        I + +++  +  ++T    +G                    +R A++ILF F+R+P  + +  + + +W+  L        T ED  +LL+ +L  P G+  W A  L                  L +   E+   +  L +LL   K R+++L++           PG +     W +VDSDGED  T       L+ESDL+A L Q+P  +IF +AL +       + +DDY  +P       ++L ++ F  +++  +  GL  Y+  RYK L KR+ R+++HT+Q + D+ EL ++   + +   ++R+     +VE+ A    +       I + R  G  Q    +P+  L     W    +L        PTD  ND             F     LA   ++ +D  YLL     +A E     + +  L+ AI   +F I Y+   TR    K  R++L+  +L        +L   K+ +  V Q   +LF+ LP     PS   F++LS+WLL        +QLAR + S+LNWG     E  ++LP ++H RMA L+  +  +++ +    SG   ++ES++ V+ L  + + ++EQ F  WC  ++  LRLH       S R  +  P   +P       E ++ I     E  + P+A+Y+ +  +   +   +   +   ++Q L++  RH     CLELI  +   +       L  CE F  +   +++AD TY  + K+++     GP+L  + N     ++      +   L  +  +LN  T    W  + + L+LLD++L ++    D +    E FY   K  TE  +  A K S L   F  G    + I  + P N  WL   ILE +  + +   ++ ELL +   +        V A       L  + +   +  VI + AQ+LAS +  +     +   FF+ YL      N+ L    + G   K ++ ++  P ++  +  + +A++Y+     ++   N  +  +    +   + ++   LW+++ +++       +LPAQY  + L  +   ++   +       L ++ R  A  W        + +RL+N     P  P+  K  Q   +            ++ P     +PI  P      + QI       ++++  +A  +    + L  L+  YL  +   Y   P  +  +  C      + CT  A I L     ++  DV S + ++NR+ ++K+++++L   +++   Q +    +C+  L+++ LES             +    + +FY +   +N  T K+ P        +  +G       + Q   +L+  L+   L+E+    F P+ +D     +MY  +I S+    C  + +  + SKF++  ++E+    LS++  + +L      A  +    L     L+++   + V +   DF      VM        D   + V   DL+   F R N  E          +EL L+    R +L T+ A  +     SR        +GL G Y  H  Y    C  L+    +    L  SA   ICS+ E++        +   ++ Y PW+   YT E               Q ++ LPW
Sbjct:  182 LETSEADPLYAAVMEYYELQGKITSNLHDVEKLRKGCAESQKQIWVRQPVTRTFSGTCGDGNVVQECVTYDVIQVDPIKLEVAKTSLTGLYDLVCHAYTNNSITAKITKVKVDQIINDLLTYPNLDGHSVVSLHHTQSGEALQCVSQLRRAISILFSFVRRPSPNANFDKDLKEWLRKLIALQLLLATREDHWFLLFNILRCPNGVGSWAAQFLQLPGTRAVRRGSQQNELPLDLNSPELNHCMAVLQILLMPVKKRNEYLKSQAQAHRELSDTPGATDR---WIVVDSDGEDSHTPAGECVGLKESDLVALLNQMPFEKIFTSALRI------EKFLDDYIIEPDM-ITAQQMLAVVVFFSQLVKTIGEGLLTYNNERYKQLAKRLGRLVRHTLQYVFDYNELFINNNLYKSSEMYERI-----QVELQA----LLVRACGYIYRTRNLGTWQYFSTLPFGTLDAEVIWHLFYYL----NVGFPTDLANDLVSNAEAAFQAEDFWRKFDLANADVAPEDMYYLLQTFFEMANERNR--SKDGSLVKAICLHIFHIGYIHKSTREICYKTARDMLA--NLMDEDLFGCVLVQLKMRYGEVDQAA-YLFKALPLENWHPSMDTFEVLSNWLLHFDYQSSESQLARLIISHLNWGLDC--EGRLFLPHNIHVRMAHLVNEALNKYAPEVIGASG---ISESVRQVSSLIDSTQSSREQ-FTNWCWRMVSVLRLHLMDQGVESVRRTLQHPT--EPLLFIPELERMEMIFQGVNE--NRPLALYVGMLVSLHGHSIPLICQHGFILLQQLLLDHRHAATIRCLELIVPLFLETPET----LANCESFQRLITTLLNADRTYLKLAKDMVYANSIGPILELLDNMLHHQIISYTSYGLCSPLNLLNIWLNCFTTLPGWSQNSNLLYLLDRMLRISYQFPDCRAQAVEFFYNYYKDCTE--WKSAPKGSALKAFF--GGQSVSRIPLISPQN-CWLNLVILEIEFRLVD-TRIFPELLRQISAQP-------VEAALKKTISLSKTSAFPASQLVIFKYAQLLASMESTHALFPIVCQKFFELYLWRVPTENESLNFSHNFGVSDKFYEYNV--PLMKSIKSQLKSAESYY----SALATKNANDDAMAHFYRNCCKLMQNCALWLEDTQINRFTSDAEHLPAQYNSEKLRELLSGHVNHWTEFLCLASLRKEQRHQADQWGR------KVMRLSNQ--KAPRTPVQPKQRQPPAQHIKSLLKSYEKIVENPLHIRVEPIKTPPIDGVIVAQI----QKKMTTLNSTANNYHYKTSELNSLDLNYLERVPTLYSMIPYEETRRKECTSLLFKRNCTAPAQIKLT-PEHIRINDVISRKQAQNRERHDKIIEDILLAMSVESFAQAIEELGVCIGALLVAPLESS------------VTQIGVRVFYDIVDNLNEVTMKFQPTHDLYFQVLEKLGVFLEADQAAQGLAILRLALKRPDLLELLAGVFVPSRTDVDHFLSMYEFLIDSHLK-HCDTQTLFVLFSKFDLLGWMEAYQPKLSEINRLLLLVLQGLEAWSQPDSSL-----LQDLFRRHLVHIFGYDFPQHYGEVMQLVLDRTSDQKLMPVVLLDLLNALFVRSNCAELSLQQSEVRVHELALDFAR-RQKLFTLKAATDTLLLLSRHFQKERLHHGLHGLYPKHKDY----CQALVLWFTSFGHTLLASA---ICSYQELLADQISDIVFGSIVETYSPWLIP-YTEETVSGVAHWIRQLTPGQSKVLLPW 1862          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Zebrafish
Match: epg5 (ectopic P-granules autophagy protein 5 homolog (C. elegans) [Source:NCBI gene;Acc:569543])

HSP 1 Score: 355.14 bits (910), Expect = 1.147e-97
Identity = 528/2434 (21.69%), Postives = 1008/2434 (41.41%), Query Frame = 1
Query:  541 EPLGEGEMRVHYKNALLDNLECLQARFIGEMQNL---DPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTN--------VRDNG------------PIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI----GRDEVELAITSLAMLLGSRKARDQFLEAWNP-------GLSKEEAG-WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTDNDWFLT---------------NLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPSTR-PK---VVDPEYLKPS--SITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVAD------VNMLKVIQNLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNL---IAKQFPGPVLNCIGNSFCPSLVIAN------GNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFR---LGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGL---GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR----QSNPTNILLIDQT------------QKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLV--RQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIAT--KILQRFKRQTS--CSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSY--ESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNE------LVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLD-ALAFKLARSATENICSWH--EVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNN---DARSYLLHCVLIWIANGLLVVKELPAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEV--------ANPIESDVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQI-------SDREPSQKMAMSLLTEVSQLFKNPHISTLA--IEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILC----IVQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFI-------QFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            +P    ++R+    + L+N+E  +A F    QNL   + H L +L+  Y R  + LT+ ++ L+ A  DC   +  LW  +      +  C D   V   + + +   N     +L    +   + +    AL  Y   ++R Q+E++L  ++++        V+D              P++ ++++LF F R+          IH W+  L   L    +  D L++L  LL  PAG+ +W  P  LQI        V   + +LA+L+   + R  FL    P        L++  +G W LVD  GE+D+    SW LL E DL++   Q P   +F+  L +           DY P       K++ + AF   ++ +L  GL  Y++ RY+   KRI  +I+ T+  ++DH    +S + + +           ++  +++ ++   +  +LK +R G    + ++P+  LS    W    +++   +++        L+                 QL + +++  D I LLT  +++A   R  ++ E   +  I   ++++ YV   TR  FSKVGRELL++I+  HP  +S++LE  +     VG + L+LF++LP  L MP+  E  L+  WL++     V N+LA  +   LNWGF       + LP  LH  +A L++ +++++  D   G   ++E IK V+YL       Q P  E SF+ W   +++RL+LH + R P+      P    PS   IT+ S  + P+  A   +   P+  ++A+      +  +      +++LK +    ++ +  R  + ++  I+     N    LL  E F++  +L +  D     + + +   +A+   GP   C       S++ A+        +V     ++F+L  +T Q  WY D++ L+LLD +     +  L    E    ++ Q  +        +  L+ I      G    + I        +W    IL  +   E +  L   +    L        T   A+      L L +  ++   +I + AQ   +   D+  L  +   FFQ YL   R    +  GL   G +G + F        L+  R  ++   ++H +   +++      +  + LL   T             ++     +  LW+D+  L  +++ + +LP QY    L  +  RQ  +  E  +  R  +  + ++    W+            ++SIF+    P+A   +IL   ++  +   S L +P  AP     IP+ +L +       +   L+ +   A      +     L+ + L  L + Y ++    + Q+ C  K  Q C   A I + Y++  K   V ++I   + D  +L  + ++ +    + +  +  ++ I +L +  +   +   +KV     +  FY +   +  +TQ++PP R F ++ +  +G  F+     +   +LK +L N  L  +  P+F PN+  S+  ++Y +V+ +   +SG     ++  +L+KF++ Q+L ++ P    +  +M V+  A+     E   ++ +  N+   +    +     D      R++   SS   +  L    W   L+   C+    N+      ++L+  ++   +E +  +  K R S+   +  GL  K+GP+   +      L+   +  +L     E + S    + +E       K++ PWI    T +NT       PWL  D  +A +LVG+       +     +      R  L   ++ +           P MP + +Y    ++  + W +L P    M     F       + C     ++  ++ W+ V         NP    +   +  L+V F+ K        ++  L+D    L W+ +  S Y Q + + VS   P  ++ +  T   ++++ L  AAG            DMT+  Q  +++++V+ L+   S  Q  N                 + +  L +EME ++  I       +D +       SL  E+  L     IST       + CW+++    P++LP L    +  + +  +   +E  I ++  +D      + W  I   +++     + + +E +   S L     I+Q++ +     N ++    +   + Q+ P    +E    L    +L+LL   IQ       +    I         L+++ E + +SG  G +GLG+KS LS  FR+  RS+S FL VQ+PS N  R+H   PG     ++ + ++A        + L  L+ + S +   EL  +    ++    FI  P HC+ D+   L  +   L+ D    ++I
Sbjct:  208 KPFTSEQLRMWEPGSWLENVELHEAEF----QNLAHQEGHELYELLLSYWRCRKQLTQAQTELQAANSDCKNVQNRLWSFKDERLSLQGICADQNKVYGYHCYQQVTLNEAALAELKHLFSAKAEILHQTVALHSYTSILSRLQVESYLYRLLSSNPTTKSVAVQDTSAGNPKSQPSSLQPLKESISVLFIFTRRVLDDSQFQADIHLWLQRLVSVLHQVGSTGDHLFILNHLLCCPAGVGKWAVP-FLQIKVLDNPSGVYHFMQALAILMSPARHRPDFLGHMKPSDARGNNSLTEPASGNWTLVDEGGEEDEDPETSWMLLSEDDLVSLFSQFPFDELFKHLLGICSKG-------DYQPL-ATTSQKMMKIFAFASSLVELLAVGLQTYNRARYRQFVKRIGHMIRMTLCYVSDHWAQYISLTGVSRTTVQEQSFSMEKLQVEFDHLFLRAVLHVLKAKRLGIWLFMSEMPYGTLSSSMLWKIF-YIMQCAETDGLEKLSCSLSAEDCIQRLRESSHQERFQLWLSEINSSDGICLLTTFAHMAQPRRTDVDPE--FVRNIVLEIYEVSYVSVTTREIFSKVGRELLAAIAAAHPHIISVLLERLRETIERVGMVSLYLFKELPLHLWMPAQEEVGLIRDWLMNFSLTAVENRLACIILEGLNWGFQ--PNGCLILPAPLHSDVALLVIEAYQKYLTDKPYGG-ILSEGIKQVSYLANVVRLGQTP--ESSFNQWAWDIVLRLKLHANERSPQDAWCPLPSSSAPSVPEITD-SPIMHPVFKAV--KAGIPIGCFLAIEMTTIGHSLEKFCSEGISLLKTL----IQSRHLRAAVHILENIL-PLVYNCQFYLLKNEQFLSCVQLFLQLDSGTQGVTQQVTQKVAQHLIGPA-TCENIKLLNSVIQAHVLESSRNGRVGAVAVLEFWLQVLTEQSLWYRDRAVLFLLDHMCR---SAFLHQQEECLQKILYQQHKSALGYHGDKGLLSSIMGWIVAGNVTPSFIEGSSLTGEVWFAWMILNMETMFEEDSQLRRCVEHELLSNPA---CTPDQALKKAQVRLKLQVVPSLQRLMIYRWAQQALATPADHPILPLVWQKFFQLYL---RQPGPEF-GLEVKGCIGRRYFHSAAHLSLLKSLRQRLVEVSDFHHAASKALKVPCASGDSGDGLLTPGTPITQYMTSPDLHTEIVRLFTVFALWLDDENLQKQEIYLPSLPKQYDTHRLAKIMQRQQEVWMEHVDIER--VQHELQEVLDLWSKVKSEPAVSQNSSSSIFTDFINPLAARERILTHLRKHDAPQGSLLPVPMKAPVP--DIPTASLTDEKISTTLIQEDLTKLQHQAKLATVRETQQVALDNELLEVLPQLYINREDQLSMQLECRGKSGQPCQGPANITVKYSSMHKLEPVQNQIQSLKSDIKQLQADGIK-APPQSLAEAAVHTENFITALVNVFKQNPSPGVLKV----GITAFYQIVSFVCEDTQRHPPTRQFFTSCIEILGQVFIRDVQSECKHMLKTILLNRRLCNLLSPYFTPNASPSELVSLYEEVVNTLHIDSG----DVIFMLLTKFDLFQWLSTTQPPFSERSRLMTVIHQALCTCGLEPEPEVLMPFNIFCKHWTELLLYQFPDHYSDFLRLLMQSSS---DQLLSPDCWRTSLKALGCSPQTKNKTNKSRSMLLSPQQVDETIEWLSKYFLKLRLSNGDFRSFGLLSKWGPYIEEVKVFWEDLITYVIDLELNHCGKEPVGSPRLLKALENLHRKMAKLFEPWILVLDT-DNTSHPRCS-PWLESDAAVAASLVGLYTRLTETLHEKFKDRLLPGQRGALWLHLMFYCETC-----TSPKMPEYLLYTYHTEYSRLPWKDLHPDQTLMNQF--FNVERGSPKSCFVFMGELLCEVNWVSVLSDSLSPQLNPSTHTMVVSVLHLMV-FLAKEDLSKPESSVLSLLDQSASLPWNLVDFSSY-QNVTRYVSTHYPASLVLSHDTSSQQVVRLLRMAAG-FEPTTQVLHHKDMTLKCQA-FLHLMVQFLT---SLDQNGN-----------------ISLASLETEMEKLLENIVIFNPPETDLQQRHMATCSLFAEMLTLLNEAGISTAEGLGTKLHCWVEKRARGPLLLPLLTAACRCLASVRHMTRTTEACILSY-FTDGCVDQYSGWGPILVSLQVPELTVEDFIQESLSLGSFLTLYVYILQRLNLEQTLLNEKKTLMLLNTWISQVFPSGPADEAKLFLWWHKFLELL--QIQVDQEDACSLDTLILTLMAFQNRLVQLGEERLNSGILGAIGLGRKSPLSNRFRVVARSMSAFLLVQVPSENQLRLH---PGT----ELQLSAKA-------QQALSALEAMASNKQYSELHVS----VNQACQFIKYPNHCLRDANTLLTLLVNALYTDLHYLDII 2531          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Zebrafish
Match: epg5 (ectopic P-granules autophagy protein 5 homolog (C. elegans) [Source:NCBI gene;Acc:569543])

HSP 1 Score: 344.354 bits (882), Expect = 2.031e-94
Identity = 537/2449 (21.93%), Postives = 999/2449 (40.79%), Query Frame = 1
Query:  541 EPLGEGEMRVHYKNALLDNLECLQARFIGEMQNL---DPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTN--------VRDNG------------PIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI----GRDEVELAITSLAMLLGSRKARDQFLEAWNPG-------LSKEEAG-WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALP----QFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTDNDWFLT---------------NLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPSTRPK----VVDPEYLKPS--SITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVAD------VNMLKVIQNLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNL---IAKQFPGPVLNCIGNSFCPSLVIAN------GNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLE----------LNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGL---GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR----QSNPTNILLIDQT------------QKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLV--RQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIAT--KILQRFKRQTS--CSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSY--ESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNE------LVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLD-ALAFKLARSATENICSWH--EVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNN---DARSYLLHCVLIWIANGLLVVKELPAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEV--------ANPIESDVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQI-------SDREPSQKMAMSLLTEVSQLFKNPHISTLA--IEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGP----TSWATINACVRINIEFQQQYWKECIKQNSILC----IVQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFI-------QFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            +P    ++R+    + L+N+E  +A F    QNL   + H L +L+  Y R  + LT+ ++ L+ A  DC   +  LW  +      +  C D   V   + + +   N     +L    +   + +    AL  Y   ++R Q+E++L  ++++        V+D              P++ ++++LF F R+          IH W+  L   L    +  D L++L  LL  PAG+ +W  P  LQI        V   + +LA+L+   + R  FL    P        L++  +G W LVD  GE+D+    SW LL E DL++   Q P   +F+  L +    D       Y P       K++ + AF   ++ +L  GL  Y++ RY+   KRI  +I+ T+  ++DH    +S + +     Q         +VE    +     H+LK  +       C     +P+  LS    W    +++   +++        L+                 QL + +++  D I LLT  +++A   R  ++ E +    +    +++ YV   TR  FSKVGRELL++I+  HP  +S++LE  +     VG + L+LF++LP  L MP+  E  L+  WL++     V N+LA  +   LNWGF       + LP  LH  +A L++ +++++  D   G   ++E IK V+YL       Q P  E SF+ W   +++RL+LH + R         P    PS   IT+ S  + P+  A   +   P+  ++A+      +  +      +++LK++    ++ +  R  + ++  I+     N    LL  E F++  +L +  D     + + +   +A+   GP   C       S++ A+        +V     ++F+L  +T Q  WY D++ L+LLD L            L   L  Q   + F  V       QFS            R GT   +L +       +W    IL  +   E +  L   +    L        T   A+      L L +  ++   +I + AQ   +   D+     +   FFQ YL   R    +  GL   G +G + F        L+  R  ++   ++H +   +++      +  + LL   T             ++     +  LW+D+  L  +++ + +LP QY    L  +  RQ  +  E  +  R  +  + ++    W+            ++SIF+    P+A   +IL   ++  +   S L +P  AP     IP+ +L +       +   L+ +   A      +     L+ + L  L + Y ++    + Q+ C  K  Q C   A I + Y++  K   V ++I   + D  +L  + ++ +    + +  +  ++ I +L +  +   +   +KV     +  FY +   +  +TQ++PP R F ++ +  +G  F+     +   +LK +L N  L  +  P+F PN+  S+  ++Y +V+ +   +SG     ++  +L+KF++ Q+L ++ P    +  +M V+  A+     E   ++ +  N+   +    +     D      R++   SS   +  L    W   L+   C+    N+      ++L+  ++   +E +  +  K R S+   +  GL  K+GP+   +      L+   +  +L     E + S    + +E       K++ PWI    T +NT       PWL  D  +A +LVG+       +     +      R  L   ++ +           P MP + +Y    ++  + W +L P    M     F       + C     ++  ++ W+ V         NP    +   +  L+V F+ K        ++  L+D    L W+ +  S Y Q + + VS   P  ++ +  T   ++++ L  AAG            DMT+  Q  +++++V+ L+   S  Q  N                 + +  L +EME ++  I       +D +       SL  E+  L     IST       + CW+++    P++    + L  +     + V       E  ILS  +DGG     + W  I   +++     + + +E +   S L     I+Q++ +     N ++    +   + Q+ P    +E    L    +L+LL   IQ       +    I         L+++ E + +SG  G +GLG+KS LS  FR+  RS+S FL VQ+PS N  R+H   PG     ++ + ++A        + L  L+ + S +   EL  +    ++    FI  P HC+ D+   L  +   L+ D    ++I
Sbjct:  207 KPFTSEQLRMWEPGSWLENVELHEAEF----QNLAHQEGHELYELLLSYWRCRKQLTQAQTELQAANSDCKNVQNRLWSFKDERLSLQGVCADQNKVYGYHCYQQVTLNEAALAELKHLFSAKAEILHQTVALHSYTSILSRLQVESYLYRLLSSNPTTKSVAVQDTSAVSPKSQPSSLQPLKESISVLFIFTRRVLDDSQFQADIHLWLQRLVAVLHQVGSTGDHLFILNHLLCCPAGVGKWAVP-FLQIKVLDNPSGVYHFMQALAILMSPARHRPDFLGHMRPSDARGNNSLTEPASGNWTLVDEGGEEDEDPETSWMLLSEDDLVSLFSQFPFDELFKHLLGICSKGD-------YQPL-ATTSQKMMKIFAFASSLVELLAVGLQTYNRARYRQFVKRIGHMIRMTLCYVSDHWAQYISLTGVSRTTVQEQSFSMEKLQVEFDHLFLRAVLHVLKWFIMCISSSYC-----MPYGTLSSSMLWKIF-YIMQCAETDGLEKLSCSLSAEDCIQRLRESSHQERFQLWLSEINSSDGICLLTTFAHMAQPRRTDVDPEFVRNIVLEI--YEVSYVSVTTREIFSKVGRELLAAIAAAHPHIISVLLERLRETIERVGMVSLYLFKELPLHLWMPAQEEVGLIRDWLMNFSLTAVENRLACIILEGLNWGFQ--PNGCLILPAPLHSDVALLVIEAYQKYLTDKPYGG-ILSEGIKQVSYLANVVRLGQTP--ESSFNQWAWDIVLRLKLHANERSPQDAWCPLPSSSAPSVPEITD-SPIMHPVFKAV--KAGIPIGCFLAIEMTTIGHSLEKFCSEGISLLKIL----IQSRHLRAAVHILENIL-PLVYNCQFYLLKNEQFLSCVQLFLQLDSGTQGVTQQVTQKVAQHLIGPA-TCENIKLLNSVIQAHVLESSRNGRVGAVAVLEFWLQVLTEQSLWYRDRAVLFLLDHLCRSAFLHQQEECLQKILYQQ---QRFALVYYGLDSGQFSH-----------RRGTVCASLASCFYFK--VWFAWMILNMETMFEEDSQLRRCVEHELLSNPA---CTPDQALKKAQVRLKLQVVPSLQRLMIYRWAQQALATPADHPIQPLVWQKFFQLYL---RQPGPEF-GLEVKGCIGRRYFHSAAHLSLLKSLRQRLVEVSDFHHAASKALKVPCASGDSGDGLLTPGTPITQYMTSPDLHTEILRLFTVFALWLDDENLQKQEIYLPSLPKQYDTHRLAKIMQRQQEVWMEHVDIER--VQHELQEVLDLWSKVKSEPAVSQNSSSSIFTDFINPLAARERILTHLRKHDAPQGSLLPVPMKAPVP--DIPTASLTDEKISTTLIQEDLTKLQHQAKLATVRETQQVALDNELLEVLPQLYINREDQLSMQLECRGKSGQPCQGPANITVKYSSMHKLEPVQNQIQSLKSDIKQLQADGIK-APPQSLAEAAVHTENFITALVNVFKQNPSPGVLKV----GITAFYQIVSFVCEDTQRHPPTRQFFTSCIEILGQVFIRDVQSECKHMLKTILLNRRLCNLLSPYFTPNASPSELVSLYEEVVNTLHIDSG----DVIFMLLTKFDLFQWLSTTQPPFSERSRLMTVIHQALCTCGLEPEPEVLMPFNIFCKHWTELLLYQFPDHYSDFLRLLMQSSS---DQLLSPDCWRTSLKALGCSPQTKNKTNKSRSMLLSPQQVDETIEWLSKYFLKLRLSNGDFRSFGLLSKWGPYIEEVKVFWEDLITYVIDLELNHCGKEPVGSPRLLKALENLHRKMAKLFEPWILVLDT-DNTSHPRCS-PWLESDAAVAASLVGLYTRLTETLHEKFKDRLLPGQRGALWLHLMFYCETC-----TSPKMPEYLLYTYHTEYSRLPWKDLHPDQTLMNQF--FNVERGSPKSCFVFMGELLCEVNWVSVLGDSLSPQLNPSTHTMVVSVLHLMV-FLAKEDLSKPESSVLSLLDQSASLPWNLVDFSSY-QNVTRYVSTHYPASLVLSHDTSSQQVVRLLRMAAG-FEPTTQVLHHKDMTLKCQA-FLHLMVQFLT---SLDQNGN-----------------ISLASLETEMEKLLENIVIFNPPETDLQQRHMATCSLFAEMLTLLNEAGISTAEGLGTKLHCWVEKRARGPLL----LPLLTAACRCLASVRHMTRTTEACILSYFTDGGCVDQYSGWGPILVSLQVPELTVEDFIQESLSLGSFLTLYVYILQRLNLEQTLLNEKKTLMLLNTWISQVFPSGPADEAKLFLWWHKFLELL--QIQVDQEDACSLDTLILTLMAFQNRLVQLGEERLNSGILGAIGLGRKSPLSNRFRVVARSMSAFLLVQVPSENQLRLH---PGT----ELQLSAKA-------QQALSALEAMASNKQYLELHVS----VNQACQFIKYPNHCLRDANTLLTLLVNALYTDLHYLDII 2524          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Xenopus
Match: EPG5 (ectopic P-granules autophagy protein 5 homolog [Source:NCBI gene;Acc:779599])

