Tau tubulin kinase

Overview
NameTau tubulin kinase
Smed IDSMED30023193
Uniprot Best hitTau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=Ttbk2 PE=1 SV=1 (E=6.17679e-98)
Length (bp)4469
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tau tubulin kinase (SMED30023193) t-SNE clustered cells

Violin plots show distribution of expression levels for Tau tubulin kinase (SMED30023193) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tau tubulin kinase (SMED30023193) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tau tubulin kinase (SMED30023193) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023193

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023193SMESG000026133.1 SmedASXL_016036SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30023193SMESG000026133.1 dd_Smed_v4_12470_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023193SMESG000026133.1 dd_Smed_v4_12470_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023193SMESG000026133.1 dd_Smed_v6_12470_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30023193SMESG000026133.1 Contig10388newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30023193SMESG000026133.1 Contig10388uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30023193SMESG000026133.1 dd_Smed_v4_12470_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30023193SMESG000026133.1 dd_Smed_v4_12470_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30023193SMESG000026133.1 dd_Smed_v4_12470_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30023193SMESG000026133.1 dd_Smed_v4_12470_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tau tubulin kinase vs. Ensembl Human
Match: TTBK2 (tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:19141])

HSP 1 Score: 340.502 bits (872), Expect = 1.909e-103
Identity = 184/300 (61.33%), Postives = 230/300 (76.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+F+ISTTL+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF    G   VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + +K+  V +SD FDWE
Sbjct:    1 MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGD--VRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Human
Match: TTBK2 (tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:19141])

HSP 1 Score: 343.969 bits (881), Expect = 1.557e-97
Identity = 183/300 (61.00%), Postives = 230/300 (76.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+F+ISTTL+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF   +    VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + +K+  V +SD FDWE
Sbjct:    1 MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFT--NSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Human
Match: TTBK1 (tau tubulin kinase 1 [Source:HGNC Symbol;Acc:HGNC:19140])

HSP 1 Score: 339.732 bits (870), Expect = 1.105e-95
Identity = 177/300 (59.00%), Postives = 230/300 (76.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+     V+K+RWK++KK+GGGGFGEIYE +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRN+KF+YV M LQG+NLADLRR    G+F++STTL+L  QIL+SIE IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQ+   + +  VRPPR+VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVG IK  Y+H   L+ +P+EF  FL HI  LDYF KPDY+++ ++  + MK + + ++++FDWE
Sbjct:   14 MSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYT--NTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWE 311          
BLAST of Tau tubulin kinase vs. Ensembl Human
Match: TTBK1 (tau tubulin kinase 1 [Source:HGNC Symbol;Acc:HGNC:19140])

HSP 1 Score: 325.094 bits (832), Expect = 3.865e-95
Identity = 159/262 (60.69%), Postives = 201/262 (76.72%), Query Frame = 3
Query:  243 VDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRN+KF+YV M LQG+NLADLRR    G+F++STTL+L  QIL+SIE IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQ+    G   VRPPR+VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVG IK  Y+H   L+ +P+EF  FL HI  LDYF KPDY+++ ++  + MK + + ++++FDWE
Sbjct:    1 MDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGD--VRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWE 260          
BLAST of Tau tubulin kinase vs. Ensembl Human
Match: TTBK2 (tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:19141])

HSP 1 Score: 288.115 bits (736), Expect = 2.684e-85
Identity = 162/300 (54.00%), Postives = 207/300 (69.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+F+ISTTL+L  QIL+SIE+IHS+GFLHRDIKP                                     PR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + +K+  V +SD FDWE
Sbjct:    1 MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKP-------------------------------------PRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 263          
BLAST of Tau tubulin kinase vs. Ensembl Celegans
Match: ttbk-7 (Tau TuBulin Kinase [Source:UniProtKB/TrEMBL;Acc:Q22033])