HSP 1 Score: 349.747 bits (896), Expect = 7.358e-96
Identity = 514/2420 (21.24%), Postives = 1004/2420 (41.49%), Query Frame = 1
Query:  538 PEPLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIEN----------FLAGIVTNVRDNGP------------IRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSL---LQIGRDEVELAITSLAMLLGSRKARDQFLEAWNPG------LSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWS-ALPQFDRLFPGNCRVEML-AQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--------------IDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPS-TRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQNL--VVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTY---------YNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANG--NKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVS---AINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGL---GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTN---------------ILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPD-LLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIAT-KILQRFKRQTS-CSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGA-QLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSL--ESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESSPNLLS---KLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNELVLNIDEIRME-LETIGAWLN----KSRFSDTRCKQNGLFGKYGPH----SVYIMKICGQLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNNDARSYLLHCVLIWIANGLLVVKEL---PAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFI-DIASQMRWMEVANPI-------ESDVAAQMFQLVVTFICKTKSVFKILA--IEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQK-MAM-SLLTEVSQLFKNPHISTLAI--EPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQS-ANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKI-------SESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P    + ++++    + L+N+      F   + + D H   +L+  Y R  + L   E++L     D    +  +W  +  +   +  C D A V   + +  A  ++     L        D +    AL  Y   ++R Q+++          FL  +    +  G             ++  +++LF F R+          I  W+  L   L    ++ D L+LL  +L  PAG+++W AP +   +Q     V   +  LA+L+   + R +FL   NP         K+   W LVD  GE+D+    SW+LL E DLIAFL Q P   +F+  L             +Y P +   P +++ + AF   ++ +L  GL+ +++ RY+   KRI RII+ T+  ++DH  L L+ +    Q   L+     VE L A+Y+ ++   +  +LK +R G    + ++P+  LS    W     +              ID           +     +  +  M+  + I LLT  + +A   +  ++ +L+   A+    +++ YV   TR +FSKVGRELL+SI++ H   +S++LE  +     VG + L+LF++LP     P+ +E  L+  WLL++  + V ++LA  +   LNWG    ++ A++L  ++H  +A +++ +++++  D K     ++ESIK V+YL       Q P  E SF  W   LI+RL++H +  + ++ D    K   +T  S  L P+  A   +   P+  YI +  ++  +  D   ++ +  L  +V+ +  R  + ++ +++      Q  LL   E F+    + +  D+           + + ++L    + G  +  + N     +  ++   N+V     ++F+   + +Q  W+ D+  L L+D++ +       +   ++      +       D    S        G    + I+     + +W    +L  +   E +  L      R +V+ +      +S   A+    + L L +  ++   +I + A    +   D+  L      F+Q++  L         GL   G +G + F        L+Q +  ++   ++H S   ++R   P +               +   +  ++L     + ++W+++      D+ + +LP QY    L  ++R        F    RI  E  +++ + WN         ++ A+S      + ++  +IL   ++  + C    L  + P  P+ IP     N  + ++ V   L+ + Q A      ++    L+ + L  + + Y ++      ++ C     + C   AV+ + +        V+ ++   R++  +L  E  + + L  +++  + L++ I +L    ++QS     KI       +  F+ +   +  ETQ++PP R F ++ +  +G  F+  +  +   +L+ +L+N  L  +  P+F P +   +   +Y  V+++         ++  +L+KF++  +L S+   +S   KL     L   +    PE+  Q+   I  +  N +         ++ CL  +M S S       L    W   L+   C    +    + +    ++ LETI  WL+    K RFS +  +  GL  K+ P+      +   +   L+D     L++     + S H  +        +++ PWI      +N+ Q     PWL  D  +A   VG+     + I +    +  R        +W+   L+   E    P +P + +Y    ++  + W ++ P    M+   EF      S +   LF+  +  ++ W+ + + +       E+         ++ F+ K + +       +  L+     L+W  +    Y+  M    S+  P +IL    T E  I+K L  +AG +++  + ++  D+T  K  IY+  VV+ L      +  +++K   S+ +    KL            + V+    D +  ++ MA+ SL  E+  +  N  ++T       ++ W+  +    +++P L    QS + I  +   +E  I  +   +        W  I A +++     + + +EC+   S L +   V Q L   Q+ AN  +    I   LEQ++P  +VN++   L ++ +  L LS IQ         +N ++ LL +        E + SSG  G +GLG+KS LS  FR+  RSL+ F+  Q+P+ N  R+ +   G   H               + K  Q L  ++S  SSK+  A  +  I     FI  P HC+ D    L  +   L+P+    N+I
Sbjct:  248 PLAFTKDQLKIFEPCSWLENVAAFTEEF-ESIAHQDRHDFHELLMNYGRCRKQLVLAEAKLHIMVSDWKNLKSKVWDFKEEHMTVQGLCEDQAKVVGYHHYQRAEVDSSALADLKRLFELKSDHLHQTFALHSYTSVLSRLQVDSYIYDLLNSSPFLRSLGIECQGQGSSKLEGSHTDVVLLKECISVLFSFTRRVLEDAQFHNDIQLWLQKLVSVLLKVASLGDHLFLLNHVLRCPAGVSKWAAPFVQVRVQNNPAGVFHFMQLLAVLMYPVRNRAEFLCHINPSEKKGSSSGKDSGSWTLVDEAGEEDEDPETSWTLLTEDDLIAFLSQFPFHDLFKNVLGF-------SSRGEYSPEKST-PQEMMKIFAFANSLIDLLALGLETFNRVRYRQFVKRIGRIIRMTLCYVSDHWALYLNNNMEADQSGALY----SVEKLQAEYDELFLRAVLHVLKAKRLGIWLFMSEMPYGTLSNSMLWKLFYLMHYAENDNVEILYPSIDTADCRSRLTGTYLFNKFEEYLSSMNNSEGICLLTTFAQMAQTKQTDVDEDLVKSIALEI--YEVSYVSMSTRETFSKVGRELLASITMVHTSIISVLLERVRDTIDKVGMVSLYLFKELPLHRWSPTSSEISLIRDWLLNHNLSEVESKLACIILEGLNWGCN--EKNALHLNPAIHVDVALMILEAYQKYISD-KPYTGLISESIKQVSYLASIVRTGQSP--EASFIQWAWDLILRLKMHRNDQKEQLCD----KVPDLTEASV-LHPVLKAV--KAGVPIGCYIGIAVSSVGHSVDKFCVEGVSLLGELVQARHLRAVVHILDKVLPMFYPCQYYLLKN-EQFLGHIHVFLQLDNGVPQGISLQMTHKVTQHLSGINY-GENVKLLTNMIQAHIAASSSSPNEVGPAAVLEFWTQVLISQQLWHRDKGTLLLMDQMCKAAFRYVQEDSVQKLLYQQHKDALGFHCDRGLLSSFVGWIVAGNVTPSFIDSSYNPSQIWFSWAVLSTESLFEEDSQL------RRVVEWELVSNPSMSPDQALKKAQQQLKLPIVPSVQRLMIYRWAHQALATPADHPLL----PFFWQKFFLLYLNRPGPQYGLPVNGCIGKRFFSSHSHTHMLKQMKRRLIEVADFHHSASKALRALVPLDGSPVFPDSLGGSQECMATPEVHKELVRLFNVFVVWLEDENFQKGDVYLPSLPKQYDAHRLAKIMRNEQELWMEFINMERITYE-IQESINAWNQ--------IKPASSHSGTLALYVSKDRILCNLRKHGAPCPATTLHLMKPPVPV-IPPSCYINTQESMKLVHKDLTILQQYAKTASMRESQQVALDGEMLETIPKLYVNREEQIEMKMECRGNLNKSCAGPAVVTVKFEGMQMEEAVSQQLHIMRREMKQLQAEATKPTQLS-IIEAAVHLENFITALVNAYKVQSPLEIPKI------GIGTFFAVVEYVCDETQRHPPSRQFFTSCIEILGQVFISGTQTECRPVLQTILQNRRLCSLLSPYFTPAASPGEFVQLYEKVVEAVNDD--NSDVIFMLLTKFDLNHWLNSAKPCMSERTKLLECVHLALTLCGLVPEEELQMPFSIFCKHWNSV-LRYQFPDHYSDCLRLLMQSSSEQL----LSPECWRTSLKAVGC----YTACGITLGACHLQVLETI-KWLSDFFYKLRFSKSDFQSFGLLSKWSPYMAEVKTFFEYLVKSLIDYELAGLSQETMGRLKSLHSAIT-------ELFKPWIMVLDKEDNSSQR--CYPWLESDTSVA---VGMVQLFSDCILTLHQKSQDRLLPGQRGALWLH--LMHYCETCTAPKLPEYILYSYHTEYSKLPWKDMYPDQTVME---EFFKVERGSPKSCFLFLGSVLCEVNWVSILSDVWGPAPRPETHRMLVCLLFMLVFVAKEEKLVNEPGSPLLSLLGQASTLSWHLVDAVSYQNVMGYFSSHYPPCVILSKHLTDE-LILKVLKVSAG-LTTFPECNIYSDVT-PKCRIYIQQVVQFLG-----SLEQDAKITLSALEQEMSKLLD----------DIVIFNPPDLDVQKRHMALSSLFMELLMVMNNAGVTTAESLRGALLSWIDTNVQGLLVMPLLTAACQSLASIRHMAEATEACIIAYFRDENLHVQNPGWGPILASLQVPELTTEDFLQECLSLGSYLTLHVYVLQCLNQEQTLANELRVLVMISKWLEQVQPG-SVNDEPK-LFLWCHKILQLSLIQVEQSDSVVTENVLRILLSVQGKLTLLGEERMSSGILGAIGLGRKSPLSSRFRIIARSLAAFIAAQIPAENQVRLKA---GSGLH--------------LSPKAQQALTAVESMTSSKQY-AEFQEQISQATQFIRYPGHCLQDGNTLLALLINSLYPEVHYLNII 2544          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Xenopus
Match: EPG5 (ectopic P-granules autophagy protein 5 homolog [Source:NCBI gene;Acc:779599])

HSP 1 Score: 348.206 bits (892), Expect = 1.947e-95
Identity = 521/2427 (21.47%), Postives = 1006/2427 (41.45%), Query Frame = 1
Query:  538 PEPLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIEN----------FLAGIVTNVRDNGP------------IRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSL---LQIGRDEVELAITSLAMLLGSRKARDQFLEAWNPG------LSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWS-ALPQFDRLFPGNCRVEML-AQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWS--FLTFLIDPNQSEV------PTDNDWFLT------NLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPS-TRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQNL--VVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTY---------YNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANG--NKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVS---AINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGL---GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTN---------------ILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPD-LLNLVRQANITAESFNFPRRILLEQSRQAASGWN-TRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGA-QLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSL--ESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESSPNLLS---KLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNI---------TEHNELVLNIDEIRMELETIGAWLN----KSRFSDTRCKQNGLFGKYGPH----SVYIMKICGQLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNNDARSYLLHCVLIWIANGLLVVKEL---PAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFI-DIASQMRWMEVANPI-------ESDVAAQMFQLVVTFICKTKSVFKILA--IEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQK-MAM-SLLTEVSQLFKNPHISTLAI--EPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQS-ANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKI-------SESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P    + ++++    + L+N+      F   + + D H   +L+  Y R  + L   E++L     D    +  +W  +  +   +  C D A V   + +  A  ++     L        D +    AL  Y   ++R Q+++          FL  +     DNG             ++  +++LF F R+          I  W+  L   L    ++ D L+LL  +L  PAG+++W AP +   +Q     V   +  LA+L+   + R +FL   NP         K+   W LVD  GE+D+    SW+LL E DLIAFL Q P   +F+  L             +Y P +   P +++ + AF   ++ +L  GL+ +++ RY+   KRI RII+ T+  ++DH  L L+ +    Q   L+     VE L A+Y+ ++   +  +LK +R G    + ++P+  LS    W   +L    + +  E+        D    LT        +  +  M+  + I LLT  + +A   +  ++ +L+   A+    +++ YV   TR +FSKVGRELL+SI++ H   +S++LE  +     VG + L+LF++LP     P+ +E  L+  WLL++  + V ++LA  +   LNWG    ++ A++L  ++H  +A +++ +++++  D K     ++ESIK V+YL       Q P  E SF  W   LI+RL++H +  + ++ D    K   +T  S  L P+  A   +   P+  YI +  ++  +  D   ++ +  L  +V+ +  R  + ++ +++      Q  LL   E F+    + +  D+           + + ++L    + G  +  + N     +  ++   N+V     ++F+   + +Q  W+ D+  L L+D++ +       +   ++      +       D    S        G    + I+     + +W    +L  +   E +  L      R +V+ +      +S   A+    + L L +  ++   +I + A    +   D+  L      F+Q++  L         GL   G +G + F        L+Q +  ++   ++H S   ++R   P +               +   +  ++L     + ++W+++      D+ + +LP QY    L  ++R        F    RI  E  +++ + WN  + ++D        +    P V     +    K    C    L  + P  P+ IP     N  + ++ V   L+ + Q A      ++    L+ + L  + + Y ++      ++ C     + C   AV+ + +        V+ ++   R++  +L  E  + + L  +++  + L++ I +L    ++QS     KI       +  F+ +   +  ETQ++PP R F ++ +  +G  F+  +  +   +L+ +L+N  L  +  P+F P +   +   +Y  V+++         ++  +L+KF++  +L S+   +S   KL     L   +    PE+  Q+   I  +  N +         ++ CL  +M S S       L    W   L+   C            E   + L    +++ LETI  WL+    K RFS +  +  GL  K+ P+      +   +   L+D     L++     + S H  +        +++ PWI      +N+ Q     PWL  D  +A   VG+     + I +    +  R        +W+   L+   E    P +P + +Y    ++  + W ++ P    M+   EF      S +   LF+  +  ++ W+ + + +       E+         ++ F+ K + +       +  L+     L+W  +    Y+  M    S+  P +IL    T E  I+K L  +AG +++  + ++  D+T  K  IY+  VV+ L      +  +++K   S+ +    KL            + V+    D +  ++ MA+ SL  E+  +  N  ++T       ++ W+  +    +++P L    QS + I  +   +E  I  +   +        W  I A +++     + + +EC+   S L +   V Q L   Q+ AN  +    I   LEQ++P  +VN++   L ++ +  L LS IQ         +N ++ LL +        E + SSG  G +GLG+KS LS  FR+  RSL+ F+  Q+P+ N  R+ +   G   H               + K  Q L  ++S  SSK+  A  +  I     FI  P HC+ D    L  +   L+P+    N+I
Sbjct:  248 PLAFTKDQLKIFEPCSWLENVAAFTEEF-ESIAHQDRHDFHELLMNYGRCRKQLVLAEAKLHIMVSDWKNLKSKVWDFKEEHMTVQGLCEDQAKVVGYHHYQRAEVDSSALADLKRLFELKSDHLHQTFALHSYTSVLSRLQVDSYIYDLLNSSPFLRSVAVYPPDNGSSKLEGSHTDVVLLKECISVLFSFTRRVLEDAQFHNDIQLWLQKLVSVLLKVASLGDHLFLLNHVLRCPAGVSKWAAPFVQVRVQNNPAGVFHFMQLLAVLMYPVRNRAEFLCHINPSEKKGSSSGKDSGSWTLVDEAGEEDEDPETSWTLLTEDDLIAFLSQFPFHDLFKNVLGF-------SSRGEYSPEKST-PQEMMKIFAFANSLIDLLALGLETFNRVRYRQFVKRIGRIIRMTLCYVSDHWALYLNNNMEADQSGALY----SVEKLQAEYDELFLRAVLHVLKAKRLGIWLFMSEMPYGTLSNSMLWKLFYLMHYAENDNVEILYPSIDTADCRSRLTVSENRDKFEEYLSSMNNSEGICLLTTFAQMAQTKQTDVDEDLVKSIALEI--YEVSYVSMSTRETFSKVGRELLASITMVHTSIISVLLERVRDTIDKVGMVSLYLFKELPLHRWSPTSSEISLIRDWLLNHNLSEVESKLACIILEGLNWGCN--EKNALHLNPAIHVDVALMILEAYQKYISD-KPYTGLISESIKQVSYLASIVRTGQSP--EASFIQWAWDLILRLKMHRNDQKEQLCD----KVPDLTEASV-LHPVLKAV--KAGVPIGCYIGIAVSSVGHSVDKFCVEGVSLLGELVQARHLRAVVHILDKVLPMFYPCQYYLLKN-EQFLGHIHVFLQLDNGVPQGISLQMTHKVTQHLSGINY-GENVKLLTNMIQAHIAASSSSPNEVGPAAVLEFWTQVLISQQLWHRDKGTLLLMDQMCKAAFRYVQEDSVQKLLYQQHKDALGFHCDRGLLSSFVGWIVAGNVTPSFIDSSYNPSQIWFSWAVLSTESLFEEDSQL------RRVVEWELVSNPSMSPDQALKKAQQQLKLPIVPSVQRLMIYRWAHQALATPADHPLL----PFFWQKFFLLYLNRPGPQYGLPVNGCIGKRFFSSHSHTHMLKQMKRRLIEVADFHHSASKALRALVPLDGSPVFPDSLGGSQECMATPEVHKELVRLFNVFVVWLEDENFQKGDVYLPSLPKQYDAHRLAKIMRNEQELWMEFINMERITYE-IQESINAWNQIKVEMD--------TCLLNPAVTKDRILCNLRKHGAPCPATTLHLMKPPVPV-IPPSCYINTQESMKLVHKDLTILQQYAKTASMRESQQVALDGEMLETIPKLYVNREEQIEMKMECRGNLNKSCAGPAVVTVKFEGMQMEEAVSQQLHIMRREMKQLQAEATKPTQLS-IIEAAVHLENFITALVNAYKVQSPLEIPKI------GIGTFFAVVEYVCDETQRHPPSRQFFTSCIEILGQVFISGTQTECRPVLQTILQNRRLCSLLSPYFTPAASPGEFVQLYEKVVEAVNDD--NSDVIFMLLTKFDLNHWLNSAKPCMSERTKLLECVHLALTLCGLVPEEELQMPFSIFCKHWNSV-LRYQFPDHYSDCLRLLMQSSSEQL----LSPECWRTSLKAVGCYTPRKIPSTVQAEACGITLGACHLQV-LETI-KWLSDFFYKLRFSKSDFQSFGLLSKWSPYMAEVKTFFEYLVKSLIDYELAGLSQETMGRLKSLHSAIT-------ELFKPWIMVLDKEDNSSQR--CYPWLESDTSVA---VGMVQLFSDCILTLHQKSQDRLLPGQRGALWLH--LMHYCETCTAPKLPEYILYSYHTEYSKLPWKDMYPDQTVME---EFFKVERGSPKSCFLFLGSVLCEVNWVSILSDVWGPAPRPETHRMLVCLLFMLVFVAKEEKLVNEPGSPLLSLLGQASTLSWHLVDAVSYQNVMGYFSSHYPPCVILSKHLTDE-LILKVLKVSAG-LTTFPECNIYSDVT-PKCRIYIQQVVQFLG-----SLEQDAKITLSALEQEMSKLLD----------DIVIFNPPDLDVQKRHMALSSLFMELLMVMNNAGVTTAESLRGALLSWIDTNVQGLLVMPLLTAACQSLASIRHMAEATEACIIAYFRDENLHVQNPGWGPILASLQVPELTTEDFLQECLSLGSYLTLHVYVLQCLNQEQTLANELRVLVMISKWLEQVQPG-SVNDEPK-LFLWCHKILQLSLIQVEQSDSVVTENVLRILLSVQGKLTLLGEERMSSGILGAIGLGRKSPLSSRFRIIARSLAAFIAAQIPAENQVRLKA---GSGLH--------------LSPKAQQALTAVESMTSSKQY-AEFQEQISQATQFIRYPGHCLQDGNTLLALLINSLYPEVHYLNII 2554          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Xenopus
Match: EPG5 (ectopic P-granules autophagy protein 5 homolog [Source:NCBI gene;Acc:779599])

HSP 1 Score: 347.821 bits (891), Expect = 2.293e-95
Identity = 517/2409 (21.46%), Postives = 1011/2409 (41.97%), Query Frame = 1
Query:  538 PEPLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTNV------------RDNGPIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSL---LQIGRDEVELAITSLAMLLGSRKARDQFLEAWNPG------LSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWS-ALPQFDRLFPGNCRVEML-AQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSF-------------LTFLIDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPS-TRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQNL--VVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTY---------YNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANG--NKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVS---AINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGL---GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTN---------------ILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPD-LLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIAT-KILQRFKRQTS-CSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGA-QLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSL--ESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESSPNLLS---KLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNELVLNIDEIR-MELETIGAWLN----KSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALA-FKLARSATENICSWHEVVEKSWDLY---LKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNNDARSYLLHCVLIWIANGLLVVKEL---PAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFI-DIASQMRWMEVANPI-------ESDVAAQMFQLVVTFICKTKSVFKILA--IEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQK-MAM-SLLTEVSQLFKNPHISTLAI--EPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQS-ANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKI-------SESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P    + ++++    + L+N+      F   + + D H   +L+  Y R  + L   E++L     D    +  +W  +  +   +  C D A V   + +  A  ++     L        D +    AL  Y   ++R Q+++++  ++ +              D   ++  +++LF F R+          I  W+  L   L    ++ D L+LL  +L  PAG+++W AP +   +Q     V   +  LA+L+   + R +FL   NP         K+   W LVD  GE+D+    SW+LL E DLIAFL Q P   +F+  L             +Y P +   P +++ + AF   ++ +L  GL+ +++ RY+   KRI RII+ T+  ++DH  L L+ +    Q   L+     VE L A+Y+ ++   +  +LK +R G    + ++P+  LS    W               + F    N + V   +   L   +  +  M+  + I LLT  + +A   +  ++ +L+   A+    +++ YV   TR +FSKVGRELL+SI++ H   +S++LE  +     VG + L+LF++LP     P+ +E  L+  WLL++  + V ++LA  +   LNWG    ++ A++L  ++H  +A +++ +++++  D K     ++ESIK V+YL       Q P  E SF  W   LI+RL++H +  + ++ D    K   +T  S  L P+  A   +   P+  YI +  ++  +  D   ++ +  L  +V+ +  R  + ++ +++      Q  LL   E F+    + +  D+           + + ++L    + G  +  + N     +  ++   N+V     ++F+   + +Q  W+ D+  L L+D++ +       +   ++      +       D    S        G    + I+     + +W    +L  +   E +  L      R +V+ +      +S   A+    + L L +  ++   +I + A    +   D+  L      F+Q++  L         GL   G +G + F        L+Q +  ++   ++H S   ++R   P +               +   +  ++L     + ++W+++      D+ + +LP QY    L  ++R        F    RI  E  +++ + WN         ++ A+S      + ++  +IL   ++  + C    L  + P  P+ IP     N  + ++ V   L+ + Q A      ++    L+ + L  + + Y ++      ++ C     + C   AV+ + +        V+ ++   R++  +L  E  + + L  +++  + L++ I +L    ++QS     KI       +  F+ +   +  ETQ++PP R F ++ +  +G  F+  +  +   +L+ +L+N  L  +  P+F P +   +   +Y  V+++         ++  +L+KF++  +L S+   +S   KL     L   +    PE+  Q+   I  +  N +         ++ CL  +M S S       L    W   L+   C         +  +    + LETI  WL+    K RFS +  +  GL  K+ P+   +      L+ +L  ++LA  + E + S H +      L+    +++ PWI      +N+ Q     PWL  D  +A   VG+     + I +    +  R        +W+   L+   E    P +P + +Y    ++  + W ++ P    M+   EF      S +   LF+  +  ++ W+ + + +       E+         ++ F+ K + +       +  L+     L+W  +    Y+  M    S+  P +IL    T E  I+K L  +AG +++  + ++  D+T  K  IY+  VV+ L      +  +++K   S+ +    KL            + V+    D +  ++ MA+ SL  E+  +  N  ++T       ++ W+  +    +++P L    QS + I  +   +E  I  +   +        W  I A +++     + + +EC+   S L +   V Q L   Q+ AN  +    I   LEQ++P  +VN++   L ++ +  L LS IQ         +N ++ LL +        E + SSG  G +GLG+KS LS  FR+  RSL+ F+  Q+P+ N  R+ +   G   H               + K  Q L  ++S  SSK+  A  +  I     FI  P HC+ D    L  +   L+P+    N+I
Sbjct:  203 PLAFTKDQLKIFEPCSWLENVAAFTEEF-ESIAHQDRHDFHELLMNYGRCRKQLVLAEAKLHIMVSDWKNLKSKVWDFKEEHMTVQGLCEDQAKVVGYHHYQRAEVDSSALADLKRLFELKSDHLHQTFALHSYTSVLSRLQVDSYIYDLLNSSPFLRSVALEGSHTDVVLLKECISVLFSFTRRVLEDAQFHNDIQLWLQKLVSVLLKVASLGDHLFLLNHVLRCPAGVSKWAAPFVQVRVQNNPAGVFHFMQLLAVLMYPVRNRAEFLCHINPSEKKGSSSGKDSGSWTLVDEAGEEDEDPETSWTLLTEDDLIAFLSQFPFHDLFKNVLGF-------SSRGEYSPEKST-PQEMMKIFAFANSLIDLLALGLETFNRVRYRQFVKRIGRIIRMTLCYVSDHWALYLNNNMEADQSGALY----SVEKLQAEYDELFLRAVLHVLKAKRLGIWLFMSEMPYGTLSNSMLWKLFYLMHYAENDNVEILFCYLNNTAGVIYQHWVNLDKFEEYLSSMNNSEGICLLTTFAQMAQTKQTDVDEDLVKSIALEI--YEVSYVSMSTRETFSKVGRELLASITMVHTSIISVLLERVRDTIDKVGMVSLYLFKELPLHRWSPTSSEISLIRDWLLNHNLSEVESKLACIILEGLNWGCN--EKNALHLNPAIHVDVALMILEAYQKYISD-KPYTGLISESIKQVSYLASIVRTGQSP--EASFIQWAWDLILRLKMHRNDQKEQLCD----KVPDLTEASV-LHPVLKAV--KAGVPIGCYIGIAVSSVGHSVDKFCVEGVSLLGELVQARHLRAVVHILDKVLPMFYPCQYYLLKN-EQFLGHIHVFLQLDNGVPQGISLQMTHKVTQHLSGINY-GENVKLLTNMIQAHIAASSSSPNEVGPAAVLEFWTQVLISQQLWHRDKGTLLLMDQMCKAAFRYVQEDSVQKLLYQQHKDALGFHCDRGLLSSFVGWIVAGNVTPSFIDSSYNPSQIWFSWAVLSTESLFEEDSQL------RRVVEWELVSNPSMSPDQALKKAQQQLKLPIVPSVQRLMIYRWAHQALATPADHPLL----PFFWQKFFLLYLNRPGPQYGLPVNGCIGKRFFSSHSHTHMLKQMKRRLIEVADFHHSASKALRALVPLDGSPVFPDSLGGSQECMATPEVHKELVRLFNVFVVWLEDENFQKGDVYLPSLPKQYDAHRLAKIMRNEQELWMEFINMERITYE-IQESINAWNQ--------IKPASSHSGTLALYVSKDRILCNLRKHGAPCPATTLHLMKPPVPV-IPPSCYINTQESMKLVHKDLTILQQYAKTASMRESQQVALDGEMLETIPKLYVNREEQIEMKMECRGNLNKSCAGPAVVTVKFEGMQMEEAVSQQLHIMRREMKQLQAEATKPTQLS-IIEAAVHLENFITALVNAYKVQSPLEIPKI------GIGTFFAVVEYVCDETQRHPPSRQFFTSCIEILGQVFISGTQTECRPVLQTILQNRRLCSLLSPYFTPAASPGEFVQLYEKVVEAVNDD--NSDVIFMLLTKFDLNHWLNSAKPCMSERTKLLECVHLALTLCGLVPEEELQMPFSIFCKHWNSV-LRYQFPDHYSDCLRLLMQSSSEQL----LSPECWRTSLKAVGCYTPRKIPSTVQAESPDPLVLETI-KWLSDFFYKLRFSKSDFQSFGLLSKWSPYMAEVKTFFEYLVKSLIDYELAGLSQETMGS-HRIQAGLKSLHSAITELFKPWIMVLDKEDNSSQR--CYPWLESDTSVA---VGMVQLFSDCILTLHQKSQDRLLPGQRGALWLH--LMHYCETCTAPKLPEYILYSYHTEYSKLPWKDMYPDQTVME---EFFKVERGSPKSCFLFLGSVLCEVNWVSILSDVWGPAPRPETHRMLVCLLFMLVFVAKEEKLVNEPGSPLLSLLGQASTLSWHLVDAVSYQNVMGYFSSHYPPCVILSKHLTDE-LILKVLKVSAG-LTTFPECNIYSDVT-PKCRIYIQQVVQFLG-----SLEQDAKITLSALEQEMSKLLD----------DIVIFNPPDLDVQKRHMALSSLFMELLMVMNNAGVTTAESLRGALLSWIDTNVQGLLVMPLLTAACQSLASIRHMAEATEACIIAYFRDENLHVQNPGWGPILASLQVPELTTEDFLQECLSLGSYLTLHVYVLQCLNQEQTLANELRVLVMISKWLEQVQPG-SVNDEPK-LFLWCHKILQLSLIQVEQSDSVVTENVLRILLSVQGKLTLLGEERMSSGILGAIGLGRKSPLSSRFRIIARSLAAFIAAQIPAENQVRLKA---GSGLH--------------LSPKAQQALTAVESMTSSKQY-AEFQEQISQATQFIRYPGHCLQDGNTLLALLINSLYPEVHYLNII 2498          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Xenopus
Match: EPG5 (ectopic P-granules autophagy protein 5 homolog [Source:NCBI gene;Acc:779599])

HSP 1 Score: 326.635 bits (836), Expect = 6.477e-89
Identity = 519/2411 (21.53%), Postives = 1005/2411 (41.68%), Query Frame = 1
Query:  538 PEPLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIEN----------FLAGIVTNVRDNG---PIRTA-----LTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSL---LQIGRDEVELAITSLAMLLGSRKARDQFLEAWNPG------LSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWS-ALPQFDRLFPGNCRVEML-AQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWS--FLTFLIDPNQSEV------PTDNDWFLT------NLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPS-TRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQNL--VVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTY---------YNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANG--NKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGN--FMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVS---AINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGL---GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILLIDQTQKLSERL-----------EMLLLWIDEPKLHIEDMPVLNLPAQYRPD-LLNLVRQANITAESFNFPRRILLEQSRQAASGWN-TRHDLDFRFVRLANSI----FSKPTVPIATKILQRFKRQTS-CSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGA-QLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSL--ESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESSPNLLS---KLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEH--NELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALA-FKLARSATENICSWHEVVEKSWDLY---LKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNNDARSYLLHCVLIWIANGLLVVKEL---PAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFI-DIASQMRWMEVANPI-----ESDVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQK-MAM-SLLTEVSQLFKNPHISTLAI--EPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQS-ANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKI-------SESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P    + ++++    + L+N+      F   + + D H   +L+  Y R  + L   E++L     D    +  +    A  ++ +  C D A V   + +  A  ++     L        D +    AL  Y   ++R Q+++          FL  +     DNG   P+  +     +++LF F R+          I  W+  L   L    ++ D L+LL  +L  PAG+++W AP +   +Q     V   +  LA+L+   + R +FL   NP         K+   W LVD  GE+D+    SW+LL E DLIAFL Q P   +F+  L             +Y P +   P +++ + AF   ++ +L  GL+ +++ RY+   KRI RII+ T+  ++DH  L L+ +    Q   L+     VE L A+Y+ ++   +  +LK +R+        +P+  LS    W   +L    + +  E+        D    LT        +  +  M+  + I LLT  + +A   +  ++ +L+   A+    +++ YV   TR +FSKVGRELL+SI++ H   +S++LE  +     VG + L+LF++LP     P+ +E  L+  WLL++  + V ++LA  +   LNWG    ++ A++L  ++H  +A +++ +++++  D K     ++ESIK V+YL       Q P  E SF  W   LI+RL++H +  + ++ D    K   +T  S  L P+  A   +   P+  YI +  ++  +  D   ++ +  L  +V+ +  R  + ++ +++      Q  LL   E F+    + +  D+           + + ++L    + G  +  + N     +  ++   N+V     ++F+   + +Q  W+ D+  L L+D++ +             F  V +   +K      K S                +Q  P    ++W    +L  +   E +  L      R +V+ +      +S   A+    + L L +  ++   +I + A    +   D+  L      F+Q++  L         GL   G +G + F        L+Q +  ++   ++H S   ++R   P     +D +    + L            + ++W+++      D+ + +LP QY    L  ++R        F    RI  E  +++ + WN  + ++D   +  A S+        T+ +  +IL   ++  + C    L  + P  P+ IP     N  + ++ V   L+ + Q A      ++    L+ + L  + + Y ++      ++ C     + C   AV+ +   +      V+ ++   R++  +L  E  + + L  +++  + L++ I +L    ++QS     KI       +  F+ +   +  ETQ++PP R F ++ +  +G  F+  +  +   +L+ +L+N  L  +  P+F P +   +   +Y  V+++         ++  +L+KF++  +L S+   +S   KL     L   +    PE+  Q+   I  +  N +         ++ CL  +M S S       L    W   L+   C       + ++L+ +++   ++ +  +  K RFS +  +  GL  K+ P+   +      L+ +L  ++LA  + E + S H +      L+    +++ PWI      +N+ Q     PWL  D  +A   VG+     + I +    +  R        +W+   L+   E    P +P + +Y    ++  + W ++ P    M+   EF      S +   LF+  +  ++ W+ + + +       +    +  L+   +   K       +  L+     L+W  +    Y+  M    S+  P +IL           K+L           D  ++ D+T  K  IY+  VV+ L      +  +++K   S+ +    KL            + V+    D +  ++ MA+ SL  E+  +  N  ++T       ++ W+  +    +++P L    QS + I  +   +E  I  +    +   G   W  I A +++     + + +EC+   S L +   V Q L   Q+ AN  +    I   LEQ++P  +VN++   L ++ +  L LS IQ         +N ++ LL +        E + SSG  G +GLG+KS LS  FR+  RSL+ F+  Q+P+ N  R+ +   G   H               + K  Q L  ++S  SSK+  A  +  I     FI  P HC+ D    L  +   L+P+    N+I
Sbjct:  236 PLAFTKDQLKIFEPCSWLENVAAFTEEF-ESIAHQDRHDFHELLMNYGRCRKQLVLAEAKLHIMVSDWKNLKSKVDHSMAFLSL-QGLCEDQAKVVGYHHYQRAEVDSSALADLKRLFELKSDHLHQTFALHSYTSVLSRLQVDSYIYDLLNSSPFLRSVAVYPPDNGNAFPVWPSSRLECISVLFSFTRRVLEDAQFHNDIQLWLQKLVSVLLKVASLGDHLFLLNHVLRCPAGVSKWAAPFVQVRVQNNPAGVFHFMQLLAVLMYPVRNRAEFLCHINPSEKKGSSSGKDSGSWTLVDEAGEEDEDPETSWTLLTEDDLIAFLSQFPFHDLFKNVLGF-------SSRGEYSPEKST-PQEMMKIFAFANSLIDLLALGLETFNRVRYRQFVKRIGRIIRMTLCYVSDHWALYLNNNMEADQSGALY----SVEKLQAEYDELFLRAVLHVLKAKRY-------RMPYGTLSNSMLWKLFYLMHYAENDNVEILYPSIDTADCRSRLTVSENRDKFEEYLSSMNNSEGICLLTTFAQMAQTKQTDVDEDLVKSIALEI--YEVSYVSMSTRETFSKVGRELLASITMVHTSIISVLLERVRDTIDKVGMVSLYLFKELPLHRWSPTSSEISLIRDWLLNHNLSEVESKLACIILEGLNWGCN--EKNALHLNPAIHVDVALMILEAYQKYISD-KPYTGLISESIKQVSYLASIVRTGQSP--EASFIQWAWDLILRLKMHRNDQKEQLCD----KVPDLTEASV-LHPVLKAV--KAGVPIGCYIGIAVSSVGHSVDKFCVEGVSLLGELVQARHLRAVVHILDKVLPMFYPCQYYLLKN-EQFLGHIHVFLQLDNGVPQGISLQMTHKVTQHLSGINY-GENVKLLTNMIQAHIAASSSSPNEVGPAAVLEFWTQVLISQQLWHRDKGTLLLMDQMCK-----------AAFRYVQEDSVQKLLYQQHKVS----------------SQAAPCCTIYIWFSWAVLSTESLFEEDSQL------RRVVEWELVSNPSMSPDQALKKAQQQLKLPIVPSVQRLMIYRWAHQALATPADHPLL----PFFWQKFFLLYLNRPGPQYGLPVNGCIGKRFFSSHSHTHMLKQMKRRLIEVADFHHSASKALRALVP-----LDGSPVFPDSLGVNIFFPFRLFNVFVVWLEDENFQKGDVYLPSLPKQYDAHRLAKIMRNEQELWMEFINMERITYE-IQESINAWNQIKVEMDTCLLNPAVSMEPASSHSGTLALYDRILCNLRKHGAPCPATTLHLMKPPVPV-IPPSCYINTQESMKLVHKDLTILQQYAKTASMRESQQVALDGEMLETIPKLYVNREEQIEMKMECRGNLNKSCAGPAVVTVKVRSMQMEEAVSQQLHIMRREMKQLQAEATKPTQLS-IIEAAVHLENFITALVNAYKVQSPLEIPKI------GIGTFFAVVEYVCDETQRHPPSRQFFTSCIEILGQVFISGTQTECRPVLQTILQNRRLCSLLSPYFTPAASPGEFVQLYEKVVEAVNDD--NSDVIFMLLTKFDLNHWLNSAKPCMSERTKLLECVHLALTLCGLVPEEELQMPFSIFCKHWNSV-LRYQFPDHYSDCLRLLMQSSSEQL----LSPECWRTSLKAVGCYTPRKIPSTMMLSAEQVLETIKWLSDFFYKLRFSKSDFQSFGLLSKWSPYMAEVKTFFEYLVKSLIDYELAGLSQETMGS-HRIQAGLKSLHSAITELFKPWIMVLDKEDNSSQR--CYPWLESDTSVA---VGMVQLFSDCILTLHQKSQDRLLPGQRGALWL--HLMHYCETCTAPKLPEYILYSYHTEYSKLPWKDMYPDQTVME---EFFKVERGSPKSCFLFLGSVLCEVNWVSILSDVWGPAPRPETHRMLVCLLFMLVFVAKEEKLGSPLLSLLGQASTLSWHLVDAVSYQNVMGYFSSHYPPCVILS----------KHL----------TDELILKDVT-PKCRIYIQQVVQFLG-----SLEQDAKITLSALEQEMSKLLD----------DIVIFNPPDLDVQKRHMALSSLFMELLMVMNNAGVTTAESLRGALLSWIDTNVQGLLVMPLLTAACQSLASIRHMAEATEACIIAYF---RDGTGNPGWGPILASLQVPELTTEDFLQECLSLGSYLTLHVYVLQCLNQEQTLANELRVLVMISKWLEQVQPG-SVNDEPK-LFLWCHKILQLSLIQVEQSDSVVTENVLRILLSVQGKLTLLGEERMSSGILGAIGLGRKSPLSSRFRIIARSLAAFIAAQIPAENQVRLKA---GSGLH--------------LSPKAQQALTAVESMTSSKQY-AEFQEQISQATQFIRYPGHCLQDGNTLLALLINSLYPEVHYLNII 2481          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Xenopus
Match: EPG5 (ectopic P-granules autophagy protein 5 homolog [Source:NCBI gene;Acc:779599])

HSP 1 Score: 62.3882 bits (150), Expect = 9.571e-9
Identity = 77/432 (17.82%), Postives = 181/432 (41.90%), Query Frame = 1
Query: 3667 GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTN---------------ILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPD-LLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIAT-KILQRFKRQTS-CSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGA-QLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLES--QLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQS 4899
            G +G + F        L+Q +  ++   ++H S   ++R   P +               +   +  ++L     + ++W+++      D+ + +LP QY    L  ++R        F    RI  E  +++ + WN         ++ A+S      + ++  +IL   ++  + C    L  + P  P+ IP     N  + ++ V   L+ + Q A      ++    L+ + L  + + Y ++      ++ C     + C   AV+ + +        V+ ++   R++  +L  E  + + L  +++  + L++ I +L +  ++QS     KI       +  F+ +   +  ETQ++PP R F ++ +  +G  F+  +  +   +L+ +L+N  L  +  P+F P +   +   +Y  V+++
Sbjct:  209 GCIGKRFFSSHSHTHMLKQMKRRLIEVADFHHSASKALRALVPLDGSPVFPDSLGGSQECMATPEVHKELVRLFNVFVVWLEDENFQKGDVYLPSLPKQYDAHRLAKIMRNEQELWMEFINMERITYE-IQESINAWNQ--------IKPASSHSGTLALYVSKDRILCNLRKHGAPCPATTLHLMKPPVPV-IPPSCYINTQESMKLVHKDLTILQQYAKTASMRESQQVALDGEMLETIPKLYVNREEQIEMKMECRGNLNKSCAGPAVVTVKFEGMQMEEAVSQQLHIMRREMKQLQAEATKPTQLS-IIEAAVHLENFITALVNAYKVQSPLEIPKI------GIGTFFAVVEYVCDETQRHPPSRQFFTSCIEILGQVFISGTQTECRPVLQTILQNRRLCSLLSPYFTPAASPGEFVQLYEKVVEA 623          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Mouse
Match: Epg5 (ectopic P-granules autophagy protein 5 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:1918673])

HSP 1 Score: 373.244 bits (957), Expect = 3.546e-103
Identity = 522/2432 (21.46%), Postives = 997/2432 (41.00%), Query Frame = 1
Query:  544 PLGEGEMRVHYKNALLDNLECLQARFIGEMQNL---DPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFL-----------------AGIVTNVRDNGP-----IRTALTILFRFLRQ----PPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI----GRDEVELAITSLAMLLGSRKARDQFL-----EAWNPGLSKEEAG-WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEML-AQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--------------IDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSE--WLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQ--NLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADD----TYYNMVKNLIAKQFPGPV--------LNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFV--SAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR-------------QSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLV--RQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSI---FSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLES--QLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRC---------------NITEHNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALA-FKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVE-----HLNIIASYVTNNDA--RSYLLHCVLIWIANGLLVVKELPAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEV------ANPI-ESDVAAQMFQLVVTFICKTKSVFK--ILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREP-SQKMAM-SLLTEVSQLFKNPHIST---LAIEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQSANPEQWQTRIVDC-LEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKI-------SESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P  + ++++    + L+N+    A ++ E  N+   D H   +L+  Y R  + L   E+ L     DC +A+  LW  +      +  C D   V   + +     N +  G+L        + +     L  Y   ++R Q+E+++                 A  V  + ++ P     ++  +++LF F R+       H D++  +   ++ L R         D  +LL  +L  PAG+ +W  P  +QI        V   + SLA+L+   K R +F+       W P  S   +G W LVD  GE+D+    SW LL E DL+  L Q P   +F+  L         +   DY P     P +++ + AF   ++ +L  GLD +++ RY+   KRI  +I+ T+  ++DH    +S S       L P    +E L  +++ ++   +  +LK +R G    + ++P+  LS    W  L  +              + P + +    +     + +  +  ++  + I LLTA + +A   R   N +   +  I   ++++ YV   TR +FSKVGRELL +I+  HP+ +S++L+  +     VG + L+LF++LP  L  PS  E  ++  WLL+N    V N+LA  +   LNWGF   ++  ++L  +LH  +A L++ +++++ +  K     ++ES+K V+YL     + + P  E SF+ W  +LI+RL+LH +   +   P     S++ + +E     P+  A   +   P+  Y+A+      +  +    + I    ++V+ +  R  +  + +I+      Q  LL   E F++   L +  D          V + +A+   G V         + I    C   V    + V     ++F++ ++ +Q  WY +Q  L+L+D L +    L  +   ++      +       D S  S L      G    + +  L     +W    +L  +   E +  L      R +V+++     F    A+      L L +  ++   +I + A        D+  L  I   FF  YL         L   G +G + FQ       L+  +  +    ++H +   ++R                P  +   +  ++L     + +LW+++      D  + +LP  Y    L  V   Q ++  E  N  R   ++   Q      T+  L+      ++S    F+ P +  A  +    K +     L L  + P  P+ IPS AL       + +   L+ + Q A      ++    L+ + L  + +QY ++       + C     + C   AV+ + +    K   V+ +I   +++  +L  E  Q   L+ VV+  +  ++LI +L +  +LQ      K+       ++LF+ +   ++ ETQ++PP R F ++ +  +G  F+  +  +   LL+ +L+N  L  +  P F PN+  ++   +Y  V+           ++  +L+KF+I+Q+L S+ P L  +  +++ +  A+     E    + +  NL      ++  LL   F      V+           L    W   L    C                +   + ++L+  ++   ++ +  +  K R S    K  GLF K+ P+   +    G L+  L   ++A  + +   S  EV+       ++++ PWI      E++ Q     PWL  D  +A ++V +  +     H +     +  ++   R +LLH      A         P MP   +Y     ++ + W +L P    M+    F       + C      +  ++ W+ V       +P+ E+   A     ++  + K   +       +  L+     L+W  +    Y+  +    S+  P ++L N  + E  I+K L  +AG +S++ D    +D+ + K   + + +V+ LS            A   +G        +  I+ L  ++  ++    D +  ++ MA+ S   EV  +  N  + T   LA+  +  W+ +     I+LP L    QS + +  +  ++E  I  +      D     W  +   +++     + + +EC+   S L +   + Q L S Q+   +     +V   LEQ+ P     E    L ++++  L LS IQ         ++ I+ LL +       +E + SSG  G +GLG++S LS  FR+  RS++ FL VQ+P+ +  R+               PS  +  A    K  Q L  L+S   SK+       ++ + + FI +P HC+ +  +FL  +  +L+P+    + I
Sbjct:  249 PFTKEQLKLLEPGSWLENV----ASYVEEFDNIAHQDRHEFYELLLNYSRCRKQLLLAEAELLTLMSDCHSAKSRLWHFKDEQMAVQGICADQVKVYGHHHYQRVEMNENVLGELKKLFDAKSEHLHQTLTLHSYTSVLSRLQVESYIFTLLNSSAALRSLAVYQADQVPKLTESIPSDVCQLKECISVLFMFTRRVSEDAQFHEDILLWLQKLVSVLQRVGCPG----DHFFLLNHVLRCPAGIRKWAVP-FIQIKVLNNPSGVFHFMQSLALLMSPVKNRAEFMCHMKPSEWKPSSSGPASGNWTLVDEAGEEDEDPETSWILLNEDDLVTLLSQFPFQELFQHLLGF-------KAKGDYLP-ETTRPQEMMKIFAFANSLVELLAVGLDTFNRARYRQFVKRIGYLIRMTLGYVSDHWAQYVSHST---GAGLTPQPYSMEKLQVEFDELFLRAVLHVLKAKRLGIWLFMSEMPFGTLSVQMLWKLLYLMHQVESGDLQQLCASLQPAECKRRLQDPEHFASFEKCLSSINSSEEICLLTAFAQMARARR--TNVDEDFIKIIVLEIYEVSYVTLSTRETFSKVGRELLGAIAAVHPEIISVLLDRVQETIDQVGMVSLYLFKELPLYLWRPSAPEIAVIRDWLLNNNLTAVKNKLACVILEGLNWGFT--EQGTLHLDQALHTEVALLVLEAYQKY-LAQKPYTGLISESMKQVSYLASIVRYGETP--ETSFNQWAWNLILRLKLHKNDFGRQNFPVIPFCSTVPDMTESSMFHPLLKAV--KSGLPIGCYLALAVTAVGHSLEKFCAEGIPLLGVLVQSRHLRAVVHALDKILPVFYPYQCYLLKN-EQFLSNLLLFLQLDSGVPQGVTQQVTHRVAQHLTGAVHGDNVKLLSSMIQAHIC---VSTQPDGVGPVAVLEFWVQALISQHLWYREQPILFLMDHLCKTAFHLMQEDCVQKLLYQQHKNALGYHCDRSLLSSLVNWIVAGNITPSFVEGLSTSTQVWFAWTVLNMESIFEEDSQL------RRVVERELVINAFSPDQALKKAQVQLKLPIVPSLQRLLIYRWAHQALVTPSDHPLLPLIWQKFFLLYLHRPGP-QYGLPVDGCIGRRFFQSPSHVNLLKDMKRRLTEVADFHYAASKALRVPAEGSEGTPEGQAGTPGFLTSPELHRELVRLFNVYVLWLEDENFQKGDTYIPSLPKHYDVHRLAKVMQNQQDLWMEYVNMER---IQHEFQETVALWTQAKLESHAAPCSSSAQLDFTDPLLAKARVLSNLEKHEAPHPPLLLHPVRPPVPL-IPSAALLTQKDSTQLMCTDLNLLQQQARSATLRESQQVALDGELLETMPKQYVNREDQATLHLECRGSSGKKCQGAAVVTVQFEGMNKNEAVSQQIHVLQKEVRQLQAEAAQPPALN-VVEAAVHAENLITALVNTYKLQPTPGVQKL------GISLFFTVVDHVSDETQRHPPTRQFFTSCIEILGQVFVSGTKSECRKLLQTILKNRRLCSLLAPFFTPNAAPAEFIQLYERVVTCLRED--NSDVIFMLLTKFDIQQWLNSTKPPLSDRTRLLESIHLALTAWGLEPEEDILMPFNL---FCKHWTHLLLYQFPDQYSDVLRLLVQSSAEQLLSPECWKATLRALGCYAPSSQQGAASVESSGLHSASRVLLSDKQVMETVQWLSDFFYKLRLSKLDFKSFGLFSKWSPYMADVKTFLGYLVKRLTDLEIASLSQDPTASSKEVLRSLHAQIIQLFKPWILVLEDAESSHQR--HYPWLESDTAVASSIVQLFSDCVGSLHTSFKDRLLPGDEGALRLHLLHYCETCTA---------PKMPEFILYAFHSAYQRLEWKDLHPDQRLMEAF--FKVERGSPKSCFLFLGSVLCRVNWVSVLSDAWNPSPLPETQSMAVCLLFMMVLLAKEAQLVDEPDSPLLSLLGQTSSLSWHLVDLVSYQSVLGYFSSHYPPSVVLANDCSSE-LIVKLLKVSAG-LSAHADGRKHVDI-VPKCQAFTHQMVQFLS------------ALEQTGKIT-FPALEREISKLLDDI--IIFNPPDMDSQTRHMALSSFFVEVLMMMNNAAVPTAEFLAVS-IRTWIGQRVHGLIVLPLLTAACQSLASVRHMAEITEACIMAYFKESSLDQN-LGWGPVLVSLQVPQLTARDFLEECLALGSCLTLYVYLLQCLNSEQTVKNDMKMLLVVSGWLEQVYPSSAQEEAK--LFLWWHQILQLSLIQLEQNDSVLTESVIRILLMLQSRQSLMAEERLSSGILGAIGLGRRSPLSNRFRVAARSMAAFLLVQVPAEDQIRLK--------------PSSELHLA---PKAQQVLTALESMTLSKQYVEYQDQILHA-LQFIRHPGHCLQNGKSFLALLVNRLYPEVHYLDNI 2571          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Mouse
Match: Epg5 (ectopic P-granules autophagy protein 5 homolog (C. elegans) [Source:MGI Symbol;Acc:MGI:1918673])

HSP 1 Score: 373.244 bits (957), Expect = 3.546e-103
Identity = 522/2432 (21.46%), Postives = 997/2432 (41.00%), Query Frame = 1
Query:  544 PLGEGEMRVHYKNALLDNLECLQARFIGEMQNL---DPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFL-----------------AGIVTNVRDNGP-----IRTALTILFRFLRQ----PPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI----GRDEVELAITSLAMLLGSRKARDQFL-----EAWNPGLSKEEAG-WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEML-AQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--------------IDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSE--WLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQ--NLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADD----TYYNMVKNLIAKQFPGPV--------LNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFV--SAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR-------------QSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLV--RQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSI---FSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLES--QLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRC---------------NITEHNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALA-FKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVE-----HLNIIASYVTNNDA--RSYLLHCVLIWIANGLLVVKELPAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEV------ANPI-ESDVAAQMFQLVVTFICKTKSVFK--ILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREP-SQKMAM-SLLTEVSQLFKNPHIST---LAIEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQSANPEQWQTRIVDC-LEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKI-------SESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P  + ++++    + L+N+    A ++ E  N+   D H   +L+  Y R  + L   E+ L     DC +A+  LW  +      +  C D   V   + +     N +  G+L        + +     L  Y   ++R Q+E+++                 A  V  + ++ P     ++  +++LF F R+       H D++  +   ++ L R         D  +LL  +L  PAG+ +W  P  +QI        V   + SLA+L+   K R +F+       W P  S   +G W LVD  GE+D+    SW LL E DL+  L Q P   +F+  L         +   DY P     P +++ + AF   ++ +L  GLD +++ RY+   KRI  +I+ T+  ++DH    +S S       L P    +E L  +++ ++   +  +LK +R G    + ++P+  LS    W  L  +              + P + +    +     + +  +  ++  + I LLTA + +A   R   N +   +  I   ++++ YV   TR +FSKVGRELL +I+  HP+ +S++L+  +     VG + L+LF++LP  L  PS  E  ++  WLL+N    V N+LA  +   LNWGF   ++  ++L  +LH  +A L++ +++++ +  K     ++ES+K V+YL     + + P  E SF+ W  +LI+RL+LH +   +   P     S++ + +E     P+  A   +   P+  Y+A+      +  +    + I    ++V+ +  R  +  + +I+      Q  LL   E F++   L +  D          V + +A+   G V         + I    C   V    + V     ++F++ ++ +Q  WY +Q  L+L+D L +    L  +   ++      +       D S  S L      G    + +  L     +W    +L  +   E +  L      R +V+++     F    A+      L L +  ++   +I + A        D+  L  I   FF  YL         L   G +G + FQ       L+  +  +    ++H +   ++R                P  +   +  ++L     + +LW+++      D  + +LP  Y    L  V   Q ++  E  N  R   ++   Q      T+  L+      ++S    F+ P +  A  +    K +     L L  + P  P+ IPS AL       + +   L+ + Q A      ++    L+ + L  + +QY ++       + C     + C   AV+ + +    K   V+ +I   +++  +L  E  Q   L+ VV+  +  ++LI +L +  +LQ      K+       ++LF+ +   ++ ETQ++PP R F ++ +  +G  F+  +  +   LL+ +L+N  L  +  P F PN+  ++   +Y  V+           ++  +L+KF+I+Q+L S+ P L  +  +++ +  A+     E    + +  NL      ++  LL   F      V+           L    W   L    C                +   + ++L+  ++   ++ +  +  K R S    K  GLF K+ P+   +    G L+  L   ++A  + +   S  EV+       ++++ PWI      E++ Q     PWL  D  +A ++V +  +     H +     +  ++   R +LLH      A         P MP   +Y     ++ + W +L P    M+    F       + C      +  ++ W+ V       +P+ E+   A     ++  + K   +       +  L+     L+W  +    Y+  +    S+  P ++L N  + E  I+K L  +AG +S++ D    +D+ + K   + + +V+ LS            A   +G        +  I+ L  ++  ++    D +  ++ MA+ S   EV  +  N  + T   LA+  +  W+ +     I+LP L    QS + +  +  ++E  I  +      D     W  +   +++     + + +EC+   S L +   + Q L S Q+   +     +V   LEQ+ P     E    L ++++  L LS IQ         ++ I+ LL +       +E + SSG  G +GLG++S LS  FR+  RS++ FL VQ+P+ +  R+               PS  +  A    K  Q L  L+S   SK+       ++ + + FI +P HC+ +  +FL  +  +L+P+    + I
Sbjct:  249 PFTKEQLKLLEPGSWLENV----ASYVEEFDNIAHQDRHEFYELLLNYSRCRKQLLLAEAELLTLMSDCHSAKSRLWHFKDEQMAVQGICADQVKVYGHHHYQRVEMNENVLGELKKLFDAKSEHLHQTLTLHSYTSVLSRLQVESYIFTLLNSSAALRSLAVYQADQVPKLTESIPSDVCQLKECISVLFMFTRRVSEDAQFHEDILLWLQKLVSVLQRVGCPG----DHFFLLNHVLRCPAGIRKWAVP-FIQIKVLNNPSGVFHFMQSLALLMSPVKNRAEFMCHMKPSEWKPSSSGPASGNWTLVDEAGEEDEDPETSWILLNEDDLVTLLSQFPFQELFQHLLGF-------KAKGDYLP-ETTRPQEMMKIFAFANSLVELLAVGLDTFNRARYRQFVKRIGYLIRMTLGYVSDHWAQYVSHST---GAGLTPQPYSMEKLQVEFDELFLRAVLHVLKAKRLGIWLFMSEMPFGTLSVQMLWKLLYLMHQVESGDLQQLCASLQPAECKRRLQDPEHFASFEKCLSSINSSEEICLLTAFAQMARARR--TNVDEDFIKIIVLEIYEVSYVTLSTRETFSKVGRELLGAIAAVHPEIISVLLDRVQETIDQVGMVSLYLFKELPLYLWRPSAPEIAVIRDWLLNNNLTAVKNKLACVILEGLNWGFT--EQGTLHLDQALHTEVALLVLEAYQKY-LAQKPYTGLISESMKQVSYLASIVRYGETP--ETSFNQWAWNLILRLKLHKNDFGRQNFPVIPFCSTVPDMTESSMFHPLLKAV--KSGLPIGCYLALAVTAVGHSLEKFCAEGIPLLGVLVQSRHLRAVVHALDKILPVFYPYQCYLLKN-EQFLSNLLLFLQLDSGVPQGVTQQVTHRVAQHLTGAVHGDNVKLLSSMIQAHIC---VSTQPDGVGPVAVLEFWVQALISQHLWYREQPILFLMDHLCKTAFHLMQEDCVQKLLYQQHKNALGYHCDRSLLSSLVNWIVAGNITPSFVEGLSTSTQVWFAWTVLNMESIFEEDSQL------RRVVERELVINAFSPDQALKKAQVQLKLPIVPSLQRLLIYRWAHQALVTPSDHPLLPLIWQKFFLLYLHRPGP-QYGLPVDGCIGRRFFQSPSHVNLLKDMKRRLTEVADFHYAASKALRVPAEGSEGTPEGQAGTPGFLTSPELHRELVRLFNVYVLWLEDENFQKGDTYIPSLPKHYDVHRLAKVMQNQQDLWMEYVNMER---IQHEFQETVALWTQAKLESHAAPCSSSAQLDFTDPLLAKARVLSNLEKHEAPHPPLLLHPVRPPVPL-IPSAALLTQKDSTQLMCTDLNLLQQQARSATLRESQQVALDGELLETMPKQYVNREDQATLHLECRGSSGKKCQGAAVVTVQFEGMNKNEAVSQQIHVLQKEVRQLQAEAAQPPALN-VVEAAVHAENLITALVNTYKLQPTPGVQKL------GISLFFTVVDHVSDETQRHPPTRQFFTSCIEILGQVFVSGTKSECRKLLQTILKNRRLCSLLAPFFTPNAAPAEFIQLYERVVTCLRED--NSDVIFMLLTKFDIQQWLNSTKPPLSDRTRLLESIHLALTAWGLEPEEDILMPFNL---FCKHWTHLLLYQFPDQYSDVLRLLVQSSAEQLLSPECWKATLRALGCYAPSSQQGAASVESSGLHSASRVLLSDKQVMETVQWLSDFFYKLRLSKLDFKSFGLFSKWSPYMADVKTFLGYLVKRLTDLEIASLSQDPTASSKEVLRSLHAQIIQLFKPWILVLEDAESSHQR--HYPWLESDTAVASSIVQLFSDCVGSLHTSFKDRLLPGDEGALRLHLLHYCETCTA---------PKMPEFILYAFHSAYQRLEWKDLHPDQRLMEAF--FKVERGSPKSCFLFLGSVLCRVNWVSVLSDAWNPSPLPETQSMAVCLLFMMVLLAKEAQLVDEPDSPLLSLLGQTSSLSWHLVDLVSYQSVLGYFSSHYPPSVVLANDCSSE-LIVKLLKVSAG-LSAHADGRKHVDI-VPKCQAFTHQMVQFLS------------ALEQTGKIT-FPALEREISKLLDDI--IIFNPPDMDSQTRHMALSSFFVEVLMMMNNAAVPTAEFLAVS-IRTWIGQRVHGLIVLPLLTAACQSLASVRHMAEITEACIMAYFKESSLDQN-LGWGPVLVSLQVPQLTARDFLEECLALGSCLTLYVYLLQCLNSEQTVKNDMKMLLVVSGWLEQVYPSSAQEEAK--LFLWWHQILQLSLIQLEQNDSVLTESVIRILLMLQSRQSLMAEERLSSGILGAIGLGRRSPLSNRFRVAARSMAAFLLVQVPAEDQIRLK--------------PSSELHLA---PKAQQVLTALESMTLSKQYVEYQDQILHA-LQFIRHPGHCLQNGKSFLALLVNRLYPEVHYLDNI 2571          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. UniProt/SwissProt
Match: sp|Q80TA9|EPG5_MOUSE (Ectopic P granules protein 5 homolog OS=Mus musculus OX=10090 GN=Epg5 PE=1 SV=2)

HSP 1 Score: 373.244 bits (957), Expect = 2.480e-102
Identity = 522/2432 (21.46%), Postives = 997/2432 (41.00%), Query Frame = 1
Query:  544 PLGEGEMRVHYKNALLDNLECLQARFIGEMQNL---DPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFL-----------------AGIVTNVRDNGP-----IRTALTILFRFLRQ----PPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI----GRDEVELAITSLAMLLGSRKARDQFL-----EAWNPGLSKEEAG-WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEML-AQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--------------IDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSE--WLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQ--NLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADD----TYYNMVKNLIAKQFPGPV--------LNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFV--SAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR-------------QSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLV--RQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSI---FSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLES--QLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRC---------------NITEHNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALA-FKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVE-----HLNIIASYVTNNDA--RSYLLHCVLIWIANGLLVVKELPAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEV------ANPI-ESDVAAQMFQLVVTFICKTKSVFK--ILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREP-SQKMAM-SLLTEVSQLFKNPHIST---LAIEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQSANPEQWQTRIVDC-LEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKI-------SESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P  + ++++    + L+N+    A ++ E  N+   D H   +L+  Y R  + L   E+ L     DC +A+  LW  +      +  C D   V   + +     N +  G+L        + +     L  Y   ++R Q+E+++                 A  V  + ++ P     ++  +++LF F R+       H D++  +   ++ L R         D  +LL  +L  PAG+ +W  P  +QI        V   + SLA+L+   K R +F+       W P  S   +G W LVD  GE+D+    SW LL E DL+  L Q P   +F+  L         +   DY P     P +++ + AF   ++ +L  GLD +++ RY+   KRI  +I+ T+  ++DH    +S S       L P    +E L  +++ ++   +  +LK +R G    + ++P+  LS    W  L  +              + P + +    +     + +  +  ++  + I LLTA + +A   R   N +   +  I   ++++ YV   TR +FSKVGRELL +I+  HP+ +S++L+  +     VG + L+LF++LP  L  PS  E  ++  WLL+N    V N+LA  +   LNWGF   ++  ++L  +LH  +A L++ +++++ +  K     ++ES+K V+YL     + + P  E SF+ W  +LI+RL+LH +   +   P     S++ + +E     P+  A   +   P+  Y+A+      +  +    + I    ++V+ +  R  +  + +I+      Q  LL   E F++   L +  D          V + +A+   G V         + I    C   V    + V     ++F++ ++ +Q  WY +Q  L+L+D L +    L  +   ++      +       D S  S L      G    + +  L     +W    +L  +   E +  L      R +V+++     F    A+      L L +  ++   +I + A        D+  L  I   FF  YL         L   G +G + FQ       L+  +  +    ++H +   ++R                P  +   +  ++L     + +LW+++      D  + +LP  Y    L  V   Q ++  E  N  R   ++   Q      T+  L+      ++S    F+ P +  A  +    K +     L L  + P  P+ IPS AL       + +   L+ + Q A      ++    L+ + L  + +QY ++       + C     + C   AV+ + +    K   V+ +I   +++  +L  E  Q   L+ VV+  +  ++LI +L +  +LQ      K+       ++LF+ +   ++ ETQ++PP R F ++ +  +G  F+  +  +   LL+ +L+N  L  +  P F PN+  ++   +Y  V+           ++  +L+KF+I+Q+L S+ P L  +  +++ +  A+     E    + +  NL      ++  LL   F      V+           L    W   L    C                +   + ++L+  ++   ++ +  +  K R S    K  GLF K+ P+   +    G L+  L   ++A  + +   S  EV+       ++++ PWI      E++ Q     PWL  D  +A ++V +  +     H +     +  ++   R +LLH      A         P MP   +Y     ++ + W +L P    M+    F       + C      +  ++ W+ V       +P+ E+   A     ++  + K   +       +  L+     L+W  +    Y+  +    S+  P ++L N  + E  I+K L  +AG +S++ D    +D+ + K   + + +V+ LS            A   +G        +  I+ L  ++  ++    D +  ++ MA+ S   EV  +  N  + T   LA+  +  W+ +     I+LP L    QS + +  +  ++E  I  +      D     W  +   +++     + + +EC+   S L +   + Q L S Q+   +     +V   LEQ+ P     E    L ++++  L LS IQ         ++ I+ LL +       +E + SSG  G +GLG++S LS  FR+  RS++ FL VQ+P+ +  R+               PS  +  A    K  Q L  L+S   SK+       ++ + + FI +P HC+ +  +FL  +  +L+P+    + I
Sbjct:  249 PFTKEQLKLLEPGSWLENV----ASYVEEFDNIAHQDRHEFYELLLNYSRCRKQLLLAEAELLTLMSDCHSAKSRLWHFKDEQMAVQGICADQVKVYGHHHYQRVEMNENVLGELKKLFDAKSEHLHQTLTLHSYTSVLSRLQVESYIFTLLNSSAALRSLAVYQADQVPKLTESIPSDVCQLKECISVLFMFTRRVSEDAQFHEDILLWLQKLVSVLQRVGCPG----DHFFLLNHVLRCPAGIRKWAVP-FIQIKVLNNPSGVFHFMQSLALLMSPVKNRAEFMCHMKPSEWKPSSSGPASGNWTLVDEAGEEDEDPETSWILLNEDDLVTLLSQFPFQELFQHLLGF-------KAKGDYLP-ETTRPQEMMKIFAFANSLVELLAVGLDTFNRARYRQFVKRIGYLIRMTLGYVSDHWAQYVSHST---GAGLTPQPYSMEKLQVEFDELFLRAVLHVLKAKRLGIWLFMSEMPFGTLSVQMLWKLLYLMHQVESGDLQQLCASLQPAECKRRLQDPEHFASFEKCLSSINSSEEICLLTAFAQMARARR--TNVDEDFIKIIVLEIYEVSYVTLSTRETFSKVGRELLGAIAAVHPEIISVLLDRVQETIDQVGMVSLYLFKELPLYLWRPSAPEIAVIRDWLLNNNLTAVKNKLACVILEGLNWGFT--EQGTLHLDQALHTEVALLVLEAYQKY-LAQKPYTGLISESMKQVSYLASIVRYGETP--ETSFNQWAWNLILRLKLHKNDFGRQNFPVIPFCSTVPDMTESSMFHPLLKAV--KSGLPIGCYLALAVTAVGHSLEKFCAEGIPLLGVLVQSRHLRAVVHALDKILPVFYPYQCYLLKN-EQFLSNLLLFLQLDSGVPQGVTQQVTHRVAQHLTGAVHGDNVKLLSSMIQAHIC---VSTQPDGVGPVAVLEFWVQALISQHLWYREQPILFLMDHLCKTAFHLMQEDCVQKLLYQQHKNALGYHCDRSLLSSLVNWIVAGNITPSFVEGLSTSTQVWFAWTVLNMESIFEEDSQL------RRVVERELVINAFSPDQALKKAQVQLKLPIVPSLQRLLIYRWAHQALVTPSDHPLLPLIWQKFFLLYLHRPGP-QYGLPVDGCIGRRFFQSPSHVNLLKDMKRRLTEVADFHYAASKALRVPAEGSEGTPEGQAGTPGFLTSPELHRELVRLFNVYVLWLEDENFQKGDTYIPSLPKHYDVHRLAKVMQNQQDLWMEYVNMER---IQHEFQETVALWTQAKLESHAAPCSSSAQLDFTDPLLAKARVLSNLEKHEAPHPPLLLHPVRPPVPL-IPSAALLTQKDSTQLMCTDLNLLQQQARSATLRESQQVALDGELLETMPKQYVNREDQATLHLECRGSSGKKCQGAAVVTVQFEGMNKNEAVSQQIHVLQKEVRQLQAEAAQPPALN-VVEAAVHAENLITALVNTYKLQPTPGVQKL------GISLFFTVVDHVSDETQRHPPTRQFFTSCIEILGQVFVSGTKSECRKLLQTILKNRRLCSLLAPFFTPNAAPAEFIQLYERVVTCLRED--NSDVIFMLLTKFDIQQWLNSTKPPLSDRTRLLESIHLALTAWGLEPEEDILMPFNL---FCKHWTHLLLYQFPDQYSDVLRLLVQSSAEQLLSPECWKATLRALGCYAPSSQQGAASVESSGLHSASRVLLSDKQVMETVQWLSDFFYKLRLSKLDFKSFGLFSKWSPYMADVKTFLGYLVKRLTDLEIASLSQDPTASSKEVLRSLHAQIIQLFKPWILVLEDAESSHQR--HYPWLESDTAVASSIVQLFSDCVGSLHTSFKDRLLPGDEGALRLHLLHYCETCTA---------PKMPEFILYAFHSAYQRLEWKDLHPDQRLMEAF--FKVERGSPKSCFLFLGSVLCRVNWVSVLSDAWNPSPLPETQSMAVCLLFMMVLLAKEAQLVDEPDSPLLSLLGQTSSLSWHLVDLVSYQSVLGYFSSHYPPSVVLANDCSSE-LIVKLLKVSAG-LSAHADGRKHVDI-VPKCQAFTHQMVQFLS------------ALEQTGKIT-FPALEREISKLLDDI--IIFNPPDMDSQTRHMALSSFFVEVLMMMNNAAVPTAEFLAVS-IRTWIGQRVHGLIVLPLLTAACQSLASVRHMAEITEACIMAYFKESSLDQN-LGWGPVLVSLQVPQLTARDFLEECLALGSCLTLYVYLLQCLNSEQTVKNDMKMLLVVSGWLEQVYPSSAQEEAK--LFLWWHQILQLSLIQLEQNDSVLTESVIRILLMLQSRQSLMAEERLSSGILGAIGLGRRSPLSNRFRVAARSMAAFLLVQVPAEDQIRLK--------------PSSELHLA---PKAQQVLTALESMTLSKQYVEYQDQILHA-LQFIRHPGHCLQNGKSFLALLVNRLYPEVHYLDNI 2571          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. UniProt/SwissProt
Match: sp|Q9HCE0|EPG5_HUMAN (Ectopic P granules protein 5 homolog OS=Homo sapiens OX=9606 GN=EPG5 PE=1 SV=2)