HSP 1 Score: 307.375 bits (786), Expect = 8.589e-89
Identity = 172/333 (51.65%), Postives = 235/333 (70.57%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVK---DKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWEL---NXXXXXXXXXXXNIDTNMERRNSAII 1109
            MTSS+ E ++   G VI+ERWKI  K+GGGGFGEIYE  D  V+   ++VAIK+ESSK  KQVL+MEV+VL++LQG KHACK YG GRNDKF+Y+ M+LQGKNLADLRR+     F++ST +++ +QIL+ I  IHSIGFLHRD+KPSNFA+G +++T R VYMLDFGLARQ++   G  ++R PR  AGFRGTVRYA++ AH N EMGR DDLWS FYM  E + GQLPWR++KDK++VG++K   D    L   P+E   F+AH++ L Y   PDY  +++L+   +   +++  + +DWEL   N  +      + N+   ++   +A+I
Sbjct:    1 MTSSS-EGEILQVGQVIRERWKIKAKIGGGGFGEIYEATD--VQNHHERVAIKVESSKATKQVLKMEVAVLRRLQGKKHACKFYGCGRNDKFNYLVMSLQGKNLADLRREAPKQCFNLSTAVRVGIQILNGIREIHSIGFLHRDVKPSNFAMGRTSQTMRNVYMLDFGLARQYLNAKG--EIRSPRSAAGFRGTVRYAAVTAHKNKEMGRQDDLWSLFYMLTEFLQGQLPWRKIKDKDEVGKMKEEADLVVLLDDCPHEMHLFVAHLKVLGYADTPDYVYLESLLNKIVAENEISWDEPYDWELGYDNMATRQKQQANGNLSARLKSHTTAVI 328          
BLAST of Tau tubulin kinase vs. Ensembl Celegans
Match: R13H9.5 (pep chromosome:WBcel235:IV:5065746:5066987:-1 gene:WBGene00020071.1 transcript:R13H9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R13H9.5)

HSP 1 Score: 186.422 bits (472), Expect = 4.858e-52
Identity = 125/311 (40.19%), Postives = 176/311 (56.59%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKL--QGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIG-GSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHT---KFLQSLP-NEFKPFLAHIQELDYFKKPD----YEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            MT+          G ++ ERW I KKLG GG G +Y C D     K A+K+E      QVL+MEV VL +L  +G++H CK    GR   F+YV MTL GK+L DLR+       S++ +L + +Q L+++E++H+IG+LHRD+KP N+ IG       R VY+LDFG+AR+F   D +  +R PR  AGFRGTVRYA +  H N E+GR DD+    YM  E+  G++PW+ + D   VGQ K    +T    F+   P NE K  +  +   DYF  P+    Y +MK  + +C K +       +DWE
Sbjct:    1 MTAPPPPLVELPPGSMV-ERWSITKKLGEGGCGAVYLCTD--ATGKYALKVEGISEAMQVLKMEVLVLGELTKRGSRHFCKIEDKGRYGSFNYVVMTLVGKSLQDLRKGTAQQCLSLACSLSVGIQSLEALEDLHNIGYLHRDVKPGNYTIGRAELNELRKVYILDFGMARKFT--DNNGVIRKPRAAAGFRGTVRYAPIACHKNQELGRKDDVEVWLYMQVELTVGRVPWKEITDMNAVGQAKQTIRNTPEKMFVFPCPANELKEIMKMVDSWDYFADPNYADCYRLMKQALANCGKPEY-----PYDWE 301          
BLAST of Tau tubulin kinase vs. Ensembl Celegans
Match: ttbk-2 (Tau TuBulin Kinase [Source:UniProtKB/TrEMBL;Acc:O76712])

HSP 1 Score: 185.652 bits (470), Expect = 7.340e-52
Identity = 125/311 (40.19%), Postives = 176/311 (56.59%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKL--QGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIG-GSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHT---KFLQSLP-NEFKPFLAHIQELDYFKKPD----YEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            MT+          G ++ ERW I KKLG GG G +Y C D     K A+K+E      QVL+MEV VL +L  +G++H CK    GR   F+YV MTL GK+L DLR+       S++ +L + +Q L+++E++H+IG+LHRD+KP N+ IG       R VY+LDFG+AR+F   D +  +R PR  AGFRGTVRYA +  H N E+GR DD+    YM  E+  G++PW+ + D   VGQ K    +T    F+   P NE K  +  +   DYF  P+    Y +MK  + +C K +       +DWE
Sbjct:    1 MTAPPPPLVELPPGSMV-ERWSITKKLGEGGCGAVYLCTD--ATGKYALKVEGISEAMQVLKMEVLVLGELTKRGSRHFCKIEDKGRYGSFNYVVMTLVGKSLQDLRKGTAQQCLSLACSLSVGIQSLEALEDLHNIGYLHRDVKPGNYTIGRAELNELRKVYILDFGMARKFT--DNNGVIRKPRAAAGFRGTVRYAPIACHKNQELGRKDDVEVWLYMQVELTVGRVPWKEITDMNAVGQAKQAIRNTPEKMFVFPCPANELKEIMKMVDSWDYFADPNYADCYRLMKQTLANCGKPEY-----PYDWE 301          
BLAST of Tau tubulin kinase vs. Ensembl Celegans
Match: F35C11.3 (pep chromosome:WBcel235:II:8246776:8248263:1 gene:WBGene00009402.1 transcript:F35C11.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F35C11.3)