HSP 1 Score: 358.992 bits (920), Expect = 4.767e-98
Identity = 525/2443 (21.49%), Postives = 998/2443 (40.85%), Query Frame = 1
Query:  544 PLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEH-----ALAKYEVGINRQQIENFLAGIVTN--------VRDNG--------------PIRTALTILFRFLRQ----PPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI----GRDEVELAITSLAMLLGSRKARDQFLEAWNPGLSKEEAG------WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEML-AQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--------------IDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPSTR------PKVVDPEYLKPSSIT----NTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQ--NLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNL---IAKQFPGP-------VLNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGL---GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR-------------QSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVR----QANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSI---FSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSL--ESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNI---------TEHNELVLNIDEI---RMELETIGAWLN----KSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALA-FKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTN----NDARSYLLHCVLIWIANGLLVVKELPAMPYHDIYCLK--FRLITWELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEV------ANP---IESDVAAQMFQLV-----VTFICKTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAM-SLLTEVSQLFKNPHISTLAI--EPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSANPEQWQTRIV----DCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLL-------KISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P  + ++++    + L+N+E     F   M + D H   +L+  Y R  + L   E+ L     DC  A+  LW+ +      +  C D   V   + +     N +       +L +L DA   EH     AL  Y   ++R Q+E+++  ++++        +   G               ++  +++LF F R+       H D++  +   ++ L R         D L+LL  +L  PAG+++W  P  +QI        V   + SLA+L+   K R +F+    P   K  +       W LVD  GE+D+    SW LL E DL+  L Q P   +F+  L         +   DY P     P +++ + AF   ++ +L  GL+ +++ RY+   KRI  +I+ T+  ++DH    +S +   Q   L      +E L  +++ ++   +  +LK +R G    + ++P+  LS    W     +              + P Q +    +    TN +  +  M+  + I LLT  + +A   R   N +   +  I   ++++ YV   TR +FSKVGRELL +I+  HP+ +S++L+  +     VG + L+LF++LP  L  PS +E  ++  WLL+     V N+LA  +   LNWGFA   +  ++L  ++H  +A +++ +++++ +  K     ++ES+K V+YL     + + P  E SF+ W  +LI+RL+LH +        P V       P S+T      S    P+  A   +   P+  Y+A++     +  +    + I    ++V+ +  R  + ++ +I+      Q  LL   +   ++   +         + + +   +A+   G        +LN +  +     V    N+V     ++F++ ++ +Q  WY +Q  L+L+D L +    L  +   ++      +       D S  S L      G    + +  L     +W    +L  +   E +  L   +    ++       T   A+      L L +  ++   +I + A        D+  L  I   FF  YL           GL   G +G + FQ       L++ +  +    ++H +   ++R                P  +   +  ++L     + +LW+++      D  + +LP  Y  D+  L +    Q ++  E  N  R   +    Q   G  T+  L+      + S+   F+ P +     +    K +     L L    P  P+ I S  L +     + V   L+ + Q A      ++    L+ + L  + +QY ++       + C     + C   AV+ + +    K   ++ ++   R++  +L  E  +  +L+ +V+  +  ++LI +L    +LQ      K+       ++LF+ +   ++ ETQ++PP R F ++ +  +G  F+     +   +L+ +L+N  L  +  P F PN+  ++   +Y  V++          ++  +L+KF++KQ+L ++ P L  +  +++ +  A+     E    + +  NL      ++  LL   F      ++           L    W   L    C           TE   L  + D +   +  +ETI  WL+    K R S    K  GLF K+ P+   +    G L+  L   ++   A +   S   V++    + ++++ PWI      E+++Q     PWL  D  +A ++V +  + ++ +     +     DA +  LH +    A         P MP   +Y     +R + W+ L   D M +   F       + C      +  ++ W+ V      ++P     S +   +F ++     V  + +T S      +  L+     L+W  +    Y+  +    S+  P IIL   S  E  I+K L  +AG +S   D+   +D  + K   + + +V+ LS     T  +N K   +  +    KL    I     +M+S          ++ MA+ SL  EV  +  N  I T       +  W+ +     ++LP L    QS + +  +   +E  I  +      +   + W  I   +++     +++ +EC+   S L +   +L  + S    + + +++      LEQ+ P     E+   L ++++  L LS IQ         ++ I+ LL        ++E + SSG  G +G G+KS LS  FR+  RS++ FL VQ+P  +  R+    PG   H               T K  Q L+ L+S  SSK+       ++ +   FI +P HC+ D  +FL  +   L+P+    + I
Sbjct:  254 PFTKEQLKILEPGSWLENVESYLEEF-DSMAHQDRHEFYELLLNYSRCRKQLLLAEAELLTLTSDCQNAKSRLWQFKEEQMSVQGICADQVKVFSYHRYQRVEMNENAL----VELKKLFDAK-SEHLHQTLALHSYTSVLSRLQVESYIYALLSSSAVLRSSAIHQQGRASKQTESIPSDLCQLKECISVLFMFTRRVNEDTQFHDDILLWLQKLVSVLQRVGCPG----DHLFLLNHILRCPAGVSKWAVP-FIQIKVLHNPSGVFHFMQSLALLMSPVKNRAEFMCHMKPSERKPSSSGPGSGTWTLVDEGGEEDEDPETSWILLNEDDLVTILAQFPFHELFQHLLGF-------KAKGDYLP-ETTRPQEMMKIFAFANSLVELLAVGLETFNRARYRQFVKRIGYMIRMTLGYVSDHWAQYVSHN---QGSGLAQQPYSMEKLQVEFDELFLRAVLHVLKAKRLGIWLFMSEMPFGTLSVQMLWKLFYLMHQVESENLQQLSSSLQPAQCKQQLQDPEHFTNFEKCLSSMNSSEEICLLTTFAQMAQARR--TNVDEDFIKIIVLEIYEVSYVTLSTRETFSKVGRELLGTITAVHPEIISVLLDRVQETIDQVGMVSLYLFKELPLYLWQPSASEIAVIRDWLLNYNLTVVKNKLACVILEGLNWGFAK--QATLHLDQAVHAEVALMVLEAYQKY-LAQKPYAGILSESMKQVSYLASIVRYGETP--ETSFNQWAWNLILRLKLHKNDYGIQPNCPAV-------PFSVTVPDMTESPTFHPLLKAV--KAGMPIGCYLALSMTAVGHSIEKFCAEGIPLLGILVQSRHLRTVVHVLDKILPLFYPCQYYLLKNEQFLSHLLLFLHLDSGVPQGVTQQVTHKVAQHLTGASHGDNVKLLNSMIQAHIS--VSTQPNEVGPVAVLEFWVQALISQHLWYREQPILFLMDHLCKAAFQLMQEDCIQKLLYQQHKNALGYHCDRSLLSSLVSWIVAGNITPSFVEGLATPTQVWFAWTVLNMESIFEEDSQLRRVIEGELVINSA---FTPDQALKKAQTQLKLPIVPSLQRLLIYRWAHQALVTPSDHPLLPLIWQKFFLLYLHRP----GPQYGLPIDGCIGRRFFQSPAHINLLKEMKRRLTEVADFHHAASKALRVPAEGSEGLPESHSGTPGYLTSPELHKELVRLFNVYILWLEDENFQKGDTYIPSLPKHY--DIHRLAKVMQNQQDLWMEYLNMER---IYHEFQETVGLWTQAKLESHSTPCSLSVQLDFTDPLLAKERVLSNLRKHEAPQPPLALHPTKPPVPV-ISSAVLLSQKDATQLVCTDLNLLQQQARTAALRESQQVALDGELLDTMPKQYVNREEQTTLHLECRGSSGKKCQGAAVVTVQFEGMHKNEAISQQLHVLRKEVKQLQAEAAKPPSLN-IVEAAVHAENLITALVNAYKLQPTPGIQKV------GISLFFTIVDYVSDETQRHPPTRQFFTSCIEILGQVFISGIKSECRKVLETILKNSRLCSLLSPFFTPNAAPAEFIQLYEQVVKFLSED--NSDMIFMLLTKFDLKQWLSATKPPLSDRTRLLESIHLALTAWGLEPDEDILMPFNL---FCKHWTYLLLYQFPDQYSDILRLLMQSSAEQLLSPECWKATLRALGCCAPSCQQGAASTEGAVLPSSSDALLSDKQVMETI-QWLSDFFYKLRLSKMDFKSFGLFSKWSPYMADVKTFLGYLVKRLIDLEMTCLAQDPTASRKTVLKSLHSVIIQLFKPWILVLEDNESSQQR--HYPWLESDTVVASSIVQLFTDCIDSLHESFKDKLLPGDAGALWLHLMHYCEACT------APKMPEFILYAFHSTYRKLPWKDLHP-DQMLMEAFFKVERGSPKSCFLFLGSVLCEVNWVSVLSDAWNSSPHPETRSMIVCLLFMMILLAKEVQLVDQTDS-----PLLSLLGQTSSLSWHLVDIVSYQSVLSYFSSHYPPSIILAKESYAE-LIMKLLKVSAG-LSIPTDSQKHLD-AVPKCQAFTHQMVQFLS-----TLEQNGKITLAVLEQEMSKLLDDIIVFNPPDMDS---------QTRHMALSSLFMEVLMMMNNATIPTAEFLRGSIRTWIGQKMHGLVVLPLLTAACQSLASVRHMAETTEACITAYFKESPLNQN-SGWGPILVSLQVPELTMEEFLQECLTLGSYLTLYVYLLQCLNSEQTLRNEMKVLLILSKWLEQVYPSSV--EEEAKLFLWWHQVLQLSLIQTEQNDSVLTESVIRILLLVQSRQNLVAEERLSSGILGAIGFGRKSPLSNRFRVVARSMAAFLSVQVPMEDQIRLR---PGSELH--------------LTPKAQQALNALESMASSKQYVEYQDQILQAT-QFIRHPGHCLQDGKSFLALLVNCLYPEVHYLDHI 2578          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. UniProt/SwissProt
Match: sp|A5WUT8|EPG5_DANRE (Ectopic P granules protein 5 homolog OS=Danio rerio OX=7955 GN=epg5 PE=3 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 8.660e-97
Identity = 528/2434 (21.69%), Postives = 1008/2434 (41.41%), Query Frame = 1
Query:  541 EPLGEGEMRVHYKNALLDNLECLQARFIGEMQNL---DPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTN--------VRDNG------------PIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI----GRDEVELAITSLAMLLGSRKARDQFLEAWNP-------GLSKEEAG-WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTDNDWFLT---------------NLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPSTR-PK---VVDPEYLKPS--SITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVAD------VNMLKVIQNLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNL---IAKQFPGPVLNCIGNSFCPSLVIAN------GNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFR---LGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGL---GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIR----QSNPTNILLIDQT------------QKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLV--RQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIAT--KILQRFKRQTS--CSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSY--ESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNE------LVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLD-ALAFKLARSATENICSWH--EVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNN---DARSYLLHCVLIWIANGLLVVKELPAMPYHDIYCL--KFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEV--------ANPIESDVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQI-------SDREPSQKMAMSLLTEVSQLFKNPHISTLA--IEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILC----IVQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFI-------QFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            +P    ++R+    + L+N+E  +A F    QNL   + H L +L+  Y R  + LT+ ++ L+ A  DC   +  LW  +      +  C D   V   + + +   N     +L    +   + +    AL  Y   ++R Q+E++L  ++++        V+D              P++ ++++LF F R+          IH W+  L   L    +  D L++L  LL  PAG+ +W  P  LQI        V   + +LA+L+   + R  FL    P        L++  +G W LVD  GE+D+    SW LL E DL++   Q P   +F+  L +           DY P       K++ + AF   ++ +L  GL  Y++ RY+   KRI  +I+ T+  ++DH    +S + + +           ++  +++ ++   +  +LK +R G    + ++P+  LS    W    +++   +++        L+                 QL + +++  D I LLT  +++A   R  ++ E   +  I   ++++ YV   TR  FSKVGRELL++I+  HP  +S++LE  +     VG + L+LF++LP  L MP+  E  L+  WL++     V N+LA  +   LNWGF       + LP  LH  +A L++ +++++  D   G   ++E IK V+YL       Q P  E SF+ W   +++RL+LH + R P+      P    PS   IT+ S  + P+  A   +   P+  ++A+      +  +      +++LK +    ++ +  R  + ++  I+     N    LL  E F++  +L +  D     + + +   +A+   GP   C       S++ A+        +V     ++F+L  +T Q  WY D++ L+LLD +     +  L    E    ++ Q  +        +  L+ I      G    + I        +W    IL  +   E +  L   +    L        T   A+      L L +  ++   +I + AQ   +   D+  L  +   FFQ YL   R    +  GL   G +G + F        L+  R  ++   ++H +   +++      +  + LL   T             ++     +  LW+D+  L  +++ + +LP QY    L  +  RQ  +  E  +  R  +  + ++    W+            ++SIF+    P+A   +IL   ++  +   S L +P  AP     IP+ +L +       +   L+ +   A      +     L+ + L  L + Y ++    + Q+ C  K  Q C   A I + Y++  K   V ++I   + D  +L  + ++ +    + +  +  ++ I +L +  +   +   +KV     +  FY +   +  +TQ++PP R F ++ +  +G  F+     +   +LK +L N  L  +  P+F PN+  S+  ++Y +V+ +   +SG     ++  +L+KF++ Q+L ++ P    +  +M V+  A+     E   ++ +  N+   +    +     D      R++   SS   +  L    W   L+   C+    N+      ++L+  ++   +E +  +  K R S+   +  GL  K+GP+   +      L+   +  +L     E + S    + +E       K++ PWI    T +NT       PWL  D  +A +LVG+       +     +      R  L   ++ +           P MP + +Y    ++  + W +L P    M     F       + C     ++  ++ W+ V         NP    +   +  L+V F+ K        ++  L+D    L W+ +  S Y Q + + VS   P  ++ +  T   ++++ L  AAG            DMT+  Q  +++++V+ L+   S  Q  N                 + +  L +EME ++  I       +D +       SL  E+  L     IST       + CW+++    P++LP L    +  + +  +   +E  I ++  +D      + W  I   +++     + + +E +   S L     I+Q++ +     N ++    +   + Q+ P    +E    L    +L+LL   IQ       +    I         L+++ E + +SG  G +GLG+KS LS  FR+  RS+S FL VQ+PS N  R+H   PG     ++ + ++A        + L  L+ + S +   EL  +    ++    FI  P HC+ D+   L  +   L+ D    ++I
Sbjct:  208 KPFTSEQLRMWEPGSWLENVELHEAEF----QNLAHQEGHELYELLLSYWRCRKQLTQAQTELQAANSDCKNVQNRLWSFKDERLSLQGICADQNKVYGYHCYQQVTLNEAALAELKHLFSAKAEILHQTVALHSYTSILSRLQVESYLYRLLSSNPTTKSVAVQDTSAGNPKSQPSSLQPLKESISVLFIFTRRVLDDSQFQADIHLWLQRLVSVLHQVGSTGDHLFILNHLLCCPAGVGKWAVP-FLQIKVLDNPSGVYHFMQALAILMSPARHRPDFLGHMKPSDARGNNSLTEPASGNWTLVDEGGEEDEDPETSWMLLSEDDLVSLFSQFPFDELFKHLLGICSKG-------DYQPL-ATTSQKMMKIFAFASSLVELLAVGLQTYNRARYRQFVKRIGHMIRMTLCYVSDHWAQYISLTGVSRTTVQEQSFSMEKLQVEFDHLFLRAVLHVLKAKRLGIWLFMSEMPYGTLSSSMLWKIF-YIMQCAETDGLEKLSCSLSAEDCIQRLRESSHQERFQLWLSEINSSDGICLLTTFAHMAQPRRTDVDPE--FVRNIVLEIYEVSYVSVTTREIFSKVGRELLAAIAAAHPHIISVLLERLRETIERVGMVSLYLFKELPLHLWMPAQEEVGLIRDWLMNFSLTAVENRLACIILEGLNWGFQ--PNGCLILPAPLHSDVALLVIEAYQKYLTDKPYGG-ILSEGIKQVSYLANVVRLGQTP--ESSFNQWAWDIVLRLKLHANERSPQDAWCPLPSSSAPSVPEITD-SPIMHPVFKAV--KAGIPIGCFLAIEMTTIGHSLEKFCSEGISLLKTL----IQSRHLRAAVHILENIL-PLVYNCQFYLLKNEQFLSCVQLFLQLDSGTQGVTQQVTQKVAQHLIGPA-TCENIKLLNSVIQAHVLESSRNGRVGAVAVLEFWLQVLTEQSLWYRDRAVLFLLDHMCR---SAFLHQQEECLQKILYQQHKSALGYHGDKGLLSSIMGWIVAGNVTPSFIEGSSLTGEVWFAWMILNMETMFEEDSQLRRCVEHELLSNPA---CTPDQALKKAQVRLKLQVVPSLQRLMIYRWAQQALATPADHPILPLVWQKFFQLYL---RQPGPEF-GLEVKGCIGRRYFHSAAHLSLLKSLRQRLVEVSDFHHAASKALKVPCASGDSGDGLLTPGTPITQYMTSPDLHTEIVRLFTVFALWLDDENLQKQEIYLPSLPKQYDTHRLAKIMQRQQEVWMEHVDIER--VQHELQEVLDLWSKVKSEPAVSQNSSSSIFTDFINPLAARERILTHLRKHDAPQGSLLPVPMKAPVP--DIPTASLTDEKISTTLIQEDLTKLQHQAKLATVRETQQVALDNELLEVLPQLYINREDQLSMQLECRGKSGQPCQGPANITVKYSSMHKLEPVQNQIQSLKSDIKQLQADGIK-APPQSLAEAAVHTENFITALVNVFKQNPSPGVLKV----GITAFYQIVSFVCEDTQRHPPTRQFFTSCIEILGQVFIRDVQSECKHMLKTILLNRRLCNLLSPYFTPNASPSELVSLYEEVVNTLHIDSG----DVIFMLLTKFDLFQWLSTTQPPFSERSRLMTVIHQALCTCGLEPEPEVLMPFNIFCKHWTELLLYQFPDHYSDFLRLLMQSSS---DQLLSPDCWRTSLKALGCSPQTKNKTNKSRSMLLSPQQVDETIEWLSKYFLKLRLSNGDFRSFGLLSKWGPYIEEVKVFWEDLITYVIDLELNHCGKEPVGSPRLLKALENLHRKMAKLFEPWILVLDT-DNTSHPRCS-PWLESDAAVAASLVGLYTRLTETLHEKFKDRLLPGQRGALWLHLMFYCETC-----TSPKMPEYLLYTYHTEYSRLPWKDLHPDQTLMNQF--FNVERGSPKSCFVFMGELLCEVNWVSVLSDSLSPQLNPSTHTMVVSVLHLMV-FLAKEDLSKPESSVLSLLDQSASLPWNLVDFSSY-QNVTRYVSTHYPASLVLSHDTSSQQVVRLLRMAAG-FEPTTQVLHHKDMTLKCQA-FLHLMVQFLT---SLDQNGN-----------------ISLASLETEMEKLLENIVIFNPPETDLQQRHMATCSLFAEMLTLLNEAGISTAEGLGTKLHCWVEKRARGPLLLPLLTAACRCLASVRHMTRTTEACILSY-FTDGCVDQYSGWGPILVSLQVPELTVEDFIQESLSLGSFLTLYVYILQRLNLEQTLLNEKKTLMLLNTWISQVFPSGPADEAKLFLWWHKFLELL--QIQVDQEDACSLDTLILTLMAFQNRLVQLGEERLNSGILGAIGLGRKSPLSNRFRVVARSMSAFLLVQVPSENQLRLH---PGT----ELQLSAKA-------QQALSALEAMASNKQYSELHVS----VNQACQFIKYPNHCLRDANTLLTLLVNALYTDLHYLDII 2531          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. UniProt/SwissProt
Match: sp|Q9VE34|EPG5_DROME (Ectopic P granules protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=Epg5 PE=1 SV=2)

HSP 1 Score: 257.684 bits (657), Expect = 3.679e-67
Identity = 397/1782 (22.28%), Postives = 729/1782 (40.91%), Query Frame = 1
Query:  631 MQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTNVRDNG-------------------PIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSL------------------LQIGRDEVELAITSLAMLLGSRKARDQFLEAW---------NPGLSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDY--DPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLS---WSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTD--NDW------------FLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMD--SKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLH------PSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADV---NMLKVIQNLVV--RHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKVQQELT-MKFFLNSITNQINWYTDQSFLWLLDKLLELNTAL-DLQT-GTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVG--HKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSC------STLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNK--GAQLCTNHAVINLNYTTWVKRPDVTS-EISRNRQDYNKLVDEMLQFSNLDRVVQGV----LCLQHLIMS-LESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPN-SDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMT-SFSSMCDNGKLGVRFWDLVLECF-RCNITEH---------NELVLNIDEIRMELETIGAWLNK----SRFSDTRCKQNGLFGKYGPHSVYIMKICGQLL---DALAFKLARSATENICSWHEVVEKS-----WDLYLKVYIPWIQSFYTCENTE------------QGELRLPW 5577
            ++  +  PL   +  Y      +T     + + R  C  ++  +W  +         CGD  +V+   ++D    +  +       LT L D V   +        I + +++  +  ++T    +G                    +R A++ILF F+R+P  + +  + + +W+  L        T ED  +LL+ +L  P G+  W A  L                  L +   E+   +  L +LL   K R+++L++           PG +     W +VDSDGED  T       L+ESDL+A L Q+P  +IF +AL +       + +DDY  +P       ++L ++ F  +++  +  GL  Y+  RYK L KR+ R+++HT+Q + D+ EL ++   + +   ++R+     +VE+ A    +       I + R  G  Q    +P+  L     W    +L        PTD  ND             F     LA   ++ +D  YLL     +A E     + +  L+ AI   +F I Y+   TR    K  R++L+  +L        +L   K+ +  V Q   +LF+ LP     PS   F++LS+WLL        +QLAR + S+LNWG     E  ++LP ++H RMA L+  +  +++ +    SG   ++ES++ V+ L  + + ++EQ F  WC  ++  LRLH       S R  +  P   +P       E ++ I     E  + P+A+Y+ +  +   +   +   +   ++Q L++  RH     CLELI  +   +       L  CE F  +   +++AD TY  + K+++     GP+L  + N     ++      +   L  +  +LN  T    W  + + L+LLD++L ++    D +    E FY   K  TE  +  A K S L   F  G    + I  + P N  WL   ILE +  + +   ++ ELL +   +        V A       L  + +   +  VI + AQ+LAS +  +     +   FF+ YL      N+ L    + G   K ++ ++  P ++  +  + +A++Y+     ++   N  +  +    +   + ++   LW+++ +++       +LPAQY  + L  +   ++   +       L ++ R  A  W        + +RL+N     P  P+  K  Q   +            ++ P     +PI  P      + QI       ++++  +A  +    + L  L+  YL  +   Y   P  +  +  C      + CT  A I L     ++  DV S + ++NR+ ++K+++++L   +++   Q +    +C+  L+++ LES             +    + +FY +   +N  T K+ P        +  +G       + Q   +L+  L+   L+E+    F P+ +D     +MY  +I S+    C  + +  + SKF++  ++E+    LS++  + +L      A  +    L     L+++   + V +   DF      VM        D   + V   DL+   F R N  E          +EL L+    R +L T+ A  +     SR        +GL G Y  H  Y    C  L+    +    L  SA   ICS+ E++        +   ++ Y PW+   YT E               Q ++ LPW
Sbjct:  182 LETSEADPLYAAVMEYYELQGKITSNLHDVEKLRKGCAESQKQIWVRQPVTRTFSGTCGDGNVVQECVTYDVIQVDPIKLEVAKTSLTGLYDLVCHAYTNNSITAKITKVKVDQIINDLLTYPNLDGHSVVSLHHTQSGEALQCVSQLRRAISILFSFVRRPSPNANFDKDLKEWLRKLIALQLLLATREDHWFLLFNILRCPNGVGSWAAQFLQLPGTRAVRRGSQQNELPLDLNSPELNHCMAVLQILLMPVKKRNEYLKSQAQAHRELSDTPGATDR---WIVVDSDGEDSHTPAGECVGLKESDLVALLNQMPFEKIFTSALRI------EKFLDDYIIEPDM-ITAQQMLAVVVFFSQLVKTIGEGLLTYNNERYKQLAKRLGRLVRHTLQYVFDYNELFINNNLYKSSEMYERI-----QVELQA----LLVRACGYIYRTRNLGTWQYFSTLPFGTLDAEVIWHLFYYL----NVGFPTDLANDLVSNAEAAFQAEDFWRKFDLANADVAPEDMYYLLQTFFEMANERNR--SKDGSLVKAICLHIFHIGYIHKSTREICYKTARDMLA--NLMDEDLFGCVLVQLKMRYGEVDQAA-YLFKALPLENWHPSMDTFEVLSNWLLHFDYQSSESQLARLIISHLNWGLDC--EGRLFLPHNIHVRMAHLVNEALNKYAPEVIGASG---ISESVRQVSSLIDSTQSSREQ-FTNWCWRMVSVLRLHLMDQGVESVRRTLQHPT--EPLLFIPELERMEMIFQGVNE--NRPLALYVGMLVSLHGHSIPLICQHGFILLQQLLLDHRHAATIRCLELIVPLFLETPET----LANCESFQRLITTLLNADRTYLKLAKDMVYANSIGPILELLDNMLHHQIISYTSYGLCSPLNLLNIWLNCFTTLPGWSQNSNLLYLLDRMLRISYQFPDCRAQAVEFFYNYYKDCTE--WKSAPKGSALKAFF--GGQSVSRIPLISPQN-CWLNLVILEIEFRLVD-TRIFPELLRQISAQP-------VEAALKKTISLSKTSAFPASQLVIFKYAQLLASMESTHALFPIVCQKFFELYLWRVPTENESLNFSHNFGVSDKFYEYNV--PLMKSIKSQLKSAESYY----SALATKNANDDAMAHFYRNCCKLMQNCALWLEDTQINRFTSDAEHLPAQYNSEKLRELLSGHVNHWTEFLCLASLRKEQRHQADQWGR------KVMRLSNQ--KAPRTPVQPKQRQPPAQHIKSLLKSYEKIVENPLHIRVEPIKTPPIDGVIVAQI----QKKMTTLNSTANNYHYKTSELNSLDLNYLERVPTLYSMIPYEETRRKECTSLLFKRNCTAPAQIKLT-PEHIRINDVISRKQAQNRERHDKIIEDILLAMSVESFAQAIEELGVCIGALLVAPLESS------------VTQIGVRVFYDIVDNLNEVTMKFQPTHDLYFQVLEKLGVFLEADQAAQGLAILRLALKRPDLLELLAGVFVPSRTDVDHFLSMYEFLIDSHLK-HCDTQTLFVLFSKFDLLGWMEAYQPKLSEINRLLLLVLQGLEAWSQPDSSL-----LQDLFRRHLVHIFGYDFPQHYGEVMQLVLDRTSDQKLMPVVLLDLLNALFVRSNCAELSLQQSEVRVHELALDFAR-RQKLFTLKAATDTLLLLSRHFQKERLHHGLHGLYPKHKDY----CQALVLWFTSFGHTLLASA---ICSYQELLADQISDIVFGSIVETYSPWLIP-YTEETVSGVAHWIRQLTPGQSKVLLPW 1862          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. UniProt/SwissProt
Match: sp|Q0IEK6|EPG5_AEDAE (Ectopic P granules protein 5 homolog OS=Aedes aegypti OX=7159 GN=AAEL009648 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.846e-53
Identity = 245/1052 (23.29%), Postives = 434/1052 (41.25%), Query Frame = 1
Query:  649 HPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENF------LAGIVTNVRDNGPI------------------RTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI--------GRDEVELAITSLAMLLGSRKARDQFLEAWNPGLSK-----EEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL-IDPNQSEVPTDNDWFLTNLQLAIDQ----------MSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTR-PKVVDPEYLKPSSITNTS---EWLQPISDAQQERCSHPVAMYIAVTTNNDSY-VADVNMLKVIQ-NLVVRHQQYRL---CLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSV-ENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLG 3630
            HPL QL++ Y ++    +         R  C      LW +  +       CGD  +V  ++    A           + L +L+     + + + YEV   R +IE        L  +++N+  + P+                  R  ++ILF FLR+       +  +  W   L        TV D L++L+ +L +P+G+  W A SL+Q+        G  E +  +  +A +L   K R++FLE     +++     +E  WA+VDSDGED      S S L+E DL+A + QIP   +FRA   V    D + ++ + D  RG H   ++  +AF    + +L  GL  Y+ +RY+   KR++R+IKHT+  ++D   ++L  +   Q         R+ +  + +       + I + R+ G  Q L   P+  LS    W    FL +D    E+ T       +L +  +Q          M  +D  YLL   SN+AL +R + + E +   A+    F I Y+   T+    K  ++LL +I  +HP  +S +L+  K          L++F+ LP     P   +F+LL++W+L+   + V +  AR +  +LN+ F + +E  ++LP  +H R+A L+   + +H  +       +  S+  +      +    +  F AWC +++  LRLH   + P V++     P+ I       E  Q I     E  + P+A+Y+A+  +   + V  +      Q  L++   +Y +   CL+LI+ +      +    L  CE F ++   ++ AD  Y    K+    +   P L                                T   NW  D + + LLD +  +                       QF DA     + + FR   + +++I        ++L  + LE +  + E + G+W E++ R +        T  +AI      L    S   +S  + + A ++A+C   N     +  +FF  YL 
Sbjct:   43 HPLYQLLQRYAKARAEFSLNVLEFEALRRKCKALANELWTVREQTFAGTGTCGDGKVVHASHISSVAALQESALADFSSNLQDLMKQSFFQCSQSTYEVDATRIKIEQKIYETLNLHPVLSNLPADSPVVLNPPIDAMQLTAAIGELRLCISILFAFLRKGITDKRFLADVRGWTVKLVATQLRIATVHDHLFVLFHVLRSPSGIANW-ATSLVQLPTEQDLRWGSSEFQHILVVMACILLPIKKRNEFLEKLKLDMNRSIDVVQEEMWAIVDSDGEDCSG-SDSISELKEGDLVALIDQIPFGMVFRALTLVDRKLDGTWRLGE-DQVRGTH---VMKAIAFGTIFVELLGNGLMTYNADRYRQFAKRVARLIKHTVYYVSDLYRILLERTRSVQVVLDDYETTRINL--ELDVFVVRAAQYIYRSRKIGTWQYLSGFPFDQLSVGALWKLYYFLHLDEFNEELITAVGTDFRDLCIGPNQREKFRNGLVGMPSEDLYYLLQVFSNMAL-AREIDDFEFIETVALNL--FDIGYLNEYTKDFCYKAVKDLLFNIVYKHPSLVSSLLQYMKQDVAQADHSALYVFKSLPLDRWRPQWDDFELLANWILNYGFDAVQSSTARVILIHLNYNFDSNNE--LFLPHDIHVRIACLITEIYSKHVPELLGNPQGLVASVSSLV-----KNKTAQDQFLAWCWNMVSLLRLHCMDQSPTVINGMMKNPALILRYVLELERAQQIYQGVTE--NRPLAIYLAILISTWGHSVPQICHQGFEQIRLLLNDHRYVVVVRCLQLITPLFLECPDS----LSHCESFKSILISLMAADKYYARFTKDQFKPESNSPCL--------------------------------TELPNWTKDPAIIGLLDAMAGV---------------------AYQFPDAWH--SMKEFFRPYFSVSSIILHSPSSATVFLSIFTLELEYELTEIQSGIWHEVI-RGIGLPSSPKLTIETAIKKSTSILGYP-SFPPSSLAVFKLANLVANCTIKNFMYPIVCQLFFTIYLS 1013          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. TrEMBL
Match: A0A1S3J4D9 (ectopic P granules protein 5 homolog OS=Lingula unguis OX=7574 GN=LOC106169995 PE=4 SV=1)

HSP 1 Score: 523.857 bits (1348), Expect = 1.342e-146
Identity = 567/2447 (23.17%), Postives = 1028/2447 (42.01%), Query Frame = 1
Query:  544 PLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTN------VRDNGPI-------------------RTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGA-------PSLLQ----IGRDEVELAITSLAMLLGSRKARDQFLEAWNPGLSKE-----EAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--IDPNQS---------EVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDS----YVADVNMLKV--------------IQNLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKV----QQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVV----KQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQL---------DSIRQSN--------PTNILLIDQT--------QKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPD-LLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRH--DLDFRFVRLANSIFSKPTVPIAT-KILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGAQL---CTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLES-SPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITE-------------HNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALAFKLARSATENICSWH--EVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHL--------NIIASYVTNNDARSYLLHCVLIWIANGLLVVKELPA--MPYHDIYCLKFRLIT--W-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIA-SQMRWMEVAN------PIE--SDVAAQMFQLVVTFICKTKSVFKILA--IEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFK--NPHISTL-AIEPVIC-WLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFF--YLQLLLSAIQNSPRPG---SAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRI--HSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P  + +++  Y N LL++ +     F+ + Q  D H   +L+  Y R+  +    E  L   + +    E  +W      A  +  C D   V   + + +  F+   +G +   L+ +  A+ D  AL  Y   ++R Q+E+++  +  N      +  N P+                   +  ++ILF F R+P       +    W+T L   L    T+ED  ++L  +L  PAG+ +W +       P L +    +G   ++  I  LA L+   KAR  FL   N  L+       +  W LVDSDGE+D+   +SW  L+E+D++A L Q P+  +FR AL +    +  ++  D           +L + AF   +M IL  GL  +   RY+  NKRI R+++HTIQ ++DH      W          P   +  +  + + V+      IL  ++ G+ Q + D+P+  +S    W  L  L  +D  ++         +   D D  L   +  +  M   +  YLLTA +N+A  SRP  + E +         F+I YV   TR   +K GR+LLS+++  HP  +S +L   +    T+G + ++LFR+LP  L   +  + + +  W+L+ P     NQL R + S LN+G     E  ++L ++ H+++A L++ S+ +  + +K  +  + E +K V  +   Q+ +Q+Q FH W    I++LRLH   +P        +P    N  +   P           PV + I+  T+N+     YVA V M K+              +Q LV +H  Y   ++++  I+     N    L+  E+F  +   ++ AD TY  M K+L+   FPG ++  +    C      NG          + ++ ++N +T    WY D++  +L++ L++  +    + G E   T++    K F + Q   +   S ++ I          +       F WL  ++L A+   +++  LW  +    + K K    T   A+     +L +  S+  +   I +  Q       D+  L  +   FFQ YLG        L   G +GHK F+  +    L++ +  +  A  +H   L         D  R             N+LL +          Q L    + L  W++EP+LH   + +  LP QY  + LL L +        F    ++  E S Q  S W T+     ++R  R  NS+        AT +IL R +R                   +    L +   ++  +S  L+ + + +    A+ +    L+  Y   L   Y ++P ++   I C     L   C   A + + +    +   V   +  NR ++ +L+ +  Q      +    + ++++I++L  +  S   S           ALFY++   I  ET+ YPP R F S+ +  +G +F+  +  ++  LL+ +L++  L  +  PHF+PN+       MY  VI + +S  C   +   +L+KF++ Q+L +  P    +  +++ +  A+     E     E  + + E+   +   L S +F      V+    +    GKL  + W   LE   C                 H++ +    + +  ++ +  +  K R +       GL+ ++ P+   I    G L  +L  K   S      +++  E  E  W   ++V+ PW++  +     + GE+  PW++ D   A ++V +  E +          I  +  N           L+W       VK L A   P H +     RL T  W + LP +  ++L+V+  +   +  +   +F+ +  +QM W ++ N      P+E  + + A +FQL+V  + + K +  +    + +L+ +     W  L    +++  D  +   +P+ +L   S+    +++ L  AAG VS+    S +   T  K+ +YV+ VV+L+         K S+ K    ++     F   I  L +E+E+VV  I D     + +++L  EV QL    NP  +T+ A+   IC W++ S  + ++LP +    +  + I  +V + E  ++ F  S         W  + + ++I     +++  E ++Q S L +   V Q L   QS + E   + I   ++     +  +E    L +++   L LLL  I           +  NFI  L  + E K S+G  G +GLG+ SNLS  FR+  RSLS FL  Q+  NN  R+  H + P  V                      Q +  L++ +++K+ T   K  ID    F+ +   C+ D+   L  +   L+P+ +   ++
Sbjct:  255 PFSDEQLKSLYYNPLLEHQQVFVDDFLQQAQQ-DKHEFYELLMNYYRARVNYVNGEGELSGLQKEFKRQEEMVWVTSEHIATAQGTCLDKVSVSENHQYLQVTFDDKVSGDINKSLSSIRTALYDSLALHAYSAQLSRLQVESYIHQLYINCPFLQEIPRNAPVQAFLPEQRSPQADQQMSVLKKCISILFLFQRRPVKDEQFTQDARMWLTRLVASLLRIATLEDHWFILNHVLRCPAGVGKWASNYIQLVQPRLSRGQSSLGGPLLDNFIAMLATLMLPVKARTDFLSHMNVSLTPSADNGVDNPWVLVDSDGEEDEDPANSWQYLQENDVVALLHQFPLDAVFRHALLI----ETDEEGQDLYFIHKSSEQSMLRLFAFATSLMKILGQGLQTFKLGRYRQFNKRIGRLVRHTIQFVSDH------WMNFKSAFTHLPEQSKQRLQLELDHVFMRATDCILSAQKLGSWQFMADMPYGSVSMEMMWKLLWLLHFVDAGETVQFSVEICKQKMKDPDSKLA-FEEKLLAMPLSEATYLLTAFTNMA-RSRPPEDIEFVNAITEEM--FEISYVSTHTREFCAKTGRQLLSTLATSHPCIISTLLRLIQQHLDTIGMVSMYLFRELPLFLWELTSEDLETIHHWVLNLPLVSTENQLGRLILSRLNYGLTK-QEDRLFLDIAFHRKIAILIVESYLKQ-VAAKGMSGVITEGVKQVASVVSQQKTSQQQ-FHDWAWDTILKLRLHKHQQP--------RPVMGANEDQGFDPCD------LFDPVMLVISKMTDNNGALACYVATV-MTKIGHSVSEFLSAGLPRLQCLVQQH-HYTAVIQVLYVIVPLFYDNPQP-LIKSELFQTILHSLLSADQTYAKMAKSLLYSDFPGEIVKMLA---CMIQTQINGASAMLPYSPPMVIELWMNMLTQNTVWYQDRNVQYLINFLIK--SGHSCKGGKEVIETLMYNQYKMFIKSQGGHSMVSSLVSWIATGSAGIPTFLEGSSLPEFPWLAYHLLHAEEQYQHDSHLWQVVQIELITKPK---LTVDQAVKKAITNLKIEGSLPASRLCIYRWGQQALDTAVDHPLLPLLWQRFFQLYLGRP-AHTPGLPERGGIGHKFFESSVNTSLLKRMKKRLNEATEHHHKVLQEQSLETAADEERSGRDGEAEEEEEENLLLHNVGYQKSREFHQSLVRYYQTLGFWLEEPRLHDPHLYLPGLPPQYDAERLLKLFQNQTEPWVEFLDSAQLDYELS-QMVSEWVTKMCPKANYRMRR--NSMIDAYNPLAATERILGRLQRYEQPLPPPPLVPLKAPLPDVSPSILGDKDTLIYTISADLAGLVEYSKLFMASVSQHLALDLSYQELLPNLYRNEPTMKEMYISCKSTFSLSHNCKGPAFVTVRFEEKKRNESVYQRVEENRSEWKQLLAQSSQ-PPPQNICSAAVHVENVIIALIKEAHS--ESPVPPQYSSVGSALFYHMASMIGDETKYYPPTRQFFSSCIEILGQEFISPNPKESLPLLETILKSPSLGGLLAPHFFPNACPDTFVRMYEQVIDASKSHGC--DVTFMLLTKFDVPQWLGNVRPVHSERSHLVETIGKALCQCGSEPA---ENTLMVFEVYRSHLKKLTSYEFPDQYGDVLKLLLNASSTGKLCPKIWGDFLESIGCKYVRQEGFDLSYADNMMHSQALTTTAQFKESIDWLSTYFMKLRTTTPSLASFGLYSQWKPYVTNISVFLGYLCGSLVLKTVGSLQAGQANFNPQEGAESVWQATVQVFAPWLEPLH----RDNGEVLCPWIVGDTNTAFDMVAMFTESVACNFKQFEGFIPPFARNA--------LTLVW----EYYVKVLSAKKTPEHILQVFHARLTTLQWGKFLPDLQTLELMVKLQA---VGTRESFVFLGLVFTQMPWQDIVNYYLTQQPVEGTTGLMAILFQLLVQ-MSQEKGLMDVQGSDLPRLLLLAESFPWHFLDADNFKRVSDWFLQYCDPKCVLAERSSNSAVVLRLLKSAAGFVSAT--GSPLHPETPRKRALYVHCVVELVC--------KCSQMKGVDPEN-----FTTLILNLLTEVETVVSTIPDLSVQWEESVTLCVEVLQLLNNCNPQTTTVTAVLRSICQWIESSPCTVLLLPLVTAGCRCLASIVHMVQIIENCMDAFFNSGLDLSESYGWGRLLSAMQIPELTFREFLVESLRQGSYLTLYAYVLQHLPKCQSLDEE--NSHIAGIVQWTATAKPTSENEAKLFLWWGKILDLLLRQIDFGASHAIVIRSLNNFIAALTTLGEDKISAGLLGAIGLGRASNLSVRFRLVARSLSAFLQAQIVKNNALRLVPHDHTPANVQ---------------------QIVTSLRNLKTNKQYTPL-KEQIDFACQFVSSRGRCLRDAKFLLAELTGVLFPEKRYLAVV 2587          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. TrEMBL
Match: A0A1S3JCV6 (ectopic P granules protein 5 homolog isoform X3 OS=Lingula unguis OX=7574 GN=LOC106172173 PE=4 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.407e-142
Identity = 567/2461 (23.04%), Postives = 1028/2461 (41.77%), Query Frame = 1
Query:  544 PLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTN------VRDNGPI-------------------RTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAP--SLLQ--IGRDEVELA-------ITSLAMLLGSRKARDQFLEAWNPGLSKE-----EAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--IDPNQS---------EVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDS----YVADVNMLKV--------------IQNLVVRHQQYRL--CLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKV----QQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVV----KQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYH--LSQLDSIRQSN------------------------PTNILLIDQT--------QKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPD-LLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRH--DLDFRFVRLANSIFSKPTVPIAT-KILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGAQL---CTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLES-SPNLLSKLAMMDVLCTAI---GNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNELVLNIDEIRMELETIGA---------WLN----KSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALAFKLARSATENICSWH--EVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHL--------NIIASYVTNNDARSYLLHCVLIWIANGLLVVKELPA--MPYHDIYCLKFRLIT--W-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIA-SQMRWMEVAN------PIE--SDVAAQMFQLVVTFICKTKSVFKILA--IEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPHISTLAIEPVI----CWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFF--YLQLLLSAIQNSPRPG---SAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRI--HSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P  + +++  Y N LL++ +     F+ + Q  D H   +L+  Y R+  +    E  L   + +    E  +W      A  +  C D   V   + + +  F+   AG +   L+ +  A+ D  AL  Y   ++R Q+E+++  +  N      +  N P+                   +  ++ILF F R+P       +    W+T L   L    T+ED  ++L  +L  PAG+ +W +    L+Q  + R +  L        I  LA L+   KAR  FL   N  L+       +  W LVDSDGE+D+   +SW  L+E+D++A L Q P+  +FR AL +    +  ++  D           +L + AF   +M IL  GL  +   RY+  NKRI R+++HTIQ ++DH      W          P   +  +  + + V+      IL  ++ G+ Q + D+P+  +S    W  L  L  +D  ++         +   D D  L   +  +  M   +  YLLTA +N+A  SRP  + E +         F+I YV   TR   +K GR+LL++++  HP  +S +L   +    T+G + ++LFR+LP  L   +  + + +  W+L+ P     NQL R + S LN+G     E  ++L ++ H+++A L++ S+ +  + +K  +  + E +K V  +   Q+ +Q+Q FH W    I++LRLH   +P        +P    N  +   P           PV + I+  T+N+     YVA V M K+              +Q LV +H    +   L +I  + ++S       L+  E+F  +   ++ AD TY  M K+L+   FPG ++  +    C      NG          + ++ ++N +T    WY D++  +L++ L++  +    + G E   T++    K F + Q   +   S ++ I          +       F WL  ++L A+   +++  LW  +    + K K    T   A+     +L +  S+  +   I +  Q       D+  L  +   FFQ YLG        L   G +GHK F+  +    L++ +  +  A  +H  + Q  S+  ++                          N+LL +          Q L    + L  W++EP+LH   + +  LP QY  + LL L +        F    ++  E S Q  S W T+     ++R  R  NS+        AT +IL R +R                   +    L +   ++  +S  L+ + + +    A+ +    L+  Y   L   Y ++P ++   I C     L   C   A + + +    +   V   +  NR ++ +L+ +  Q      +    + ++++I++L  +  S   S           ALFY++   I  ET+ YPP R F S+ +  +G +F+  +  ++  LL+ +L++  L  +  PHF+PN+       MY  VI + +   C   +   +L+KF++ Q+L +  P    +  +++ +  A+   GN   E T      + + E+   +   L S +F      V+    +    GKL  + W   LE   C         L+  +  M+ + +           WL+    K R +       GL+ ++ P+  +I    G L  +L  K   S      +++  E  E  W   ++V+ PW++  +     + GE+  PW++ D   A ++V +  E +          I  +  N           L+W       VK L A   P H +     RL T  W + LP +  ++L+V+  +   +  +   +F+ +  +QM W ++ N      P E  + + A +FQL++  + + K +  +    + +L+ +     W  L    +++  D  +   +P+ +L   S+    +++ L  AAG VS+    S     T  K+ +YV+ VV+L+         K S+ K    ++     F   I  L +E+E+VV  I D     + +++L  EV QL  N +  T  +  V+     W++ S  + ++LP +    +  + I  +V + E  ++ F  S         W  + + ++I     +++  E ++Q S L +   V Q L   QS + E   + I   ++     +  +E    L +++   L LLL  I           +  NFI  L  + E K S+G  G +GLG+ SNLS  FR+  RSLS FL  Q+  NN  R+  H + P  V                      Q +  L++ +++K+ T   K  ID    F+ +   C+ D+   L  +   L+P+ +   ++
Sbjct:  256 PFSDEQLKSLYYNPLLEHQQVFVDDFLQQAQQ-DKHEFYELLMNYYRARVNYVNGEGELSGLQKEFKRQEEMVWVTSEHIATAQGTCLDKVSVSENHQYLQVTFDDKVAGDINKSLSSIRTALYDSLALHAYSAQLSRLQVESYIHQLYINCPFLQEIPRNAPVQAFLPEQRSPQADQQMSMLKKCISILFLFQRRPVKDEQFTQDARMWLTRLVASLLRIATLEDHWFILNHVLRCPAGVGKWASNYIQLVQPRLSRGQSSLGGPLLDNFIAMLATLMLPVKARTDFLSHMNVSLTPSADNGVDNPWVLVDSDGEEDEDPANSWQYLQENDVVALLHQFPLDAVFRHALLI----ETDEEGQDLYFIHKSSEQSMLRLFAFATSLMKILGQGLQTFKLGRYRQFNKRIGRLVRHTIQFVSDH------WMNFKSAFSHLPEQSKQRLQLELDHVFMRATDCILSAQKLGSWQFMADMPYGSVSMEMMWKLLWLLHFVDAGETVQFSVEICKQKMKDPDSKLA-FEEKLLAMPLSEATYLLTAFTNMA-RSRPPEDIEFVNAITEEM--FEISYVSTHTREFCAKTGRQLLATLATSHPCVISTLLRLIQQHLDTIGMVSMYLFRELPLFLWELTSEDLETIHHWVLNLPLVSTENQLGRLILSRLNYGLTK-QEDRLFLDIAFHRKIAILIVESYLKQ-VAAKGMSGVITEGVKQVASVVSQQKTSQQQ-FHDWAWDTILKLRLHKHQQP--------RPVMGANEDQGFDPCD------LFDPVMLVISKMTDNNGALACYVATV-MTKIGHSVSEFLSAGLPRLQCLVQQHHSTAVIQVLYVIVPLFYDSPQP----LIKSELFQTILHSLLSADQTYAKMAKSLLYSDFPGEIVKMLA---CMIQTQINGASAMLPYSPPMVIELWMNMLTQNTVWYQDRNVQYLINFLIK--SGHSCKGGKEVIETLMYNQYKLFIKSQGGHSMVSSLVSWIATGSAAIPTFLEGASLPEFPWLAYHLLHAEEQYQHDSYLWQVVQIELITKPK---LTVDQAVKKAIINLKIEGSLPASRLCIYRWGQQALDTAVDHPLLPLLWQRFFQLYLGRP-AHTPGLPERGGIGHKFFESSVNTSLLKRMKKRLNEATEHHHKVLQEQSLETADIDTGTRRTADEERSGRDGEAEEEEEENLLLHNVGYQKSREFHQSLVRYYQTLGFWLEEPRLHDPHLYLPGLPPQYDAERLLKLFQNQTEPWVEFLDSAQLDYELS-QMVSEWVTKMCPKANYRMRR--NSMIDAYNPLAATERILGRLQRYEQPLPPPPLVPLKAPLPDVSPSILGDKDTLIYTISADLAGLVEYSKLFMASVSQHLALDLSYQELLPNLYRNEPTMKEMYISCKSTFSLSHNCKGPAFVTVRFEEKKRNESVYQRVEENRSEWKQLLAQSSQ-PPPQNICSAAVHVENVIIALIKEAHS--ESPVPPQYSSVGSALFYHMASMIGDETKYYPPTRQFFSSCIEILGQEFISPNPKESLPLLETILKSPSLGGLLAPHFFPNACPDTFVRMYEQVIDASQRHGC--DVTFMLLTKFDVPQWLGNVRPVHSERSHLVETIGKALCQCGNEPAENT------LMVFEVYRSHLKKLTSYEFPDQYGDVLKLLLNASSTGKLCPKIWGDFLESIGCKYVRQEGFDLSYADNMMQSQALTTTAQFKESIDWLSTYFMKLRTTTPSLASFGLYSQWKPYVTHISVFLGYLCGSLVLKTVGSLQAGQANFNPQEGAESVWQATVQVFAPWLEPLH----RDNGEVLCPWIVGDTNTAFDMVAMFTESVACNFKQLEGFIPPFARNA--------LTLVW----EYYVKVLSAKKTPEHILQVFHARLTTLQWGKFLPDLQTLELMVKLQA---VGTRESFVFLGLVFTQMPWQDIVNFYLTQQPAEGTTGLMAILFQLLIQ-MSQEKGLMDVQGSDLPRLLLLAESFPWHFLDADNFKRVSDWFLQYCDPKCVLAERSSNSAVVLRLLKSAAGFVSAT--GSPFHPETPRKRALYVHCVVELVC--------KCSQMKGVDPEN-----FTTLILNLLTEVETVVSTIPDLSIQWEESVTLCVEVLQLLNNCNPQTTTVTAVLRSISQWIESSPCTVLLLPLVTAGCRCLASIVHMVQIIENCMDAFFNSGLELSESYGWGRLLSAMQIPELTFREFLVESLRQGSYLTLYAYVLQHLPKCQSLDEE--NSHIAGIVQWTATAKPTSENEAKLFLWWGKILDLLLRQIDFGASHAIVIRSLNNFIAALTTLGEDKISAGLLGAIGLGRASNLSVRFRLVARSLSAFLQAQIVKNNALRLVPHDHTPPNVQ---------------------QIVTSLRNLKTNKQYTPL-KEQIDFACQFVSSRGRCLRDAKFLLAELTGVLFPEKRYLAVV 2597          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. TrEMBL
Match: A0A1S3JED0 (ectopic P granules protein 5 homolog isoform X2 OS=Lingula unguis OX=7574 GN=LOC106172173 PE=4 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 2.387e-140
Identity = 570/2470 (23.08%), Postives = 1032/2470 (41.78%), Query Frame = 1
Query:  544 PLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTN------VRDNGPI-------------------RTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAP--SLLQ--IGRDEVELA-------ITSLAMLLGSRKARDQFLEAWNPGLSKE-----EAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--IDPNQS---------EVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQM----------GLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDS----YVADVNMLKV--------------IQNLVVRHQQYRL--CLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKV----QQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVV----KQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLD-----------SIRQSNP--------------TNILLIDQT--------QKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPD-LLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRH--DLDFRFVRLANSIFSKPTVPIAT-KILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGAQL---CTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLES-SPNLLSKLAMMDVLCTAI---GNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNELVLNIDEIRMELETIGA---------WLN----KSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALAFKLARSATENICSWH--EVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHL--------NIIASYVTNNDARSYLLHCVLIWIANGLLVVKELPA--MPYHDIYCLKFRLIT--W-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIA-SQMRWMEVAN------PIE--SDVAAQMFQLVVTFICKTKSVFKILA--IEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPHISTLAIEPVI----CWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFF--YLQLLLSAIQNSPRPG---SAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRI--HSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P  + +++  Y N LL++ +     F+ + Q  D H   +L+  Y R+  +    E  L   + +    E  +W      A  +  C D   V   + + +  F+   AG +   L+ +  A+ D  AL  Y   ++R Q+E+++  +  N      +  N P+                   +  ++ILF F R+P       +    W+T L   L    T+ED  ++L  +L  PAG+ +W +    L+Q  + R +  L        I  LA L+   KAR  FL   N  L+       +  W LVDSDGE+D+   +SW  L+E+D++A L Q P+  +FR AL +    +  ++  D           +L + AF   +M IL  GL  +   RY+  NKRI R+++HTIQ ++DH      W          P   +  +  + + V+      IL  ++ G+ Q + D+P+  +S    W  L  L  +D  ++         +   D D  L   +  +  M   +  YLLTA +N+A  SRP  + E   + AIT+ +F+I YV   TR   +K GR+LL++++  HP  +S +L   +    T+G +           ++LFR+LP  L   +  + + +  W+L+ P     NQL R + S LN+G     E  ++L ++ H+++A L++ S+ +  + +K  +  + E +K V  +   Q+ +Q+Q FH W    I++LRLH   +P        +P    N  +   P           PV + I+  T+N+     YVA V M K+              +Q LV +H    +   L +I  + ++S       L+  E+F  +   ++ AD TY  M K+L+   FPG ++  +    C      NG          + ++ ++N +T    WY D++  +L++ L++  +    + G E   T++    K F + Q   +   S ++ I          +       F WL  ++L A+   +++  LW  +    + K K    T   A+     +L +  S+  +   I +  Q       D+  L  +   FFQ YLG        L   G +GHK F+  +    L++ +  +  A  +H   L              R+++                N+LL +          Q L    + L  W++EP+LH   + +  LP QY  + LL L +        F    ++  E S Q  S W T+     ++R  R  NS+        AT +IL R +R                   +    L +   ++  +S  L+ + + +    A+ +    L+  Y   L   Y ++P ++   I C     L   C   A + + +    +   V   +  NR ++ +L+ +  Q      +    + ++++I++L  +  S   S           ALFY++   I  ET+ YPP R F S+ +  +G +F+  +  ++  LL+ +L++  L  +  PHF+PN+       MY  VI + +   C   +   +L+KF++ Q+L +  P    +  +++ +  A+   GN   E T      + + E+   +   L S +F      V+    +    GKL  + W   LE   C         L+  +  M+ + +           WL+    K R +       GL+ ++ P+  +I    G L  +L  K   S      +++  E  E  W   ++V+ PW++  +     + GE+  PW++ D   A ++V +  E +          I  +  N           L+W       VK L A   P H +     RL T  W + LP +  ++L+V+  +   +  +   +F+ +  +QM W ++ N      P E  + + A +FQL++  + + K +  +    + +L+ +     W  L    +++  D  +   +P+ +L   S+    +++ L  AAG VS+    S     T  K+ +YV+ VV+L+         K S+ K    ++     F   I  L +E+E+VV  I D     + +++L  EV QL  N +  T  +  V+     W++ S  + ++LP +    +  + I  +V + E  ++ F  S         W  + + ++I     +++  E ++Q S L +   V Q L   QS + E   + I   ++     +  +E    L +++   L LLL  I           +  NFI  L  + E K S+G  G +GLG+ SNLS  FR+  RSLS FL  Q+  NN  R+  H + P  V                      Q +  L++ +++K+ T   K  ID    F+ +   C+ D+   L  +   L+P+ +   ++
Sbjct:  256 PFSDEQLKSLYYNPLLEHQQVFVDDFLQQAQQ-DKHEFYELLMNYYRARVNYVNGEGELSGLQKEFKRQEEMVWVTSEHIATAQGTCLDKVSVSENHQYLQVTFDDKVAGDINKSLSSIRTALYDSLALHAYSAQLSRLQVESYIHQLYINCPFLQEIPRNAPVQAFLPEQRSPQADQQMSMLKKCISILFLFQRRPVKDEQFTQDARMWLTRLVASLLRIATLEDHWFILNHVLRCPAGVGKWASNYIQLVQPRLSRGQSSLGGPLLDNFIAMLATLMLPVKARTDFLSHMNVSLTPSADNGVDNPWVLVDSDGEEDEDPANSWQYLQENDVVALLHQFPLDAVFRHALLI----ETDEEGQDLYFIHKSSEQSMLRLFAFATSLMKILGQGLQTFKLGRYRQFNKRIGRLVRHTIQFVSDH------WMNFKSAFSHLPEQSKQRLQLELDHVFMRATDCILSAQKLGSWQFMADMPYGSVSMEMMWKLLWLLHFVDAGETVQFSVEICKQKMKDPDSKLA-FEEKLLAMPLSEATYLLTAFTNMA-RSRPPEDIE--FVNAITEEMFEISYVSTHTREFCAKTGRQLLATLATSHPCVISTLLRLIQQHLDTIGMLSDHKTKLFTVSMYLFRELPLFLWELTSEDLETIHHWVLNLPLVSTENQLGRLILSRLNYGLTK-QEDRLFLDIAFHRKIAILIVESYLKQ-VAAKGMSGVITEGVKQVASVVSQQKTSQQQ-FHDWAWDTILKLRLHKHQQP--------RPVMGANEDQGFDPCD------LFDPVMLVISKMTDNNGALACYVATV-MTKIGHSVSEFLSAGLPRLQCLVQQHHSTAVIQVLYVIVPLFYDSPQP----LIKSELFQTILHSLLSADQTYAKMAKSLLYSDFPGEIVKMLA---CMIQTQINGASAMLPYSPPMVIELWMNMLTQNTVWYQDRNVQYLINFLIK--SGHSCKGGKEVIETLMYNQYKLFIKSQGGHSMVSSLVSWIATGSAAIPTFLEGASLPEFPWLAYHLLHAEEQYQHDSYLWQVVQIELITKPK---LTVDQAVKKAIINLKIEGSLPASRLCIYRWGQQALDTAVDHPLLPLLWQRFFQLYLGRP-AHTPGLPERGGIGHKFFESSVNTSLLKRMKKRLNEATEHHHKVLQEQSLETADIDTGTRRTDEERSGRDGEAEEEEEENLLLHNVGYQKSREFHQSLVRYYQTLGFWLEEPRLHDPHLYLPGLPPQYDAERLLKLFQNQTEPWVEFLDSAQLDYELS-QMVSEWVTKMCPKANYRMRR--NSMIDAYNPLAATERILGRLQRYEQPLPPPPLVPLKAPLPDVSPSILGDKDTLIYTISADLAGLVEYSKLFMASVSQHLALDLSYQELLPNLYRNEPTMKEMYISCKSTFSLSHNCKGPAFVTVRFEEKKRNESVYQRVEENRSEWKQLLAQSSQ-PPPQNICSAAVHVENVIIALIKEAHS--ESPVPPQYSSVGSALFYHMASMIGDETKYYPPTRQFFSSCIEILGQEFISPNPKESLPLLETILKSPSLGGLLAPHFFPNACPDTFVRMYEQVIDASQRHGC--DVTFMLLTKFDVPQWLGNVRPVHSERSHLVETIGKALCQCGNEPAENT------LMVFEVYRSHLKKLTSYEFPDQYGDVLKLLLNASSTGKLCPKIWGDFLESIGCKYVRQEGFDLSYADNMMQSQALTTTAQFKESIDWLSTYFMKLRTTTPSLASFGLYSQWKPYVTHISVFLGYLCGSLVLKTVGSLQAGQANFNPQEGAESVWQATVQVFAPWLEPLH----RDNGEVLCPWIVGDTNTAFDMVAMFTESVACNFKQLEGFIPPFARNA--------LTLVW----EYYVKVLSAKKTPEHILQVFHARLTTLQWGKFLPDLQTLELMVKLQA---VGTRESFVFLGLVFTQMPWQDIVNFYLTQQPAEGTTGLMAILFQLLIQ-MSQEKGLMDVQGSDLPRLLLLAESFPWHFLDADNFKRVSDWFLQYCDPKCVLAERSSNSAVVLRLLKSAAGFVSAT--GSPFHPETPRKRALYVHCVVELVC--------KCSQMKGVDPEN-----FTTLILNLLTEVETVVSTIPDLSIQWEESVTLCVEVLQLLNNCNPQTTTVTAVLRSISQWIESSPCTVLLLPLVTAGCRCLASIVHMVQIIENCMDAFFNSGLELSESYGWGRLLSAMQIPELTFREFLVESLRQGSYLTLYAYVLQHLPKCQSLDEE--NSHIAGIVQWTATAKPTSENEAKLFLWWGKILDLLLRQIDFGASHAIVIRSLNNFIAALTTLGEDKISAGLLGAIGLGRASNLSVRFRLVARSLSAFLQAQIVKNNALRLVPHDHTPPNVQ---------------------QIVTSLRNLKTNKQYTPL-KEQIDFACQFVSSRGRCLRDAKFLLAELTGVLFPEKRYLAVV 2606          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. TrEMBL
Match: A0A1S3JD42 (ectopic P granules protein 5 homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106172173 PE=4 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 3.897e-140
Identity = 570/2471 (23.07%), Postives = 1033/2471 (41.80%), Query Frame = 1
Query:  544 PLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTN------VRDNGPI-------------------RTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAP--SLLQ--IGRDEVELA-------ITSLAMLLGSRKARDQFLEAWNPGLSKE-----EAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL--IDPNQS---------EVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQM----------GLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDS----YVADVNMLKV--------------IQNLVVRHQQYRL--CLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKV----QQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVV----KQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYH--LSQLDSIRQSN------------------------PTNILLIDQT--------QKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPD-LLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRH--DLDFRFVRLANSIFSKPTVPIAT-KILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGAQL---CTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLES-SPNLLSKLAMMDVLCTAI---GNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNELVLNIDEIRMELETIGA---------WLN----KSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALAFKLARSATENICSWH--EVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHL--------NIIASYVTNNDARSYLLHCVLIWIANGLLVVKELPA--MPYHDIYCLKFRLIT--W-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIA-SQMRWMEVAN------PIE--SDVAAQMFQLVVTFICKTKSVFKILA--IEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPHISTLAIEPVI----CWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCI---VQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFF--YLQLLLSAIQNSPRPG---SAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRI--HSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            P  + +++  Y N LL++ +     F+ + Q  D H   +L+  Y R+  +    E  L   + +    E  +W      A  +  C D   V   + + +  F+   AG +   L+ +  A+ D  AL  Y   ++R Q+E+++  +  N      +  N P+                   +  ++ILF F R+P       +    W+T L   L    T+ED  ++L  +L  PAG+ +W +    L+Q  + R +  L        I  LA L+   KAR  FL   N  L+       +  W LVDSDGE+D+   +SW  L+E+D++A L Q P+  +FR AL +    +  ++  D           +L + AF   +M IL  GL  +   RY+  NKRI R+++HTIQ ++DH      W          P   +  +  + + V+      IL  ++ G+ Q + D+P+  +S    W  L  L  +D  ++         +   D D  L   +  +  M   +  YLLTA +N+A  SRP  + E   + AIT+ +F+I YV   TR   +K GR+LL++++  HP  +S +L   +    T+G +           ++LFR+LP  L   +  + + +  W+L+ P     NQL R + S LN+G     E  ++L ++ H+++A L++ S+ +  + +K  +  + E +K V  +   Q+ +Q+Q FH W    I++LRLH   +P        +P    N  +   P           PV + I+  T+N+     YVA V M K+              +Q LV +H    +   L +I  + ++S       L+  E+F  +   ++ AD TY  M K+L+   FPG ++  +    C      NG          + ++ ++N +T    WY D++  +L++ L++  +    + G E   T++    K F + Q   +   S ++ I          +       F WL  ++L A+   +++  LW  +    + K K    T   A+     +L +  S+  +   I +  Q       D+  L  +   FFQ YLG        L   G +GHK F+  +    L++ +  +  A  +H  + Q  S+  ++                          N+LL +          Q L    + L  W++EP+LH   + +  LP QY  + LL L +        F    ++  E S Q  S W T+     ++R  R  NS+        AT +IL R +R                   +    L +   ++  +S  L+ + + +    A+ +    L+  Y   L   Y ++P ++   I C     L   C   A + + +    +   V   +  NR ++ +L+ +  Q      +    + ++++I++L  +  S   S           ALFY++   I  ET+ YPP R F S+ +  +G +F+  +  ++  LL+ +L++  L  +  PHF+PN+       MY  VI + +   C   +   +L+KF++ Q+L +  P    +  +++ +  A+   GN   E T      + + E+   +   L S +F      V+    +    GKL  + W   LE   C         L+  +  M+ + +           WL+    K R +       GL+ ++ P+  +I    G L  +L  K   S      +++  E  E  W   ++V+ PW++  +     + GE+  PW++ D   A ++V +  E +          I  +  N           L+W       VK L A   P H +     RL T  W + LP +  ++L+V+  +   +  +   +F+ +  +QM W ++ N      P E  + + A +FQL++  + + K +  +    + +L+ +     W  L    +++  D  +   +P+ +L   S+    +++ L  AAG VS+    S     T  K+ +YV+ VV+L+         K S+ K    ++     F   I  L +E+E+VV  I D     + +++L  EV QL  N +  T  +  V+     W++ S  + ++LP +    +  + I  +V + E  ++ F  S         W  + + ++I     +++  E ++Q S L +   V Q L   QS + E   + I   ++     +  +E    L +++   L LLL  I           +  NFI  L  + E K S+G  G +GLG+ SNLS  FR+  RSLS FL  Q+  NN  R+  H + P  V                      Q +  L++ +++K+ T   K  ID    F+ +   C+ D+   L  +   L+P+ +   ++
Sbjct:  256 PFSDEQLKSLYYNPLLEHQQVFVDDFLQQAQQ-DKHEFYELLMNYYRARVNYVNGEGELSGLQKEFKRQEEMVWVTSEHIATAQGTCLDKVSVSENHQYLQVTFDDKVAGDINKSLSSIRTALYDSLALHAYSAQLSRLQVESYIHQLYINCPFLQEIPRNAPVQAFLPEQRSPQADQQMSMLKKCISILFLFQRRPVKDEQFTQDARMWLTRLVASLLRIATLEDHWFILNHVLRCPAGVGKWASNYIQLVQPRLSRGQSSLGGPLLDNFIAMLATLMLPVKARTDFLSHMNVSLTPSADNGVDNPWVLVDSDGEEDEDPANSWQYLQENDVVALLHQFPLDAVFRHALLI----ETDEEGQDLYFIHKSSEQSMLRLFAFATSLMKILGQGLQTFKLGRYRQFNKRIGRLVRHTIQFVSDH------WMNFKSAFSHLPEQSKQRLQLELDHVFMRATDCILSAQKLGSWQFMADMPYGSVSMEMMWKLLWLLHFVDAGETVQFSVEICKQKMKDPDSKLA-FEEKLLAMPLSEATYLLTAFTNMA-RSRPPEDIE--FVNAITEEMFEISYVSTHTREFCAKTGRQLLATLATSHPCVISTLLRLIQQHLDTIGMLSDHKTKLFTVSMYLFRELPLFLWELTSEDLETIHHWVLNLPLVSTENQLGRLILSRLNYGLTK-QEDRLFLDIAFHRKIAILIVESYLKQ-VAAKGMSGVITEGVKQVASVVSQQKTSQQQ-FHDWAWDTILKLRLHKHQQP--------RPVMGANEDQGFDPCD------LFDPVMLVISKMTDNNGALACYVATV-MTKIGHSVSEFLSAGLPRLQCLVQQHHSTAVIQVLYVIVPLFYDSPQP----LIKSELFQTILHSLLSADQTYAKMAKSLLYSDFPGEIVKMLA---CMIQTQINGASAMLPYSPPMVIELWMNMLTQNTVWYQDRNVQYLINFLIK--SGHSCKGGKEVIETLMYNQYKLFIKSQGGHSMVSSLVSWIATGSAAIPTFLEGASLPEFPWLAYHLLHAEEQYQHDSYLWQVVQIELITKPK---LTVDQAVKKAIINLKIEGSLPASRLCIYRWGQQALDTAVDHPLLPLLWQRFFQLYLGRP-AHTPGLPERGGIGHKFFESSVNTSLLKRMKKRLNEATEHHHKVLQEQSLETADIDTGTRRTADEERSGRDGEAEEEEEENLLLHNVGYQKSREFHQSLVRYYQTLGFWLEEPRLHDPHLYLPGLPPQYDAERLLKLFQNQTEPWVEFLDSAQLDYELS-QMVSEWVTKMCPKANYRMRR--NSMIDAYNPLAATERILGRLQRYEQPLPPPPLVPLKAPLPDVSPSILGDKDTLIYTISADLAGLVEYSKLFMASVSQHLALDLSYQELLPNLYRNEPTMKEMYISCKSTFSLSHNCKGPAFVTVRFEEKKRNESVYQRVEENRSEWKQLLAQSSQ-PPPQNICSAAVHVENVIIALIKEAHS--ESPVPPQYSSVGSALFYHMASMIGDETKYYPPTRQFFSSCIEILGQEFISPNPKESLPLLETILKSPSLGGLLAPHFFPNACPDTFVRMYEQVIDASQRHGC--DVTFMLLTKFDVPQWLGNVRPVHSERSHLVETIGKALCQCGNEPAENT------LMVFEVYRSHLKKLTSYEFPDQYGDVLKLLLNASSTGKLCPKIWGDFLESIGCKYVRQEGFDLSYADNMMQSQALTTTAQFKESIDWLSTYFMKLRTTTPSLASFGLYSQWKPYVTHISVFLGYLCGSLVLKTVGSLQAGQANFNPQEGAESVWQATVQVFAPWLEPLH----RDNGEVLCPWIVGDTNTAFDMVAMFTESVACNFKQLEGFIPPFARNA--------LTLVW----EYYVKVLSAKKTPEHILQVFHARLTTLQWGKFLPDLQTLELMVKLQA---VGTRESFVFLGLVFTQMPWQDIVNFYLTQQPAEGTTGLMAILFQLLIQ-MSQEKGLMDVQGSDLPRLLLLAESFPWHFLDADNFKRVSDWFLQYCDPKCVLAERSSNSAVVLRLLKSAAGFVSAT--GSPFHPETPRKRALYVHCVVELVC--------KCSQMKGVDPEN-----FTTLILNLLTEVETVVSTIPDLSIQWEESVTLCVEVLQLLNNCNPQTTTVTAVLRSISQWIESSPCTVLLLPLVTAGCRCLASIVHMVQIIENCMDAFFNSGLELSESYGWGRLLSAMQIPELTFREFLVESLRQGSYLTLYAYVLQHLPKCQSLDEE--NSHIAGIVQWTATAKPTSENEAKLFLWWGKILDLLLRQIDFGASHAIVIRSLNNFIAALTTLGEDKISAGLLGAIGLGRASNLSVRFRLVARSLSAFLQAQIVKNNALRLVPHDHTPPNVQ---------------------QIVTSLRNLKTNKQYTPL-KEQIDFACQFVSSRGRCLRDAKFLLAELTGVLFPEKRYLAVV 2607          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. TrEMBL
Match: A0A0L8I6R2 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22031064mg PE=4 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 3.088e-134
Identity = 574/2456 (23.37%), Postives = 1058/2456 (43.08%), Query Frame = 1
Query:  532 RLPEPLGEGEMR-VHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNA--IVRRTYSFDE---AIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAG------IVTNVRDNGPIRT-----------------ALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSL---LQIGRDEVELA-------ITSLAMLLGSRKARDQFLEAWNPGLSKE----EAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL-IDPNQSEVPTDNDWF----------LTNLQLA--IDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSS----ITNTSEWLQP--ISDAQQE-RCSHPVAMYIAVTTNNDSY-VAD-----VNMLKVIQNLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRS-GLAQIF----RLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLW----SELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILL------------------IDQTQK----------LSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVRQANITAESFNFPRRILLEQSRQAASGWN----TRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDK----PVVQNFQIPCNKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMY--LDVIQSYESGKCKQKIVLSILSKFNIKQFLES----SPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDL--------VLECFR-------------CNITEHNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASY-------VTNNDARSYLLHCVLIWI-ANGLLVVKELPAMPYHDIYCLKFRLITWELLP----TMDCMKLIVEFISRTWISEQCKT--LFIDIASQMRWMEVANP--------IESDVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFV---DLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTI-YVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPH----ISTLAIEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSA-NPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFY--LQLLLSAIQN----SPRPGSAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLW 7365
            R  +PL   ++R ++Y N L  N E +   F+ E  N   H   +++  Y R+ + L   E+ +R  +++       LW+    + V +  C DN+  +VR  Y   E   ++F      K+G  L  + +++ DE +L  Y   ++R Q+E+++        I+  +R +GPIR                   ++ILF   R+P   H+ V  +  W   L   L    + ED L+LL  +L  PAG+  W A  +   L    DE           +T LA +L   K R+QFL+  N  L +     +  W +VDSDGE+++   ++W  LRE+D++  LGQ+ +  +F+  L + +  D S   D            ++   AF   ++ IL  GL  +  +RY+ LNKRI R+I   +   +DH      W +  Q ++  P      +  +++ ++   +  IL   R G+ Q + D+P+  +S    W  +  L +  NQS +P +              L   QLA  + +M   + IYLLTA SN+ ++ R    SE   +  IT  +F+I Y+   T+   SKVGRELLS+I+  HP  +S ++   +     +G M L+LF++LP       +A+  +L SWL+    +   + L R + SNLNWG  N + T + LPL +HQ +A +L+ ++  +      G+ F+ E +K V  +   Q+ N EQ F +W   L+ +L LH  T P+   P   +PS+    + N  E  +   ++  QQ  +  +P+AMY+A+T     + VA+     + +L  + +L       +  + +I   +     NQ   L+  + F+     ++ AD+T   + KNLI+  FPG  +  + NS   + + A          +  + + +     W  D++  ++LD L+   +A       ++  T++ +  + Q   A  RS G+ + F      G    + + +    +  WL   IL  +   E    LW     ELL    +  ++ ++   SA+    K +     +NI  +     AQ       D+  L  I   FF  YLG + +    L    S G++ F+       L++ +  ++    +H++ L S + S   N                      ++T K          L    E    W+DEP+LH   + +  LP QY  + L  +   + +         +L  +S   A  W       +   ++     +S F   T    T+IL R K  +                 +   AL   + ++  ++  L  +   A       +    ++ +YL  L + Y ++    PV    +   N   + C+     ++         D+  +++        LV E L      +V    + ++++I +L    ++    DKI+ +     A+FYYL   +  ET  YPP R F ++ ++ +G +F+ +  DQ+ VLL  +L++  L  +  PHF PN +      MY  L V++S     C+  +   +LSKF++  +LE      P ++    ++DVL TA  +   E   +   ++ L E+   +   +L+S F   L ++++    +   G+L V+ W +        V EC                NI+  +   L+  ++   LE + ++  + R  +      GL+ K+  +  YI  I    L  LA +   + +E   S  +V++  W++ + V+ PW++     +   Q +L +PW   D E A  +V    + +  I ++       V  +  +  L     +WI    +L  +++P      +YC+    +   LLP    T+D    + E +S    +   ++  L   IA  + W              I S  AA +F L +      K  F +   E+++ +F+    L W+ L ++ + Q ++  + + +PR IL   S+++   ++ +  A+     + D+S   +  I+K+ + YV  V++LL              + S  DD   + F   I  + +E+E+V M ++DR    + ++ ++  V  L  N +    IS L    +  WL+ S  S +++P +    +S + ++++V + E+ I+ F  SD S    ++W  I   ++I      ++ +EC++Q + L +   ++  + SA +  + Q  I   LE     ++ ++    ++++++     ++S ++N    +         FI  L  ++E K ++G  G +GLG++S LS +FR+ CR+L VFL   L  +   R+         HP+M+I   +     P  + L  L  LK+ R    L  T     D    F+ NP +   DS   L  + R  +
Sbjct:  418 RCIQPLTRIQLRSLYYNNELAVNEELIN-NFVQEESNNSNHEFDEILTNYYRACKKLINAENTVRLQQENHKKYRKGLWQTVQEHVVVQGYCKDNSRCVVRHLYEKSEMEHSLFE-----KIGKTLQSVRNSIEDELSLQAYSAQLSRLQVESYIHNLFKSLPILQKIRADGPIRVQAKQSMTVLHQIQRLKDCISILFSMHRRPIDDHNFVENLRIWTERLVSVLLRVASFEDHLFLLNHILRCPAGVGSWAAQYIQIPLLANTDETTFVSPSLDHMVTVLATILQPIKGREQFLQHLNTNLKERTESNDGAWIMVDSDGEENEDPKNAWQYLRENDVVNMLGQVALNELFQHVLMMTLNQDSSWHYD----VNVTSESIMMKTFAFFTCLIDILSCGLKTFSLSRYRQLNKRIGRMITQIMLYTSDH------WLSFRQCNQRLPPAMLERLQVEFDQLFLRAVHCILNAERMGSWQYMTDMPYASVSLETTWKLMWMLHMGQNQSVLPDNLPSVEQCKAELKDPLRKAQLADSLQKMPISEAIYLLTAFSNM-VQCRH--ESETEFIQTITVEVFEIAYLYDHTKDFCSKVGRELLSAIAQVHPVTISFLIHKLRDVRGNIGGMALYLFKELPMYDWQLENADLAILRSWLVSTDLSSTEHLLGRTILSNLNWGL-NKENTDLALPLWIHQYVACVLVEAYHNYITSKHLGSVFM-EGVKQVALVVRQQQTN-EQQFSSWAWELVFKLHLHNDTLPR---PSSFEPSTNLVDMDNIPELRKDTFLASVQQGLKVDNPIAMYVAMTMTKYGHDVAEFITHGIPLLSKLNSLYYT----KAVIHIIGHCV-PMFYNQGQYLIENQEFLKTLHNVLLADETPMRVAKNLISSDFPG-AMTKLFNSMILTQIQATNCPADAVTVITLWAHLMLKIPKWSLDRNCCYVLDNLVR--SAFRYVEALKKIETLLSE--QYQCMLAEYRSQGVVESFVNWIAAGQNLPSFMEKQSLPDAPWLAYLILSIEGKYEECTLLWPTIQQELLSNTKISVEQAWKK--SAVKLKLKTISAFHRLNIYRW-----AQQAVDTPNDHPILPLIWQRFFVLYLGRS-ITPGSLPERASNGNRFFESLSYRNLLKKMKKKLVDVVQHHIAVLQSAKGSEGENTESPPMSESSSCLSLESLKGECEETLKKSLNTQLHTTLQNLFESFQFWLDEPRLHEATLYLPALPTQYDSERLQKIFFCDKSPWMELIDMNMLTYESLTLALVWTEEITVSYHHQYKQKSKTDSNFRVSTA--TTRILNRLKTHSIPLGPPPITDPSPPVPEVTVTALEEKSTLMYIINTDLKVLCNHARNFSRQVSRHITMDLEYLDLLPQLYSNEWNQVPVTLECRSTINFTHK-CSGSITTSVRVCEKTLNADIQQKLNDIEGQQQVLVQEGL-LPPPQKVCVAAVHVENIITTLIKLTRARTEVDKIEHLQSIGCAIFYYLANMVTNETNFYPPTRQFFASCLDILGQEFVQKMPDQSPVLLNFVLDHPDLAGLMSPHFLPNLNPGCFLAMYEKLIVLRS-----CQIDMAFMLLSKFDVCIWLEKLNLPHPEVVK---LIDVLSTAFISCGAEPMSR---ELILFELFCTHLHKVLNSCFHYYLSQILSMLLKVSSKGRLHVKCWQIFSETAFPYVTECATPGSFDEDYQLQQLSNISAPSASQLSSHQLAQILEMMSSFFMEQRLLNKESCTFGLYSKWHKYVPYIASISAGFLKILAAQYHENLSEE--SPAQVIDYLWNMIVNVFSPWVRPL---KGPAQTQLLIPWTAGDHEAATIMVQNFCDAIRYIHTFYKSLLSPVAYSQTQDILGR---LWIFYTSILASRKIP------VYCVTLLNVELALLPWDQLTIDLQ--VAETMSTIRDNGNIESFQLVKVIAPHVNWANAMQDFISNYPVNIVSKFAAHLFHLFLQLAGDDKESF-LSFTEEVILMFMMAEKLCWNYLDSNSFSQSVNWYLQHCDPRAILAQRSSLQALELRLIKSAS---KFDCDSSAHWNSEISKKRVGYVYCVIQLL-------------CQCSYQDDINEETFSNSILNILTEIETVEMAVADRYVQNEESVEMMKTVYSLLNNCNPEGTISELITSTIYSWLESSIHSILLMPAIAAACRSLASLTNVVQILEKCIDVFFTSDGS-SEKSNWDIILLNIQIPELNLAEFLEECLQQGAFLTLHAYLIQQLSSATDCSEEQAVIWKVLEWSTKGKSSSDNEGKMLLWWHKCFCQMISQLENNTCSTTDIAQILSAFIHMLTPLAEDKDTTGILGAIGLGRRSTLSIKFRLTCRALYVFLQTTLHPDLTLRV---------HPEMSIVLHS-----PGKQALNALRNLKTNRQYCSLITTVNYCSD----FVVNPANVFHDSVKLLEYLARSFY 2763          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Cavefish
Match: epg5 (ectopic P-granules autophagy protein 5 homolog [Source:NCBI gene;Acc:103033456])