HSP 1 Score: 183.341 bits (464), Expect = 1.864e-50
Identity = 98/266 (36.84%), Postives = 160/266 (60.15%), Query Frame = 3
Query:  243 VDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPD--GSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDY-EMMKNLIRDCMKSKKVTQSDSFDWEL 1031
            V+P++K+K            ++L+MEV VLKKLQ ++H C+  G G+ + ++Y+ M++ GK + D+RR++     S  +T+++ +Q++ +++++H  GF+HRD+KPSN A+G   +  ++VY+ DFGL+RQ +LPD  G  ++R PR+ + FRGTVRY S+N H + E GRHDDL+ A Y   E  T  LPW+  K K++   +K      +  +  P  F      +++L Y + P Y   M+ L  D  K  K+T  D F+W L
Sbjct:   50 VEPLMKNK----------EDEILKMEVYVLKKLQNSRHVCRLLGSGKTETYTYMVMSVLGKEIGDVRRRLPQRKMSAPSTVRVFIQLVKALQDMHEAGFVHRDVKPSNMALG--VKNEQVVYIFDFGLSRQIMLPDASGKLKLREPRNKSMFRGTVRYCSLNVHLHKEQGRHDDLYGALYAMIETATSTLPWKG-KPKKETSALKEKTTDVQLCKGCPKSFLEIATTLRKLTYKETPPYGSFMEKLKADLPKGVKMT--DPFEWNL 300          
BLAST of Tau tubulin kinase vs. Ensembl Celegans
Match: M05D6.1 (pep chromosome:WBcel235:II:8473819:8475406:-1 gene:WBGene00010874.1 transcript:M05D6.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M05D6.1)

HSP 1 Score: 183.341 bits (464), Expect = 2.031e-50
Identity = 98/266 (36.84%), Postives = 160/266 (60.15%), Query Frame = 3
Query:  243 VDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPD--GSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDY-EMMKNLIRDCMKSKKVTQSDSFDWEL 1031
            V+P++K+K            ++L+MEV VLKKLQ ++H C+  G G+ + ++Y+ M++ GK + D+RR++     S  +T+++ +Q++ +++++H  GF+HRD+KPSN A+G   +  ++VY+ DFGL+RQ +LPD  G  ++R PR+ + FRGTVRY S+N H + E GRHDDL+ A Y   E  T  LPW+  K K++   +K      +  +  P  F      +++L Y + P Y   M+ L  D  K  K+T  D F+W L
Sbjct:   50 VEPLMKNK----------EDEILKMEVYVLKKLQNSRHVCRLLGSGKTETYTYMVMSVLGKEIGDVRRRLPQRKMSAPSTVRVFIQLVKALQDMHEAGFVHRDVKPSNMALG--VKNEQVVYIFDFGLSRQIMLPDASGKLKLREPRNKSMFRGTVRYCSLNVHLHKEQGRHDDLYGALYAMIETATSTLPWKG-KPKKETSALKEKTTDVQLCKGCPKSFLEIATTLRKLTYKETPPYGSFMEKLKADLPKGVKMT--DPFEWNL 300          
BLAST of Tau tubulin kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0300344)

HSP 1 Score: 338.191 bits (866), Expect = 4.985e-99
Identity = 181/292 (61.99%), Postives = 223/292 (76.37%), Query Frame = 3
Query:  153 DLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            DL   G V+KERWK+++K+GGGGFGEIYE  D I +++VA+K+ES++ PKQVL+MEV+VLKKLQG +H C+  G GRND+F+YV M LQGKNLA+LRR    G+FS+STTL+L LQIL +IE+IHS+GFLHRDIKPSNF++G      R VYMLDFGLARQ+    G+ +VR PR  AGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG  K  YDH   L+ LP++ K FL HIQ L Y  +PDY M+  L   CMK + V +SD +DWE
Sbjct:    5 DLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYT--TGTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE 294          
BLAST of Tau tubulin kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0344869)

HSP 1 Score: 338.576 bits (867), Expect = 9.565e-97
Identity = 181/292 (61.99%), Postives = 223/292 (76.37%), Query Frame = 3
Query:  153 DLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            DL   G V+KERWK+++K+GGGGFGEIYE  D I +++VA+K+ES++ PKQVL+MEV+VLKKLQG +H C+  G GRND+F+YV M LQGKNLA+LRR    G+FS+STTL+L LQIL +IE+IHS+GFLHRDIKPSNF++G      R VYMLDFGLARQ+    G+ +VR PR  AGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG  K  YDH   L+ LP++ K FL HIQ L Y  +PDY M+  L   CMK + V +SD +DWE
Sbjct:    5 DLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTT--GTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE 294          
BLAST of Tau tubulin kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0332908)

HSP 1 Score: 338.576 bits (867), Expect = 9.565e-97
Identity = 181/292 (61.99%), Postives = 223/292 (76.37%), Query Frame = 3
Query:  153 DLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            DL   G V+KERWK+++K+GGGGFGEIYE  D I +++VA+K+ES++ PKQVL+MEV+VLKKLQG +H C+  G GRND+F+YV M LQGKNLA+LRR    G+FS+STTL+L LQIL +IE+IHS+GFLHRDIKPSNF++G      R VYMLDFGLARQ+    G+ +VR PR  AGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG  K  YDH   L+ LP++ K FL HIQ L Y  +PDY M+  L   CMK + V +SD +DWE
Sbjct:    5 DLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTT--GTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE 294          
BLAST of Tau tubulin kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0332904)

HSP 1 Score: 338.191 bits (866), Expect = 2.062e-96
Identity = 181/292 (61.99%), Postives = 223/292 (76.37%), Query Frame = 3
Query:  153 DLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            DL   G V+KERWK+++K+GGGGFGEIYE  D I +++VA+K+ES++ PKQVL+MEV+VLKKLQG +H C+  G GRND+F+YV M LQGKNLA+LRR    G+FS+STTL+L LQIL +IE+IHS+GFLHRDIKPSNF++G      R VYMLDFGLARQ+    G+ +VR PR  AGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG  K  YDH   L+ LP++ K FL HIQ L Y  +PDY M+  L   CMK + V +SD +DWE
Sbjct:  161 DLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTT--GTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE 450          
BLAST of Tau tubulin kinase vs. Ensembl Fly
Match: Asator (gene:FBgn0039908 transcript:FBtr0332905)

HSP 1 Score: 338.576 bits (867), Expect = 2.922e-96
Identity = 181/292 (61.99%), Postives = 223/292 (76.37%), Query Frame = 3
Query:  153 DLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            DL   G V+KERWK+++K+GGGGFGEIYE  D I +++VA+K+ES++ PKQVL+MEV+VLKKLQG +H C+  G GRND+F+YV M LQGKNLA+LRR    G+FS+STTL+L LQIL +IE+IHS+GFLHRDIKPSNF++G      R VYMLDFGLARQ+    G+ +VR PR  AGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG  K  YDH   L+ LP++ K FL HIQ L Y  +PDY M+  L   CMK + V +SD +DWE
Sbjct:    5 DLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTT--GTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE 294          
BLAST of Tau tubulin kinase vs. Ensembl Zebrafish
Match: ttbk2a (tau tubulin kinase 2a [Source:ZFIN;Acc:ZDB-GENE-120928-3])