HSP 1 Score: 353.599 bits (906), Expect = 2.425e-97
Identity = 551/2450 (22.49%), Postives = 1002/2450 (40.90%), Query Frame = 1
Query:  559 EMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIV-TNVRDNG-----------------PIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQIGRDE----VELAITSLAMLLGSRKARDQFLEAWNPGLSKEE--------AGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKW------------------------SFLTFLIDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLW----WNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSS-------ITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVAD------VNMLKVIQNLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADD----TYYNMVKNLIAKQFPGPVLNC----IGNSFCPSLVIANG--NKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFM----WLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILLIDQ--------TQKLSE--------RL-EMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVRQAN--ITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIAT--KILQRFKRQTS--CSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPC-NKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIK---VIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESS-PNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLL----SSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEH------NELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALA-FKLARSATENICSWHEVVEKSWDLY---LKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNNDARSYLL--HCVLIWIANGLLVVKELPAMPYHDIYCLKFRLITWELLPTMDC---MKLIVEFISRTWISEQCKTLFI-DIASQMRWMEV--------ANPIESDVAAQMFQLVVTFICKTKSVFKI--LAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQ------KMAM-SLLTEVSQLFKNPHISTLA--IEPVICWLQE-SKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGP----TSWATINACVRINIEFQQQYWKECIKQNSILC----IVQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPG--------SAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSR---AIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            ++R+    + L+N+E L A     + + + H L +L+  Y R  + L++ ++ L+ A  DC +A+  LW         +  C D   V   + F + + N     +L        + +    AL  Y   ++R Q+E++L  ++ TN    G                 P++ ++++LF F R+          IH W+  L   L    +  D LY+L  LL  PAG+ +W  P  LQI   E    V   + +LA+L+   + R  FL    P   K          A W LVD  GE+D+    SW LL E DLIA L Q P   +F+  L +    ++  Q             K++ + AF   ++ +L  GL  Y++ RY+   KRI  +I+ T+  ++DH    +  + + +           ++  +++ ++   +  +LK +R G    + ++P+  LS    W                        S +  L +P+  E     DW        + +++  D I LLT  +++A   R   +++   +  I   ++++ YV   TR  FSKVGRELL++I+  HP  +S++LE  +     VG + L+LF++LP  L  PS  E  ++ SWLLD   + V N+LA  +   LNWGF       + LP +LH  +A L++ +++++  D       ++E IK V+YL       Q P  E SF+ W   L +RL+LH S      DP    PSS       +T+T   + P+  A   +   P+  ++A+      +  +      +++LK +    V+ +  +  + ++  I+  +   Q  LL   E F+N  +L +  D          V + +A+   GP  +C    + NS   S ++ +    +V     ++F+LN +T Q  W+ D++ L+LLD L     A  L    E  + ++ Q   K         GL   F        +      GN +    W    +L  +   E +  L   +    L        T   A+      L L +  ++   ++ + AQ   +   D+  L  I   F Q YL         L   G +G + F        L+     ++   ++H +   +++  +P++    D         TQ ++         RL     +W+D+  L  +++ + +LP QY    L  + Q    +  E  +  R  +  +  +  S W             +NSIF     P A   +IL   K+  +   + L +P  AP     IP+  L++       +   L+ +   A      +     L+ + L  L + Y ++    + Q+ C  KG Q C   A I++ Y    K   V ++I   + D  +L  + ++  +   + +G +  ++ I +L        N+ K+     I    ++ FY++   +  +TQ++PP R F ++ +  +G  F+  +  +   +LK +L N  L  +  P+F PN+  S+   +Y +V+ +  +      ++  +L+KF++ Q+L ++ P    +  +++++  A+     E   ++ +  NL   +    +        SDF   L +  +      D  +  +R    VL C   +  +         + L+  ++   +E +  +  K R S    +  GL  K+ P+   +      L+  L   +L   + E + S   +V+   DL+    K++ PWI    T  +        PWL  D  +A +LVG+  +    +     ++  R  LL      +W+   L+   E    P    Y L      +  LP  D      L+ +F +    S +   LF+ ++  ++ W+           +P    +   +  L+V F+ K   +      ++  L+     L W  +  S Y Q +   V+   P  ++ N  T    +IK L  AAG   S+ D     DMT+  Q  +++++V+ L+   S  Q  N                 + +  L  EME ++  I +  P +       MA  SL  E+  L     +ST       +  W+++ ++  P++LP L           + V       E  ILS  +DGG     + W  I   +++      ++ +E +   S L     ++Q++ +     N ++    +   + Q+ P    +E    L     L LL   +      G         AF+N    L+++ E + SSG  G +GLGKKS+LS  FR+  RS+S FL VQ+PS +  R+H   PG  T   ++  ++   A+ E++P NK    L                +  +     FI  P HC+ DS   L  +   L+ D    ++I
Sbjct:  228 QLRMWEPGSWLENVE-LHASEFQALAHQEGHELHELLLNYWRCRKQLSQAQAELQAANSDCKSAQNRLWSFRDEQLTLQGVCADQVKVCGYHRFQQVVLNEAVVAELRHLFAAKAELLHQTVALHSYTSVLSRLQVESYLYRLLSTNHITRGVAIQESETPKSQPASLQPLKESISVLFSFTRRVLDDSQFQNDIHLWLQKLVSVLHRVGSAGDHLYILNHLLCCPAGVGKWAVP-FLQIKVLENPSGVYHFMQALAVLMSPVRDRADFLCHMKPSDVKSNNSYSGPTTANWTLVDEGGEEDEDPETSWLLLSEDDLIALLSQFPFDELFKHLLGMSSKGNYQPQATTSQ--------KMMKIFAFASSLVELLAVGLRTYNRARYRQFVKRIGHMIRMTLCYVSDHWAQYICLTGVSRTTMQEQSFSMEKLQVEFDHLFLRAVLHVLKAKRLGIWLFMSEMPYGTLSSAMLWKIFYIMQCAETEGLDRLGCSLSVESCIEGLREPSHQE--KFKDW--------LSEINSSDGICLLTTFAHMAQPKR--TDADPEFVRTIVLEIYEVSYVCVSTREIFSKVGRELLAAIATAHPHIISVLLERLRETIEKVGMVSLYLFKELPLHLWSPSTEEVGVIRSWLLDYNLSTVENKLACIILEGLNWGFQ--PSGCLALPAALHSEVALLVVEAYQKYLTDKPYAG-IISEGIKQVSYLANIMRLGQTP--EMSFNQWAWDLALRLKLH-SNEKNPQDPWCPLPSSSGPAVPEVTDTPT-MHPVLKAV--KAGIPIGCFLALDMTTIGHSLEKFCSEGIHLLKTL----VQSRHLKAVVHVLDNILPLAYHCQFYLLKN-EQFLNCIQLFLQLDSGAPQGVTQQVTHKVAQHLMGPS-SCENIKLLNSVIQSHILESSRVGRVGAVAVLEFWLNVLTEQSLWHRDRTVLYLLDHLCR---AAFLHQQEECLHKLLYQ-QHKNALGYHGDKGLLSSFMGWIVAGNITPSFIEGNALTSEVWFAWLVLNMESIFEEDSQLRRCVEHELLSNPA---LTPDQALKKAQVRLKLHVVPSLQRLMVYRWAQQALATPADHPLLPLIWQKFLQLYLRQPGP-EFGLEAKGCIGKRYFHSAAHVTLLKDLGQRLVEVCDFHHAAGKALKVQSPSSETASDGETTPATPITQYMTSPELHVEVVRLFSAFAMWMDDENLQKQEVFLPSLPKQYDAHRLAKIMQGQQELWMEYVDIER--VQHELNEVLSLWGKVKSEPSFSQSSSNSIFIDFINPQAARERILTNLKKHDAPQGALLLVPMKAPVP--DIPTGCLSDEQTSAALIQEDLTKLQHQAKLAAVRETQQVALDNELLEVLPQLYTNREEQLSMQLECKGKGGQPCQGPAHISVKYAGMQKLEPVQNQIHSLKNDIKQLQGDAVKPPS-QSLAEGAVHTENFITTL-------VNAYKLHPSPAIQKVGISAFYHIVSFVCEDTQRHPPTRQFFTSCVEILGQVFIRDTQTECKRMLKTILLNRRLCNLLSPYFTPNASPSELVVLYEEVVTALHAD--SGDVIFMLLTKFDLAQWLSAAQPQFPERSRLVELIHLALTACGLEPEPEVLMPFNLFCKHWTQLLVYQFPDHYSDFLRLLTQSSSEQLLSSDCWRASLR----VLGCSSASKKKVSRSSSTQSIFLSPQQVEETIEWLSKYFLKLRLSKGDFRSFGLLSKWRPYIEEVKTFFEYLISFLIDLELNNCSKEPVGS-AGLVKALQDLHSKMAKLFRPWILVLDT--DDASNPRCSPWLESDTALAVSLVGLYTQLAETL-----HDKFRDRLLPGQRGALWL--HLMHYCETCTSPKMPEYLLYTYHTEYSRLPWKDLHPDQALMSQFFNVERGSPKSCFLFMGEVLCEVNWVSALSDALSPQPSPGSQTMVVYLLYLMV-FLAKEDHLLNKPESSLLNLLGQATSLPWHLVDFSSY-QNVTSYVNTHYPASLVLNRDTSSQLVIKLLKMAAG-FGSSLDGFHHKDMTLKCQA-FLHLMVQFLT---SLDQNGN-----------------ISLASLEMEMERLLECIVNFSPPETDLQQRHMATCSLFAEMLTLLNGASVSTAEGLGSKLHSWVEKMARGPPLVLPLLTA----ACTCLASVRHMTRTTEACILSYFTDGGCVDQYSGWGPILVSLQVPQLTVDEFIQESLALGSYLTLYVYVLQKLNMEQTLLNEKRTLVLLNSWINQVFPSSPADEAKLFLWWHKALHLLQVQVDQGDPCGLEALVLSLMAFQN---SLVQLGEERVSSGILGAIGLGKKSSLSNRFRVVARSMSAFLLVQVPSESQLRLH---PG--TELQLSPKAQQALAVLESMPGNKQYSEL----------------QQTLSQACQFIRYPGHCLRDSNRLLSLLINSLYADLHYLDII 2552          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002445.1 (pep scaffold:Pmarinus_7.0:GL477076:63120:105533:-1 gene:ENSPMAG00000002209.1 transcript:ENSPMAT00000002445.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 2.637e-41
Identity = 178/754 (23.61%), Postives = 328/754 (43.50%), Query Frame = 1
Query:  682 RSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIV---------TNVRDNGPIR----------------TALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQI----GRDEVELAITSLAMLLGSRKARDQF------LEAWNPGLSKEEAG-----WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTD--------HLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWS-FLTFLIDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQ--EQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVA 2790
            R  R L   +++L+    +    +  LW      A  +  C D   V   + F     N     +L   L    + +    AL  Y   ++R Q+E++L  ++         T+  D+ P R                 ++++LF F R+          +  W+  L   L    ++ + ++LL  +L  PAG+ +W AP  LQI    G   V   +  LA+L+   + R +F      LE     +S + AG     W  VD    +++    SW LL E+DL+A   Q P   +F+  L   M +D +  +           G+++ ++A    ++ +L +GL+ +++ RY+   KRI + ++ T+  ++D        H + V S +AL Q+     G  +++  A+++ ++      +++ +R G  Q + ++P+  LS    W  + +  +   +   P  +   L+  +     +  D   Y+   I  +  ++   +   +   + +  L  Q+ YV   TR   SKVGRELL  I+  HP  +S++L   K     VG   L+LF++LP     P+  +  LL +WL++N    V N+L   +   +NWG  N   T + +  S+H  +A L+M +++R   +   G   ++ESIK V+YL      +Q  E  F+AW   L++RL+LH          +++ P     T+   + + D   +   HP+   +A       Y+A
Sbjct:   92 RCRRELLSAQAQLQAMLSEYKALKRRLWIFTEGQATAQGICADKVKVTGKHHFQTVELNAGAFTELQRLLKARSELLYQTLALHTYTSVLSRLQVESYLHHLLRQTPAFRAFTHSVDSPPERRTPKSKCTVSELLQLTRSVSVLFGFKRRSITDAQFNSDVQGWLQQLVAVLLRVGSINEDIFLLNHVLRCPAGVADWAAP-FLQIRMGEGPGIVSRFMKPLAVLMSPVRNRSEFLCQLKALEKLPFPVSAQAAGEKQQLWTFVDEA-GEEEENEDSWLLLLENDLVALFCQFPFQELFQKLLG--MQDDGTYTVAQST------SGEMMKLLAVAGAVIEVLASGLETFNRVRYRQFVKRIGQTMRLTVSHVSDCWSRFSQQHRDSVASAAALRQY-----GLGKLQ--AEFDQLFLRTAAFVMRTKRLGIWQFMSEMPYGRLSMPMLWRLYCSMHLSEREGLEPYMH---LSVTECKAKLLVPDVLSYVFLLILAVTTQADDCV---VFSASFLRGLCRQVAYVSAQTRELCSKVGRELLVVIAGAHPHVVSLLLAQAKDSLDQVGLAALYLFKELPLTWWRPTSEDMILLGNWLVENGLLTVQNKLTCLILEGMNWGL-NAQGTGLAVDSSIHLEVALLVMEAYQRFLANKPYGG-IISESIKQVSYLASVVRASQSPESIFNAWAWELVLRLKLH--------HMDWILPGGAGVTTPSPRALPDLAVDTELHPLRKAVAAGIPLGCYLA 812          

HSP 2 Score: 128.257 bits (321), Expect = 2.097e-29
Identity = 257/1323 (19.43%), Postives = 484/1323 (36.58%), Query Frame = 1
Query: 3667 GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILLI------------DQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKP---TVP-------IATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKG-----AQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVII---DCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLE-SSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNE-----LVLNI----------DEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICG----QLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNN-----DARSYLLHCVLIWIANGLLVVKELPAMPYH--DIYCLKFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEVA----NPIES-DVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFV----DLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPHISTLA--IEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSANPE------QWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRP------GSAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            GSVG + FQ       L + +  +    +YH     ++      N+               +  ++L +   +   W+D+ KL   D+ + ++P  Y P    +VR        FN  + + LE       G +     +     L ++    P   T P       ++    QR KR   C    LP +    P  + S  L +     + V+  L  + Q A +    +     L++  L  L   Y +    +  Q+ C  G        CT  A I + +        +  ++   R +  +L+ E  Q  +  RV +  +  + L+ +L        N  K++  +   +  +ALFY +   ++ ET +YPP R F+S+ +  +G  F+     ++  LL+ +L+N  L  +  PHF PN+       MY  V  +  +      +V  +L+KF++ Q+L  + P L  +  ++  +  A+     + + ++     L      ++  LL+  F       +       D  KL    W  VL    C     NE     + LN+           ++R  +E +   L   R      +  GL+  + P+   I  + G     LL A   +L R+            +  + L   ++ PWI    T + +       PWL  D  +A  +V +  + +  +      N        S  LH    W           P +P H   +Y  +F  + W    P +  M+    F         C         Q+ W+EV      P  S +  A +  L+ T     K    + A +  + + +       W  +  + Y      +  + +  ++L  P     +++  L  AAG       +       + K   YV ++V LLS   +     +  A A+             +TGL  ++++      D +    +   L+ E+  L     +   A  +  +  WL     SP++LP L    +S + +  +  L E  I       ++  G  +WA + + + +     + +  EC+   + L +   +L  +Q  N        Q   ++V  + +  P +T++++  +L+ +     LL       +           ++ +  L +++E +  SG  G + LG KS LS  FR+  RS++VFL  QL   +  R+               PS  +     T + L  L+ L   +   E     + V      F    +HC+ D+   L T+   L+P  +  ++I
Sbjct: 1126 GSVGSRFFQAPAQRALLDRLKKRLAELADYHHGASKAVPAPRTFNVGTTGPPAPPAAATAPELHKELVKLFHLFRCWLDDEKLQGADLYLPSVPLHYDPH--RMVR-------IFNNDQDLWLEFVDMTLIGRDLAGCCNDWLKELQSNRVLTPGSNTAPGAELGKSVSRGSPQRPKR--PCEPPPLPWLKTPVPAVVAS-CLCDDRVAEQLVAKDLQVLQQQACQATVRECRQVALDQDLLELLPGLYYNGEDQEVLQLECRPGYTSSSTHSCTGAATITIKFERAYMNERIKQQLHDTRVEAKQLLAETSQLPH-RRVPEAAVHTEELLTAL-------INEYKVQPKVGMRETGVALFYLMVSFVSEETTRYPPSRQFLSSCLEVLGQMFISGVETESERLLQTVLKNSCLCSLLSPHFTPNAAPRAFVGMYSLVAATLSAD--TSDMVFMLLTKFDVLQWLSVARPPLPWRSELLAGVYAALRTCGAQPSAEMVASSGLLR---SHWRKLLAHHFPDHYGETLRMLVDGSDEQKLSPEVWSDVLLTLGCTEAGPNERVPTTMALNVRPCARPVARTPQVRETMEWLARQLLALRLLRQGRRSFGLYSAWRPYVPAIASLYGFLGRHLLRAERARLVRNGKAGTTDAEAAAQSIYALLTDLFKPWILHLETGDKS--CPRSAPWLDVDSALACTMVRLFCDCVRALHELFGGNLLPFGGKGSLWLH----W--QHYCSTMAQPGIPKHVLAVYHSEFAALPWARFQPDIQAMQAF--FKVECGGQASCFRFLGSALCQVNWLEVLAGAWGPFPSGETCAMLTYLLYTLAALAKESSFLDAPDGPLPILMAQAAAFPWQLVDPAAYESVAKYVGDHFQASLVLGAPGDAASRLLPVLKAAAGLAPGTCPHPD----ALPKCRAYVKLLVGLLSKEIA-----HPNAAAA-------------LTGLLEDVQNFAPPGLDVQTLYTIHTQLVVELLVLLNQGSLEKAAPLVNGLTAWLDGHPHSPLVLPVLTAACRSLASVRHMAELVETSIAAHFAGIQAAQGSEAWAPVLSALHMPELTLKAFVDECMSLGAFLTLHAHLL-QLQHRNETTLVYEMQLLLQVVGWIARAVP-KTMSQEPKLLLWWHKALELLLLQLLHNKKLPLGEMARVLRSLVSSLTQLAEERVMSGLLGVLRLGHKSPLSPRFRLAARSMAVFLQAQLLDEHTLRLQ--------------PSSLLQLTPRTAQALSSLEALGLNKQYVEFQGEIQGVCQ----FTREHQHCLHDANRLLATLAIALFPSVRYLDII 2371          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002440.1 (pep scaffold:Pmarinus_7.0:GL477076:63120:105533:-1 gene:ENSPMAG00000002209.1 transcript:ENSPMAT00000002440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 2.029e-40
Identity = 177/759 (23.32%), Postives = 327/759 (43.08%), Query Frame = 1
Query:  682 RSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFL----------AGIVTNVRDNGP-----------IRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQIGRDE----VELAITSLAMLLGSRKARDQF------LEAWNPGLSKEEAG-----WALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTD--------HLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFL-------IDPNQSEVPTDNDWFLT---NLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQ--EQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVA 2790
            R  R L   +++L+    +    +  LW      A  +  C D   V   + F     N     +L   L    + +    AL  Y   ++R Q+E++L               +V    P           +  ++++LF F R+          +  W+  L   L    ++ + ++LL  +L  PAG+ +W AP  LQI   E    V   +  LA+L+   + R +F      LE     +S + AG     W  VD    +++    SW LL E+DL+A   Q P   +F+  L   M +D +  +           G+++ ++A    ++ +L +GL+ +++ RY+   KRI + ++ T+  ++D        H + V S +AL Q+     G  +++  A+++ ++      +++ +R G  Q + ++P+  LS    W     +       ++P      T+    L     L   +  +  +++      ++ LA+ ++   +  +   + +  L  Q+ YV   TR   SKVGRELL  I+  HP  +S++L   K     VG   L+LF++LP     P+  +  LL +WL++N    V N+L   +   +NWG  N   T + +  S+H  +A L+M +++R   +   G   ++ESIK V+YL      +Q  E  F+AW   L++RL+LH          +++ P     T+   + + D   +   HP+   +A       Y+A
Sbjct:   92 RCRRELLSAQAQLQAMLSEYKALKRRLWIFTEGQATAQGICADKVKVTGKHHFQTVELNAGAFTELQRLLKARSELLYQTLALHTYTSVLSRLQVESYLHHLLRQTPAFRAFTHSVERRTPKSKCTVSELLQLTRSVSVLFGFKRRSITDAQFNSDVQGWLQQLVAVLLRVGSINEDIFLLNHVLRCPAGVADWAAP-FLQIRMGEGPGIVSRFMKPLAVLMSPVRNRSEFLCQLKALEKLPFPVSAQAAGEKQQLWTFVDEA-GEEEENEDSWLLLLENDLVALFCQFPFQELFQKLLG--MQDDGTYTVAQST------SGEMMKLLAVAGAVIEVLASGLETFNRVRYRQFVKRIGQTMRLTVSHVSDCWSRFSQQHRDSVASAAALRQY-----GLGKLQ--AEFDQLFLRTAAFVMRTKRLGIWQFMSEMPYGRLSMPMLWRLYCSMHLSEREGLEPYMHLSVTECKAKLLVPDVLSTLVINLQDNNSCLCFCWVTFLAVTTQ-ADDCVVFSASFLRGLCRQVAYVSAQTRELCSKVGRELLVVIAGAHPHVVSLLLAQAKDSLDQVGLAALYLFKELPLTWWRPTSEDMILLGNWLVENGLLTVQNKLTCLILEGMNWGL-NAQGTGLAVDSSIHLEVALLVMEAYQRFLANKPYGG-IISESIKQVSYLASVVRASQSPESIFNAWAWELVLRLKLH--------HMDWILPGGAGVTTPSPRALPDLAVDTELHPLRKAVAAGIPLGCYLA 822          

HSP 2 Score: 124.405 bits (311), Expect = 2.922e-28
Identity = 255/1326 (19.23%), Postives = 486/1326 (36.65%), Query Frame = 1
Query: 3667 GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSI---RQSNP----------TNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVRQANITAESF-NFPRRILLEQSRQAA-SGWNTRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKG-----AQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVII---DCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLE-SSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNEL-------------------------VLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICG----QLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNN-----DARSYLLHCVLIWIANGLLVVKELPAMPYH--DIYCLKFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEVA----NPIES-DVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFV----DLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPHISTLA--IEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSANPE------QWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRP------GSAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            GSVG + FQ       L + +  +    +YH     ++   R  NP                +  ++L +   +   W+D+ KL   D+ + ++P  Y P    +VR  N   + +  F    L+ +      + W      +      +N+   +    ++    QR KR   C    LP +    P  + S  L +     + V+  L  + Q A +    +     L++  L  L   Y +    +  Q+ C  G        CT  A I + +        +  ++   R +  +L+ E  Q  +  RV +  +  + L+ +L        N  K++  +   +  +ALFY +   ++ ET +YPP R F+S+ +  +G  F+     ++  LL+ +L+N  L  +  PHF PN+       MY  V  +  +      +V  +L+KF++ Q+L  + P L  +  ++  +  A+     + + ++     L      ++  LL+  F       +       D  KL    W  VL    C     NE                          +L+  ++R  +E +   L   R      +  GL+  + P+   I  + G     LL A   +L R+            +  + L   ++ PWI    T + +       PWL  D  +A  +V +  + +  +      N        S  LH    W           P +P H   +Y  +F  + W    P +  M+    F         C         Q+ W+EV      P  S +  A +  L+ T     K    + A +  + + +       W  +  + Y      +  + +  ++L  P     +++  L  AAG ++        +D  + K   YV ++V LLS   +     +  A A+             +TGL  ++++      D +    +   L+ E+  L     +   A  +  +  WL     SP++LP L    +S + +  +  L E  I       ++  G  +WA + + + +     + +  EC+   + L +   +L  +Q  N        Q   ++V  + +  P +T++++  +L+ +     LL       +           ++ +  L +++E +  SG  G + LG KS LS  FR+  RS++VFL  QL   +  R+               PS  +     T + L  L+ L   +   E     + V      F    +HC+ D+   L T+   L+P  +  ++I
Sbjct: 1136 GSVGSRFFQAPAQRALLDRLKKRLAELADYHHGASKAVPAPRTFNPHTSPSAPSATAAATAPELHKELVKLFHLFRCWLDDEKLQGADLYLPSVPLHYDPH--RMVRIFNNDQDLWLEFVDMTLIGRDLAGCCNDWLKELQSNRVLTPGSNTAPGELGKSVSRGSPQRPKR--PCEPPPLPWLKTPVPAVVAS-CLCDDRVAEQLVAKDLQVLQQQACQATVRECRQVALDQDLLELLPGLYYNGEDQEVLQLECRPGYTSSSTHSCTGAATITIKFERAYMNERIKQQLHDTRVEAKQLLAETSQLPH-RRVPEAAVHTEELLTAL-------INEYKVQPKVGMRETGVALFYLMVSFVSEETTRYPPSRQFLSSCLEVLGQMFISGVETESERLLQTVLKNSCLCSLLSPHFTPNAAPRAFVGMYSLVAATLSAD--TSDMVFMLLTKFDVLQWLSVARPPLPWRSELLAGVYAALRTCGAQPSAEMVASSGLLR---SHWRKLLAHHFPDHYGETLRMLVDGSDEQKLSPEVWSDVLLTLGCTEAGPNETWTAPAATITTATAAAAITIEPDRAGLLSDVQVRETMEWLARQLLALRLLRQGRRSFGLYSAWRPYVPAIASLYGFLGRHLLRAERARLVRNGKAGTTDAEAAAQSIYALLTDLFKPWILHLETGDKS--CPRSAPWLDVDSALACTMVRLFCDCVRALHELFGGNLLPFGGKGSLWLH----W--QHYCSTMAQPGIPKHVLAVYHSEFAALPWARFQPDIQAMQAF--FKVECGGQASCFRFLGSALCQVNWLEVLAGAWGPFPSGETCAMLTYLLYTLAALAKESSFLDAPDGPLPILMAQAAAFPWQLVDPAAYESVAKYVGDHFQASLVLGAPGDAASRLLPVLKAAAG-LAPGTFAQKKLD-ALPKCRAYVKLLVGLLSKEIA-----HPNAAAA-------------LTGLLEDVQNFAPPGLDVQTLYTIHTQLVVELLVLLNQGSLEKAAPLVNGLTAWLDGHPHSPLVLPVLTAACRSLASVRHMAELVETSIAAHFAGIQAAQGSEAWAPVLSALHMPELTLKAFVDECMSLGAFLTLHAHLL-QLQHRNETTLVYEMQLLLQVVGWIARAVP-KTMSQEPKLLLWWHKALELLLLQLLHNKKLPLGEMARVLRSLVSSLTQLAEERVMSGLLGVLRLGHKSPLSPRFRLAARSMAVFLQAQLLDEHTLRLQ--------------PSSLLQLTPRTAQALSSLEALGLNKQYVEFQGEIQGVCQ----FTREHQHCLHDANRLLATLAIALFPSVRYLDII 2393          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002450.1 (pep scaffold:Pmarinus_7.0:GL477076:63120:92452:-1 gene:ENSPMAG00000002209.1 transcript:ENSPMAT00000002450.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 2.552e-31
Identity = 258/1321 (19.53%), Postives = 484/1321 (36.64%), Query Frame = 1
Query: 3667 GSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSI---RQSNP----------TNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKP---TVP-------IATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKG-----AQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVII---DCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLE-SSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRC------------NITEHNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICG----QLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNN-----DARSYLLHCVLIWIANGLLVVKELPAMPYH--DIYCLKFRLITW-ELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEVA----NPIES-DVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFV----DLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPHISTLA--IEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSANPE------QWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRP------GSAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLI 7392
            GSVG + FQ       L + +  +    +YH     ++   R  NP                +  ++L +   +   W+D+ KL   D+ + ++P  Y P    +VR        FN  + + LE       G +     +     L ++    P   T P       ++    QR KR   C    LP +    P  + S  L +     + V+  L  + Q A +    +     L++  L  L   Y +    +  Q+ C  G        CT  A I + +        +  ++   R +  +L+ E  Q  +  RV +  +  + L+ +L        N  K++  +   +  +ALFY +   ++ ET +YPP R F+S+ +  +G  F+     ++  LL+ +L+N  L  +  PHF PN+       MY  V  +  +      +V  +L+KF++ Q+L  + P L  +  ++  +  A+     + + ++     L      ++  LL+  F       +       D  KL    W  VL    C            N+      V    ++R  +E +   L   R      +  GL+  + P+   I  + G     LL A   +L R+            +  + L   ++ PWI    T + +       PWL  D  +A  +V +  + +  +      N        S  LH    W           P +P H   +Y  +F  + W    P +  M+    F         C         Q+ W+EV      P  S +  A +  L+ T     K    + A +  + + +       W  +  + Y      +  + +  ++L  P     +++  L  AAG       +  M++  + K   YV ++V LLS   +     N+ A                +TGL  ++++      D +    +   L+ E+  L     +   A  +  +  WL     SP++LP L    +S + +  +  L E  I       ++  G  +WA + + + +     + +  EC+   + L +   +L  +Q  N        Q   ++V  + +  P +T++++  +L+ +     LL       +           ++ +  L +++E +  SG  G + LG KS LS  FR+  RS++VFL  QL   +  R+               PS  +     T + L  L+ L   +   E     + V      F    +HC+ D+   L T+   L+P  +  ++I
Sbjct:  252 GSVGSRFFQAPAQRALLDRLKKRLAELADYHHGASKAVPAPRTFNPHTSPSAPSATAAATAPELHKELVKLFHLFRCWLDDEKLQGADLYLPSVPLHYDPH--RMVR-------IFNNDQDLWLEFVDMTLIGRDLAGCCNDWLKELQSNRVLTPGSNTAPGAELGKSVSRGSPQRPKR--PCEPPPLPWLKTPVPAVVAS-CLCDDRVAEQLVAKDLQVLQQQACQATVRECRQVALDQDLLELLPGLYYNGEDQEVLQLECRPGYTSSSTHSCTGAATITIKFERAYMNERIKQQLHDTRVEAKQLLAETSQLPH-RRVPEAAVHTEELLTAL-------INEYKVQPKVGMRETGVALFYLMVSFVSEETTRYPPSRQFLSSCLEVLGQMFISGVETESERLLQTVLKNSCLCSLLSPHFTPNAAPRAFVGMYSLVAATLSAD--TSDMVFMLLTKFDVLQWLSVARPPLPWRSELLAGVYAALRTCGAQPSAEMVASSGLLR---SHWRKLLAHHFPDHYGETLRMLVDGSDEQKLSPEVWSDVLLTLGCTEADRVPTTMALNVRPCARPVARTPQVRETMEWLARQLLALRLLRQGRRSFGLYSAWRPYVPAIASLYGFLGRHLLRAERARLVRNGKAGTTDAEAAAQSIYALLTDLFKPWILHLETGDKS--CPRSAPWLDVDSALACTMVRLFCDCVRALHELFGGNLLPFGGKGSLWLH----W--QHYCSTMAQPGIPKHVLAVYHSEFAALPWARFQPDIQAMQAF--FKVECGGQASCFRFLGSALCQVNWLEVLAGAWGPFPSGETCAMLTYLLYTLAALAKESSFLDAPDGPLPILMAQAAAFPWQLVDPAAYESVAKYVGDHFQASLVLGAPGDAASRLLPVLKAAAGLAPGTCPHPNMLNDALPKCRAYVKLLVGLLSKEIAH---PNAAAA---------------LTGLLEDVQNFAPPGLDVQTLYTIHTQLVVELLVLLNQGSLEKAAPLVNGLTAWLDGHPHSPLVLPVLTAACRSLASVRHMAELVETSIAAHFAGIQAAQGSEAWAPVLSALHMPELTLKAFVDECMSLGAFLTLHAHLL-QLQHRNETTLVYEMQLLLQVVGWIARAVP-KTMSQEPKLLLWWHKALELLLLQLLHNKKLPLGEMARVLRSLVSSLTQLAEERVMSGLLGVLRLGHKSPLSPRFRLAARSMAVFLQAQLLDEHTLRLQ--------------PSSLLQLTPRTAQALSSLEALGLNKQYVEFQGEIQGVCQ----FTREHQHCLHDANRLLATLAIALFPSVRYLDII 1499          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Nematostella
Match: EDO32943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STL6])

HSP 1 Score: 85.1149 bits (209), Expect = 7.490e-18
Identity = 61/238 (25.63%), Postives = 118/238 (49.58%), Query Frame = 1
Query: 1981 MSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETA-IYLPLSLHQRMATLLMS-------------SFKRHSMDSKSGNWFVNESIKLVTYLWWN-QEPNQEQSFHAWCLSLIIRLRLHPSTRPKVV 2649
            MSQ + ++LLT  +N+A  SR   + + +    +    +++ ++   TR   SK GR+LL ++   HP  +S++L        TVG++ +++F  LP  +  P  ++  L+ SWLL        +QLAR+V  N+NWG     E++ ++L  S H+ ++ +L+              + +  + D+     F+ +  ++ T  +    + N EQ+ + W   + ++LRLH +  P  V
Sbjct:    1 MSQSEAVFLLTTFTNMA-TSREAHDRDFIEAVTLEV--YEVSFITNQTRDFSSKTGRDLLGTLCGFHPFIISVLLRKVSETIETVGKVCVYMFSGLPVHVWHPCSSDMDLIRSWLLKTDLTSPQHQLARYVLKNMNWGCDESGESSQLFLDRSWHRAVSVMLVEVSALRLPLRPGGIAHENFAADAS----FLQQVTQIATSSYNRLMQQNHEQTLYDWLWEVALQLRLHETDLPAPV 231          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Nematostella
Match: EDO32945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STL9])

HSP 1 Score: 81.2629 bits (199), Expect = 1.978e-15
Identity = 69/258 (26.74%), Postives = 119/258 (46.12%), Query Frame = 1
Query: 6634 SDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSM-QSANPEQWQTRIVDCLE---QIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKN-------FIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEAL-PTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPD 7371
              + DGG   W  I     +    Q  + +ECI Q+++L +   +L+ + Q  +P+Q  T + D +    +++ +R   +++ +    F+ ++L  A++ +   G    N        I  L ++ E K SSG  G +G GKKS+ S  FR   R L  F+  QLPSN L R+    PG V  P  +      G  +  T +    L  L++ RS+K  +     + + + SFI NP H + D    +  +   L+P+
Sbjct:  205 GSEHDGG---WEQIAPSFSVPELAQDSFIEECIHQSALLTLYTYVLLRLSQCTSPKQEMTVLADIVSWCSRMKIRRQFEDRAPL----FWHKILQLALRQADYSGEPLNNVARQLSFLITTLHQLGEDKDSSGLLGAIGFGKKSSYSIRFRFLSRVLEAFILAQLPSNLLLRLEPKAPGYVREPVKSKQKNESGRTITSTAEAESALAALEALRSNKHYSQLVSHITEMH-SFIANPLHSLRDGPAMVARLATDLYPE 454          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Nematostella
Match: EDO31384 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY35])

HSP 1 Score: 76.2554 bits (186), Expect = 1.849e-13
Identity = 65/238 (27.31%), Postives = 112/238 (47.06%), Query Frame = 1
Query: 6694 NIEFQQQYWKECIKQNSILCIVQQILVSM-QSANPEQWQTRIVDCLE---QIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKN-------FIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALP-TNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPD 7371
            N E    + +ECI Q+++L +   +L+ + Q  +P+Q  T + D +    +++ +R   +++      F+ ++L  A++ +   G    N        I  L ++ E K SSG  G +G GKKS+ S  FR   R L  F+  QLPSN L R+    PG V  P  +      G  +  T +    L  L++ RS+K  +     + + + SFI NP H + D    +  +   L+P+
Sbjct: 1345 NAEQHAAHGQECIHQSALLTLYTYVLLRLSQCTSPKQEMTVLADIVSWCSRMKIRRQFEDRAP----LFWHKILQLALRQADYSGEPLNNVARQLSFLITTLHQLGEDKDSSGLLGAIGFGKKSSYSIRFRFLSRVLEAFILAQLPSNLLLRLEPKAPGYVREPVKSKQKNESGRTITSTAEAESALAALEALRSNKHYSQLVSHITEMH-SFIANPLHSLRDGPAMVARLATDLYPE 1577          