HSP 1 Score: 346.28 bits (887), Expect = 1.718e-99
Identity = 182/300 (60.67%), Postives = 232/300 (77.33%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+ S G ++KERWKI+KK+GGGGFGEIYE +D + +  VA+K ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR M  G+F++STTL+L LQIL++IE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF   +   +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG++K  YDH   L+ LP +F  FL HI  LDYF KPDY++++ +  + M++  V ++D +DWE
Sbjct:    1 MSGGLEQIDILSTGILVKERWKILKKIGGGGFGEIYEALDLMTRTSVALKAESAQQPKQVLKMEVAVLKKLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRSMNRGTFTVSTTLRLGLQILEAIESIHSVGFLHRDIKPSNFAMGRFPSTCRTCYMLDFGLARQFT--NSCQEVRPPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFLVGQLPWRKIKDKEQVGKLKETYDHRLMLKHLPPQFTVFLDHISNLDYFTKPDYQLLRTVFENSMRTYNVVENDPYDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Zebrafish
Match: ttbk2a (tau tubulin kinase 2a [Source:ZFIN;Acc:ZDB-GENE-120928-3])

HSP 1 Score: 347.051 bits (889), Expect = 5.060e-99
Identity = 182/300 (60.67%), Postives = 232/300 (77.33%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+ S G ++KERWKI+KK+GGGGFGEIYE +D + +  VA+K ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR M  G+F++STTL+L LQIL++IE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF   +   +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG++K  YDH   L+ LP +F  FL HI  LDYF KPDY++++ +  + M++  V ++D +DWE
Sbjct:    1 MSGGLEQIDILSTGILVKERWKILKKIGGGGFGEIYEALDLMTRTSVALKAESAQQPKQVLKMEVAVLKKLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRSMNRGTFTVSTTLRLGLQILEAIESIHSVGFLHRDIKPSNFAMGRFPSTCRTCYMLDFGLARQFT--NSCQEVRPPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFLVGQLPWRKIKDKEQVGKLKETYDHRLMLKHLPPQFTVFLDHISNLDYFTKPDYQLLRTVFENSMRTYNVVENDPYDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Zebrafish
Match: ttbk2a (tau tubulin kinase 2a [Source:ZFIN;Acc:ZDB-GENE-120928-3])

HSP 1 Score: 347.051 bits (889), Expect = 5.060e-99
Identity = 182/300 (60.67%), Postives = 232/300 (77.33%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+ S G ++KERWKI+KK+GGGGFGEIYE +D + +  VA+K ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR M  G+F++STTL+L LQIL++IE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF   +   +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG++K  YDH   L+ LP +F  FL HI  LDYF KPDY++++ +  + M++  V ++D +DWE
Sbjct:    1 MSGGLEQIDILSTGILVKERWKILKKIGGGGFGEIYEALDLMTRTSVALKAESAQQPKQVLKMEVAVLKKLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRSMNRGTFTVSTTLRLGLQILEAIESIHSVGFLHRDIKPSNFAMGRFPSTCRTCYMLDFGLARQFT--NSCQEVRPPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFLVGQLPWRKIKDKEQVGKLKETYDHRLMLKHLPPQFTVFLDHISNLDYFTKPDYQLLRTVFENSMRTYNVVENDPYDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Zebrafish
Match: ttbk2b (tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8246])

HSP 1 Score: 341.273 bits (874), Expect = 6.937e-99
Identity = 177/300 (59.00%), Postives = 232/300 (77.33%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+ + ++ D+ + G +++ERW+++KK+GGGGFGEIYE +D + +  VA+K+ES++ PKQVL+MEV+VLK+LQG  H C+  G GRND+F+YV M LQG+NLADLRR M  G+FS+STTL+L  QIL++IE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF   +   +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG +K  Y+H   L+ LP+EF  F  HI  LDY+ KPDY+++ ++  + MKS  V ++D +DWE
Sbjct:    1 MSGTVEQTDILAVGSMVRERWRVLKKIGGGGFGEIYEVLDHVNQVSVALKVESAQQPKQVLKMEVAVLKRLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRNMSHGTFSVSTTLRLGRQILEAIESIHSVGFLHRDIKPSNFAMGRLNSTCRTCYMLDFGLARQFT--NSCQEVRPPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFMVGQLPWRKIKDKEQVGNMKETYNHRLLLKHLPDEFSVFFDHISNLDYYTKPDYQLLMSVFDNSMKSYNVVENDPYDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Zebrafish
Match: ttbk1a (tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-100609-4])