HSP 2 Score: 73.9442 bits (180), Expect = 8.274e-13
Identity = 56/229 (24.45%), Postives = 101/229 (44.10%), Query Frame = 1
Query: 4279 HKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCN---KGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFN 4956
             +A+++ L D  + Y+  L R Y +        +PC    +    C   A I L Y        V  ++S NRQ+Y  +V   LQ   +D V      ++ +I  L  +++S +     +++ D   +LFY L   I+    +Y P   F S+ +  +G  F+  +  Q   LL  +LE   +  +  P F PN    +   MY +V+++ +     + +  S+LSK +
Sbjct:  781 READRHILLD--RDYIQLLPRMYTNDMTQAVISVPCRSKFRSGHQCIGPAQITLRYLAKHDNEIVIRQVSDNRQEYETMVKGFLQPCPMD-VCTAAANVERIITCLVEKVESNKQRKNKEILSDIGTSLFYQLASTIDGNCLRYQPTLQFFSSCIEILGKTFILHTGSQTEQLLYAILELTSITMLLVPFFCPNESPDRFTAMYHEVLETSD-----KDLAFSLLSKVS 1001          
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Planmine SMEST
Match: SMESG000027516.1 (SMESG000027516.1)

HSP 1 Score: 4790.33 bits (12424), Expect = 0.000e+0
Identity = 2350/2379 (98.78%), Postives = 2357/2379 (99.08%), Query Frame = 1
Query:  262 ETNQSTIEPDQKSENLEKEPERQENINLIEVEQTEQIYGIDIGVLYPSLSKCCADSITIQEMSETITDDRNSLDVVTERLTRPAVPIVEWRLPEPLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTNVRDNGPIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQIGRDEVELAITSLAMLLGSRKARDQFLEAWNPGLSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDVPMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSEXXXXXXXXXXXFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQNLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPDLLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSKFNIKQFLESSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNNDARSYLLHCVLIWIANGLLVVKELPAMPYHDIYCLKFRLITWELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEVANPIESDVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPHISTLAIEPVICWLQESKSSPIILPFLVTLYQXXXXXXXXXXXXXXXXXTFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLIYS 7398
            +TNQSTIEPDQKSENLEKEPERQENINLIEVEQTEQIYGIDIGVLYPSLSKCCADSITIQEMSETITDDRNSLDVVTERLTRPAVPIVEWRLPEPLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRL QARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTNVRDNGPIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQIGRDEVELAITSLAMLLGSRKARDQFLEAWNPGLSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIF+AALDVPMPNDHSQQIDDYDPARGCHP KLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSELLLLTAITKLLFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRH+MDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQNLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLG GNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLAR                  DDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRP+LLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILS+FNIKQFLESSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNNDARSYLLHCVLIWIANGLLVVKELPAMPYHDIYCLKFRLITWELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEVANPIES+VAAQMFQLVVTFICKTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVS NNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPHISTLAIEPVICWLQESKSSPIILPFLVTLYQSGSHISSIVSLSEELIETFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSA+QNSPRPGSAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLIYS
Sbjct:    4 KTNQSTIEPDQKSENLEKEPERQENINLIEVEQTEQIYGIDIGVLYPSLSKCCADSITIQEMSETITDDRNSLDVVTERLTRPAVPIVEWRLPEPLGEGEMRVHYKNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLHQARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGKLGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTNVRDNGPIRTALTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLHAPAGLTEWGAPSLLQIGRDEVELAITSLAMLLGSRKARDQFLEAWNPGLSKEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFQAALDVPMPNDHSQQIDDYDPARGCHPDKLLTMMAFCMRMMAILDTGLDIYHQNRYKALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQYEFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSEVPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSELLLLTAITKLLFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWHPTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVFSNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHAMDSKSGNWFVNESIKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSSITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQNLVVRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYNMVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQINWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKRSGLAQIFRLGTTFNALINQLGSGNFMWLKSYILEAQVSVENEMGLWSELLFRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQPDNVALIKIATIFFQRYLGLAR------------------DDLCHPFLQQARDSILAAKNYHLSQLDSIRQSNPTNILLIDQTQKLSERLEMLLLWIDEPKLHIEDMPVLNLPAQYRPELLNLVRQANITAESFNFPRRILLEQSRQAASGWNTRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSCSTLDLPNIAPYQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYLAALSRQYEDKPVVQNFQIPCNKGAQLCTNHAVINLNYTTWVKRPDVTSEISRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKIKVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQKIVLSILSRFNIKQFLESSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDINLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECFRCNITEHNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPHSVYIMKICGQLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQSFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNNDARSYLLHCVLIWIANGLLVVKELPAMPYHDIYCLKFRLITWELLPTMDCMKLIVEFISRTWISEQCKTLFIDIASQMRWMEVANPIESEVAAQMFQLVVTFICKTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCNPSTIEGKIIKYLNHAAGSVSPNNDNSVMIDMTINKQTIYVNVVVKLLSIAFSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQKMAMSLLTEVSQLFKNPHISTLAIEPVICWLQESKSSPIILPFLVTLYQSGSHISSIVSLSEELIETFILSDKSDGGPTSWATINACVRINIEFQQQYWKECIKQNSILCIVQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVLIIFFYLQLLLSAVQNSPRPGSAFKNFIQFLLKISESKTSSGFFGKVGLGKKSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRAIGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFDSTNFLRTMCRQLWPDCKLFNLIYS 2364          
The following BLAST results are available for this feature:
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
EPG59.927e-9921.49ectopic P-granules autophagy protein 5 homolog [So... [more]
EPG53.179e-1824.25ectopic P-granules autophagy protein 5 homolog [So... [more]
EPG53.595e-1818.98ectopic P-granules autophagy protein 5 homolog [So... [more]
EPG52.105e-1218.52ectopic P-granules autophagy protein 5 homolog [So... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
epg-57.883e-3324.12Ectopic P granules protein 5 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Epg53.669e-6822.28gene:FBgn0038651 transcript:FBtr0305051[more]
Epg53.670e-6822.28gene:FBgn0038651 transcript:FBtr0273382[more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
epg51.147e-9721.69ectopic P-granules autophagy protein 5 homolog (C.... [more]
epg52.031e-9421.93ectopic P-granules autophagy protein 5 homolog (C.... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPG57.358e-9621.24ectopic P-granules autophagy protein 5 homolog [So... [more]
EPG51.947e-9521.47ectopic P-granules autophagy protein 5 homolog [So... [more]
EPG52.293e-9521.46ectopic P-granules autophagy protein 5 homolog [So... [more]
EPG56.477e-8921.53ectopic P-granules autophagy protein 5 homolog [So... [more]
EPG59.571e-917.82ectopic P-granules autophagy protein 5 homolog [So... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Epg53.546e-10321.46ectopic P-granules autophagy protein 5 homolog (C.... [more]
Epg53.546e-10321.46ectopic P-granules autophagy protein 5 homolog (C.... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80TA9|EPG5_MOUSE2.480e-10221.46Ectopic P granules protein 5 homolog OS=Mus muscul... [more]
sp|Q9HCE0|EPG5_HUMAN4.767e-9821.49Ectopic P granules protein 5 homolog OS=Homo sapie... [more]
sp|A5WUT8|EPG5_DANRE8.660e-9721.69Ectopic P granules protein 5 homolog OS=Danio reri... [more]
sp|Q9VE34|EPG5_DROME3.679e-6722.28Ectopic P granules protein 5 homolog OS=Drosophila... [more]
sp|Q0IEK6|EPG5_AEDAE3.846e-5323.29Ectopic P granules protein 5 homolog OS=Aedes aegy... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J4D91.342e-14623.17ectopic P granules protein 5 homolog OS=Lingula un... [more]
A0A1S3JCV61.407e-14223.04ectopic P granules protein 5 homolog isoform X3 OS... [more]
A0A1S3JED02.387e-14023.08ectopic P granules protein 5 homolog isoform X2 OS... [more]
A0A1S3JD423.897e-14023.07ectopic P granules protein 5 homolog isoform X1 OS... [more]
A0A0L8I6R23.088e-13423.37Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
epg52.425e-9722.49ectopic P-granules autophagy protein 5 homolog [So... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002445.12.637e-4123.61pep scaffold:Pmarinus_7.0:GL477076:63120:105533:-1... [more]
ENSPMAT00000002440.12.029e-4023.32pep scaffold:Pmarinus_7.0:GL477076:63120:105533:-1... [more]
ENSPMAT00000002450.12.552e-3119.53pep scaffold:Pmarinus_7.0:GL477076:63120:92452:-1 ... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO329437.490e-1825.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329451.978e-1526.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313841.849e-1327.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ectopic P-granules autophagy protein 5 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000027516.10.000e+098.78SMESG000027516.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023198 ID=SMED30023198|Name=Ectopic P-granules autophagy protein 5 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=7521bp
TTGTATTTGAAAATCATATTCCTCAGAATAATATAAATTTATATCGTAAA
TAAATATTGAACATTTCAAACCATTTGTTCTATTTGTTTTTGACGTCAAA
TTTACTCTGAAATTTTATTTGCCTTAATGGCTGAGTTAGTCGTTACAAGA
AAGAAATTAAAAGCCAAAAATATAAGAATTCTTGATGAAGCAATTCCGCA
TTTTCCAGATTTATCGGGTTTACCAGACCTTAATGTATTAGAGTCTCAAG
AAAATGAACCAGAAACTAATCAATCTACCATTGAACCAGACCAGAAAAGT
GAAAATCTCGAGAAAGAGCCTGAAAGACAAGAGAACATAAATCTAATTGA
AGTAGAGCAAACAGAGCAAATTTATGGAATTGACATTGGTGTATTGTACC
CATCCCTGAGCAAATGCTGTGCAGACTCTATTACAATCCAAGAAATGAGC
GAGACGATTACTGATGACAGGAATTCATTGGACGTCGTGACAGAGCGTCT
TACAAGGCCGGCGGTGCCGATAGTGGAATGGCGGCTGCCGGAACCATTGG
GAGAAGGAGAAATGAGAGTACATTACAAAAATGCACTGCTCGACAATCTC
GAGTGCCTCCAGGCGAGATTCATCGGGGAAATGCAAAACCTGGATCCGCA
TCCTTTGGTACAATTGATTGAGGGATATCAAAGGAGCATCAGAAGTCTCA
CGGAGACTGAATCAAGGCTGCGTCAGGCGCGTGATGATTGCGTGACAGCT
GAGCCATCTCTGTGGCGTATCGAGGCAAGAAACGCAGTCAAGGAGGCGAG
ATGTGGGGACAACGCAATTGTGAGGCGAACCTACTCGTTCGACGAAGCAA
TATTCAATACGGACCAAGCAGGGAAACTCGGAGCTCAGCTGACAGAGCTG
GTTGATGCAGTGATCGATGAGCATGCACTTGCCAAGTACGAGGTAGGTAT
AAACCGACAACAGATAGAGAATTTTCTGGCGGGTATCGTAACCAATGTGC
GGGACAATGGGCCAATCAGAACGGCTCTCACAATCCTATTTCGGTTCCTC
CGTCAGCCGCCCGGTCATCATGATGTTGTACGCGCTATCCACGACTGGAT
CACTTTTTTAGGCCGTGAATTGGCCGCCAATCGCACTGTCGAAGATCGCC
TCTATCTGCTATGGCAACTTCTGCATGCACCAGCCGGCCTCACTGAGTGG
GGCGCTCCATCCCTGCTCCAGATCGGCCGTGACGAGGTCGAGCTCGCTAT
CACAAGTCTCGCCATGTTACTGGGATCGAGAAAGGCTCGTGATCAATTCC
TGGAAGCATGGAATCCCGGATTAAGCAAAGAGGAAGCCGGATGGGCGCTC
GTCGACTCGGACGGAGAAGATGACGACACGATCGGACACAGCTGGTCGCT
GTTACGGGAGAGTGATCTGATTGCTTTTCTAGGTCAGATCCCGATTGCTA
GAATATTCCGGGCAGCACTCGATGTGCCGATGCCTAATGATCACTCGCAG
CAAATTGATGATTATGACCCGGCGCGTGGCTGTCATCCCGGCAAATTGCT
CACTATGATGGCGTTTTGCATGCGCATGATGGCTATTCTCGATACTGGCC
TGGATATCTACCACCAGAATCGTTACAAAGCACTCAATAAGCGTATCAGC
CGGATTATCAAGCACACAATACAAATTCTTACTGATCATTTGGAATTAGT
TCTCAGTTGGTCCGCCCTGCCTCAATTTGACCGGTTATTTCCTGGGAACT
GCCGCGTTGAAATGCTGGCACAATATGAATTCGTCTATGAACATCTGCTA
AAGAGTATCCTCAAACATCGACGTCACGGTAATTGTCAAAATCTTGTCGA
TATCCCATGGCGAATGCTGTCGCCTCATAAGAAATGGAGCTTCCTGACAT
TCCTAATTGATCCCAACCAATCAGAAGTACCGACAGACAATGATTGGTTC
CTCACTAATCTACAGCTTGCCATTGATCAAATGAGCCAGGACGACACAAT
TTACCTGCTGACAGCAATTTCCAATTTGGCCCTTGAGAGCCGGCCGGTTA
TCAATTCTGAATTGTTGCTGCTTACCGCAATAACCAAGCTACTGTTCCAG
ATCTGCTATGTCATTCCTTTAACGCGAACCTCATTTTCCAAAGTCGGCCG
AGAACTGTTGTCATCGATCTCTCTCCAACATCCACAAGCGCTATCGATCA
TTCTAGAAGCAACAAAGCTATGGCATCCAACAGTTGGTCAGATGGGTTTG
TTCCTGTTCCGTGATTTGCCATTTTGCTTGATGATGCCTTCTGACGCCGA
GTTCAAACTCTTGTCGTCATGGCTGCTAGACAACCCCCCAAATCACGTGT
GCAATCAGTTGGCACGCCACGTATTCAGCAATCTTAACTGGGGATTTGCT
AACATCGATGAAACCGCAATCTATTTACCGTTATCTCTGCACCAGCGCAT
GGCAACCTTGCTCATGTCCAGTTTCAAAAGGCACTCAATGGACAGCAAAT
CAGGCAATTGGTTTGTCAACGAAAGCATCAAATTGGTCACTTATCTTTGG
TGGAATCAGGAACCGAATCAGGAGCAATCATTCCATGCCTGGTGTCTCAG
TTTGATCATCCGACTGCGCTTGCACCCGTCAACCCGGCCGAAGGTTGTGG
ACCCAGAATATTTAAAGCCCTCATCAATCACCAACACCTCAGAATGGCTG
CAGCCCATTTCCGATGCCCAGCAGGAACGCTGCAGCCACCCAGTCGCTAT
GTACATAGCTGTGACCACCAACAATGATTCCTATGTGGCTGATGTGAATA
TGTTGAAAGTCATCCAGAATCTCGTAGTCCGTCATCAACAGTACCGCCTT
TGTCTTGAATTGATCTCTCAAATAATCCACAATTCGACTGCCAATCAAAC
CTCATTGCTGCTCGGCTGTGAAATTTTCATGAACGTCTGGAAGCTAATAG
TCCATGCGGACGACACCTATTATAACATGGTGAAGAACCTCATCGCTAAG
CAATTTCCTGGTCCAGTACTGAATTGCATTGGGAATTCGTTCTGTCCATC
TCTCGTTATTGCTAATGGCAACAAGGTCCAGCAAGAATTGACAATGAAAT
TCTTTCTCAATTCCATAACAAATCAAATAAATTGGTACACTGACCAATCA
TTTCTATGGCTTTTGGATAAATTACTCGAACTGAATACAGCATTGGATTT
ACAGACCGGTACAGAGGAATTTTATACTGTTGTTAAGCAATTCACCGAAA
AACAATTCTCTGATGCCTCAAAACGATCGGGACTCGCCCAAATTTTCCGC
CTGGGCACCACATTTAATGCATTAATAAACCAGTTGGGTCCCGGAAATTT
CATGTGGCTTAAGAGCTATATATTGGAAGCCCAGGTGTCGGTTGAGAACG
AAATGGGGCTATGGAGTGAACTGCTGTTCAGATTTCTGGTGAAAAAGAAA
CGCGAATATCGAACTTTCGTGTCAGCTATAAATAGTGTGTACAAACATTT
GCATTTGAGCTTGAGTATCAACATAAACAGTTTTGTAATAATCCAATCTG
CCCAGATTTTAGCTTCTTGTCAGCCTGACAATGTGGCACTCATCAAAATT
GCCACCATCTTCTTTCAACGGTATCTTGGTTTGGCACGGGTCTGGAACAA
AGATTTAGTAGGGCTTGGTAGTGTTGGCCATAAAATATTTCAGGACGATC
TCTGCCATCCATTTCTCCAACAAGCTCGAGACTCAATCTTGGCAGCGAAA
AATTATCACTTGTCACAATTAGATTCCATCCGACAATCTAATCCAACCAA
TATTCTTCTAATTGATCAAACCCAGAAGCTCAGTGAAAGACTGGAAATGC
TACTGTTGTGGATTGATGAACCGAAATTGCATATTGAAGACATGCCCGTA
TTGAATTTACCAGCACAATACCGACCCGACTTATTGAATCTTGTTCGACA
AGCAAATATCACTGCCGAATCTTTCAACTTTCCTCGCAGAATTCTCTTAG
AACAATCGAGACAAGCTGCATCCGGATGGAATACGAGACATGATCTTGAT
TTCAGGTTTGTGCGACTGGCGAATTCCATTTTCTCCAAGCCGACAGTTCC
GATCGCTACCAAGATACTACAGAGATTCAAGCGTCAAACCTCCTGTTCCA
CGCTGGATTTGCCGAATATTGCCCCATATCAGCCAATCACTATTCCTTCC
CAGGCATTGGCCAATATAACCCAAATCCTGGAGTTCGTTTCAGGGCCTCT
ATCAAGCATGTATCAGTCGGCAGCTAAGCACAAAGCTAATAAGAATTTCC
TCGCAGATTTAAACAAGAAATATCTAGCGGCATTGTCTAGACAGTACGAG
GATAAGCCAGTGGTTCAAAACTTCCAGATACCGTGTAACAAGGGTGCTCA
ATTATGCACTAACCACGCGGTTATCAATTTGAATTATACAACCTGGGTCA
AACGGCCTGATGTCACAAGTGAAATTTCAAGAAACAGGCAAGATTATAAT
AAACTGGTGGATGAAATGCTCCAGTTCTCCAATCTAGATCGCGTGGTTCA
AGGCGTGCTTTGCTTACAGCATTTGATAATGAGTCTCGAATCTCAGTTAC
AATCATGCCAGAATAGTGACAAAATTAAAGTTATAATTGACTGTGCTCTG
GCTCTGTTCTACTATTTGGGGCGCCAAATAAATCCGGAAACGCAGAAATA
CCCTCCTCATCGTATCTTTGTGTCCAACAGCATGAATTCCATCGGATCAA
AATTCATGTGCCGTTCATCTGATCAAGCCAGTGTATTGTTGAAAGGGATG
CTCGAAAACGAGCTTCTAGTAGAAGTCTACGGCCCTCATTTCTATCCGAA
TTCTGATACGTCAAAAACTGCTAATATGTATCTCGACGTCATTCAATCCT
ATGAGTCAGGAAAGTGTAAACAAAAAATTGTTTTATCAATTTTGAGCAAG
TTCAACATCAAACAATTTCTTGAATCATCCCCAAATTTGCTGTCTAAGCT
TGCCATGATGGACGTTCTCTGCACGGCAATTGGGAATGCAAATCCTGAGA
AAACTCGACAATTGGAGATCGACATCAATCTGGAGGAAATTAATGGCATT
AATTTTGTCACATTATTATCGTCCGATTTTGCTATATGCCTTCCAAGAGT
GATGACAAGTTTCTCTTCAATGTGCGATAACGGAAAATTGGGAGTTCGGT
TCTGGGACCTTGTATTAGAGTGTTTTCGGTGCAATATCACTGAGCACAAT
GAATTGGTTTTGAACATTGATGAAATTCGGATGGAGTTGGAAACTATCGG
GGCATGGTTAAACAAATCCAGATTCTCTGACACTCGCTGCAAGCAAAATG
GACTGTTTGGCAAATATGGGCCACATTCGGTTTATATTATGAAAATTTGT
GGTCAGCTACTGGACGCTCTAGCTTTTAAATTGGCCAGGTCGGCCACTGA
AAATATTTGTTCTTGGCATGAAGTTGTAGAAAAGAGTTGGGATTTATATC
TGAAAGTTTATATCCCATGGATACAGTCATTTTATACTTGTGAAAACACT
GAGCAAGGAGAACTCAGACTACCTTGGCTCATGGAGGATCGCGAAATTGC
CGATAATTTAGTGGGAATCGCTGTGGAACATTTAAATATTATCGCCTCTT
ACGTTACTAACAATGATGCAAGATCTTACCTGCTACACTGCGTCCTTATC
TGGATTGCCAATGGGCTCCTCGTTGTGAAAGAATTACCCGCCATGCCATA
TCATGATATATATTGCTTGAAATTTAGACTAATTACATGGGAATTATTAC
CGACTATGGATTGCATGAAACTAATTGTTGAGTTTATATCACGGACGTGG
ATATCAGAACAATGTAAAACACTATTCATTGATATTGCCAGTCAGATGCG
ATGGATGGAGGTGGCGAATCCCATTGAAAGTGATGTCGCTGCTCAAATGT
TTCAATTAGTCGTGACGTTTATCTGTAAGACGAAATCCGTATTCAAGATT
CTGGCTATTGAAAAGTTGGTAGATGTGTTTGTCGACCTTAATTGGGATCG
GCTGCAAACATCGGTTTATCGACAGGGAATGGATCAACTGGTTTCCAATC
TTGAACCGCGAATAATTCTATGTAATCCATCCACGATCGAGGGGAAAATT
ATCAAATATCTGAATCACGCAGCCGGATCTGTATCATCTAATAATGACAA
TTCAGTGATGATTGATATGACTATTAACAAGCAAACGATCTACGTTAATG
TGGTTGTCAAACTCTTGTCAATTGCCTTCTCATTTACTCAAGGTAAAAAC
AGCAAAGCCAAAGCATCTTCAGGAGATGATAACCAGTTGAAATTATTCCA
GCTGCGAATCACGGGATTGTTCAGTGAGATGGAAAGCGTTGTCATGCAAA
TATCAGATCGGGAACCCAGTCAGAAAATGGCCATGTCATTACTTACAGAA
GTAAGCCAGCTATTCAAGAATCCACATATATCAACATTAGCTATCGAGCC
GGTGATCTGTTGGTTGCAGGAATCCAAATCTAGTCCTATTATACTTCCAT
TTCTTGTAACTTTGTATCAATCTGGGTCACACATCTCATCTATTGTTTCA
TTGTCAGAGGAATTGATAGAAACGTTTATTTTGTCAGATAAAAGCGACGG
TGGTCCGACAAGTTGGGCTACAATTAACGCCTGTGTTCGCATCAATATAG
AATTCCAGCAGCAGTATTGGAAGGAATGTATCAAACAGAACTCTATTTTG
TGTATCGTACAACAGATTCTCGTCTCTATGCAATCAGCAAACCCCGAGCA
GTGGCAAACTCGAATTGTCGATTGTCTGGAACAAATTCGCCCTCAACGAA
CAGTCAATGAACAATCGACGGTTCTTATAATATTTTTTTATTTACAGTTG
TTGTTGTCAGCGATACAAAATTCACCGAGACCCGGTTCAGCTTTCAAGAA
CTTTATTCAATTTCTTTTGAAAATATCTGAAAGTAAAACATCGTCTGGGT
TCTTCGGGAAGGTTGGATTGGGGAAAAAATCAAATTTATCTTTTGAATTC
CGAATGTTCTGCAGATCATTGTCAGTATTTCTTCATGTCCAGTTGCCATC
AAACAATCTCTTCAGGATCCACTCAAATGATCCAGGTGGAGTCACTCATC
CTGACATGACAATCCCCTCGCGCGCAATTGGTGAAGCTTTACCAACCAAT
AAAACACTTCAACATTTGGATTGGCTCAAATCTCAGCGCTCGAGCAAGGA
ATTGACGGCAACCTCAAAATCTGTTATCGACAGCAACATTTCTTTCATTT
GTAATCCGAAACATTGTATTTTCGATTCCACAAACTTTCTTCGTACTATG
TGCCGCCAGCTATGGCCAGACTGTAAACTTTTTAATTTGATCTATTCTTG
ATTTTATTTCGACTTGATATTTTCCTCGCTGGCTCCGACCTGAGACCGCT
ATTTTCATCTAGATCAGCAATTTTTATTTAATACAACTTTGATAGTCTTT
TTGGCTTATTGTTGGTGCACC
back to top

protein sequence of SMED30023198-orf-1

>SMED30023198-orf-1 ID=SMED30023198-orf-1|Name=SMED30023198-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2425bp
MAELVVTRKKLKAKNIRILDEAIPHFPDLSGLPDLNVLESQENEPETNQS
TIEPDQKSENLEKEPERQENINLIEVEQTEQIYGIDIGVLYPSLSKCCAD
SITIQEMSETITDDRNSLDVVTERLTRPAVPIVEWRLPEPLGEGEMRVHY
KNALLDNLECLQARFIGEMQNLDPHPLVQLIEGYQRSIRSLTETESRLRQ
ARDDCVTAEPSLWRIEARNAVKEARCGDNAIVRRTYSFDEAIFNTDQAGK
LGAQLTELVDAVIDEHALAKYEVGINRQQIENFLAGIVTNVRDNGPIRTA
LTILFRFLRQPPGHHDVVRAIHDWITFLGRELAANRTVEDRLYLLWQLLH
APAGLTEWGAPSLLQIGRDEVELAITSLAMLLGSRKARDQFLEAWNPGLS
KEEAGWALVDSDGEDDDTIGHSWSLLRESDLIAFLGQIPIARIFRAALDV
PMPNDHSQQIDDYDPARGCHPGKLLTMMAFCMRMMAILDTGLDIYHQNRY
KALNKRISRIIKHTIQILTDHLELVLSWSALPQFDRLFPGNCRVEMLAQY
EFVYEHLLKSILKHRRHGNCQNLVDIPWRMLSPHKKWSFLTFLIDPNQSE
VPTDNDWFLTNLQLAIDQMSQDDTIYLLTAISNLALESRPVINSELLLLT
AITKLLFQICYVIPLTRTSFSKVGRELLSSISLQHPQALSIILEATKLWH
PTVGQMGLFLFRDLPFCLMMPSDAEFKLLSSWLLDNPPNHVCNQLARHVF
SNLNWGFANIDETAIYLPLSLHQRMATLLMSSFKRHSMDSKSGNWFVNES
IKLVTYLWWNQEPNQEQSFHAWCLSLIIRLRLHPSTRPKVVDPEYLKPSS
ITNTSEWLQPISDAQQERCSHPVAMYIAVTTNNDSYVADVNMLKVIQNLV
VRHQQYRLCLELISQIIHNSTANQTSLLLGCEIFMNVWKLIVHADDTYYN
MVKNLIAKQFPGPVLNCIGNSFCPSLVIANGNKVQQELTMKFFLNSITNQ
INWYTDQSFLWLLDKLLELNTALDLQTGTEEFYTVVKQFTEKQFSDASKR
SGLAQIFRLGTTFNALINQLGPGNFMWLKSYILEAQVSVENEMGLWSELL
FRFLVKKKREYRTFVSAINSVYKHLHLSLSININSFVIIQSAQILASCQP
DNVALIKIATIFFQRYLGLARVWNKDLVGLGSVGHKIFQDDLCHPFLQQA
RDSILAAKNYHLSQLDSIRQSNPTNILLIDQTQKLSERLEMLLLWIDEPK
LHIEDMPVLNLPAQYRPDLLNLVRQANITAESFNFPRRILLEQSRQAASG
WNTRHDLDFRFVRLANSIFSKPTVPIATKILQRFKRQTSCSTLDLPNIAP
YQPITIPSQALANITQILEFVSGPLSSMYQSAAKHKANKNFLADLNKKYL
AALSRQYEDKPVVQNFQIPCNKGAQLCTNHAVINLNYTTWVKRPDVTSEI
SRNRQDYNKLVDEMLQFSNLDRVVQGVLCLQHLIMSLESQLQSCQNSDKI
KVIIDCALALFYYLGRQINPETQKYPPHRIFVSNSMNSIGSKFMCRSSDQ
ASVLLKGMLENELLVEVYGPHFYPNSDTSKTANMYLDVIQSYESGKCKQK
IVLSILSKFNIKQFLESSPNLLSKLAMMDVLCTAIGNANPEKTRQLEIDI
NLEEINGINFVTLLSSDFAICLPRVMTSFSSMCDNGKLGVRFWDLVLECF
RCNITEHNELVLNIDEIRMELETIGAWLNKSRFSDTRCKQNGLFGKYGPH
SVYIMKICGQLLDALAFKLARSATENICSWHEVVEKSWDLYLKVYIPWIQ
SFYTCENTEQGELRLPWLMEDREIADNLVGIAVEHLNIIASYVTNNDARS
YLLHCVLIWIANGLLVVKELPAMPYHDIYCLKFRLITWELLPTMDCMKLI
VEFISRTWISEQCKTLFIDIASQMRWMEVANPIESDVAAQMFQLVVTFIC
KTKSVFKILAIEKLVDVFVDLNWDRLQTSVYRQGMDQLVSNLEPRIILCN
PSTIEGKIIKYLNHAAGSVSSNNDNSVMIDMTINKQTIYVNVVVKLLSIA
FSFTQGKNSKAKASSGDDNQLKLFQLRITGLFSEMESVVMQISDREPSQK
MAMSLLTEVSQLFKNPHISTLAIEPVICWLQESKSSPIILPFLVTLYQSG
SHISSIVSLSEELIETFILSDKSDGGPTSWATINACVRINIEFQQQYWKE
CIKQNSILCIVQQILVSMQSANPEQWQTRIVDCLEQIRPQRTVNEQSTVL
IIFFYLQLLLSAIQNSPRPGSAFKNFIQFLLKISESKTSSGFFGKVGLGK
KSNLSFEFRMFCRSLSVFLHVQLPSNNLFRIHSNDPGGVTHPDMTIPSRA
IGEALPTNKTLQHLDWLKSQRSSKELTATSKSVIDSNISFICNPKHCIFD
STNFLRTMCRQLWPDCKLFNLIYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029651EPG-5
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006914autophagy
GO:0032456endocytic recycling
GO:0097352autophagosome maturation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029651Ectopic P granules protein 5PANTHERPTHR31139:SF4ECTOPIC P GRANULES PROTEIN 5 HOMOLOGcoord: 20..1166
NoneNo IPR availablePANTHERPTHR31139FAMILY NOT NAMEDcoord: 20..1166