HSP 1 Score: 343.584 bits (880), Expect = 1.897e-97
Identity = 179/300 (59.67%), Postives = 231/300 (77.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M  + ++ D+     ++K+RWK++KK+GGGGFGEIYE +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H CK  G GRNDKF+YV M LQG+NLADLRR    G+F++STTL+L  QIL+SIE IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQ+   +G  +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVGQIK  YDH   L+ +P+EF  FL H+  LDY+ KPDY+++ ++  + MK + +T+++ +DWE
Sbjct:    1 MNGTAEQQDILPPHCMVKDRWKVLKKIGGGGFGEIYEALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGRNDKFNYVVMQLQGRNLADLRRSQPRGTFTMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTFRKCYMLDFGLARQYTNTNG--EVRPPRTVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFAAGQLPWRKIKDKEQVGQIKERYDHRMLLKHMPSEFNVFLEHVLALDYYTKPDYQLLMSVFENSMKERIITENEPYDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 343.969 bits (881), Expect = 8.874e-101
Identity = 185/300 (61.67%), Postives = 230/300 (76.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++PD+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+FSIST L+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF    G   VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  Y+H   L+ LP EF  FL HI  LDYF KPDY+++ ++  + MK+  V +SD FDWE
Sbjct:   12 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCG--DVRPPRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWE 309          
BLAST of Tau tubulin kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 345.51 bits (885), Expect = 3.723e-98
Identity = 184/300 (61.33%), Postives = 230/300 (76.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++PD+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+FSIST L+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF   +    VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  Y+H   L+ LP EF  FL HI  LDYF KPDY+++ ++  + MK+  V +SD FDWE
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFT--NSCGDVRPPRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 345.895 bits (886), Expect = 7.507e-98
Identity = 184/300 (61.33%), Postives = 230/300 (76.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++PD+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+FSIST L+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF   +    VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  Y+H   L+ LP EF  FL HI  LDYF KPDY+++ ++  + MK+  V +SD FDWE
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFT--NSCGDVRPPRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 328.176 bits (840), Expect = 2.892e-95
Identity = 166/265 (62.64%), Postives = 201/265 (75.85%), Query Frame = 3
Query:  234 YECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            Y+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+FSIST L+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF    G   VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  Y+H   L+ LP EF  FL HI  LDYF KPDY+++ ++  + MK+  V +SD FDWE
Sbjct:   33 YDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCG--DVRPPRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWE 295          
BLAST of Tau tubulin kinase vs. Ensembl Xenopus
Match: col24a1 (collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:XB-GENE-980334])

HSP 1 Score: 290.041 bits (741), Expect = 7.024e-86
Identity = 163/300 (54.33%), Postives = 207/300 (69.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++PD+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+FSIST L+L  QIL+SIE+IHS+GFLHRDIKP                                     PR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  Y+H   L+ LP EF  FL HI  LDYF KPDY+++ ++  + MK+  V +SD FDWE
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFSISTMLRLGRQILESIESIHSVGFLHRDIKP-------------------------------------PRAVAGFRGTVRYASVNAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYEHRLMLKHLPPEFSVFLEHIIGLDYFTKPDYQLLVSVFDNSMKTFGVLESDPFDWE 263          
BLAST of Tau tubulin kinase vs. Ensembl Mouse
Match: Ttbk2 (tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:2155779])

HSP 1 Score: 346.28 bits (887), Expect = 3.340e-101
Identity = 183/300 (61.00%), Postives = 231/300 (77.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++PD+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+F+ISTTL+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  +MLDFGLARQF   +    VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + +K+  V +SD FDWE
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFT--NSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Mouse
Match: Ttbk1 (tau tubulin kinase 1 [Source:MGI Symbol;Acc:MGI:2147036])

HSP 1 Score: 337.421 bits (864), Expect = 4.915e-99
Identity = 178/300 (59.33%), Postives = 229/300 (76.33%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+     V+K+RWK++KK+GGGGFGEIYE +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRN+KF+YV M LQG+NLADLRR    G+F++STTL+L  QIL+SIE IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQ+    G   VRPPR+VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVG IK  Y+H   L+ +P+EF  FL HI  LDYF KPDY+++ ++  + MK + + ++++FDWE
Sbjct:   14 MSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGD--VRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWE 311          
BLAST of Tau tubulin kinase vs. Ensembl Mouse
Match: Ttbk2 (tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:2155779])

HSP 1 Score: 347.436 bits (890), Expect = 8.830e-99
Identity = 183/300 (61.00%), Postives = 231/300 (77.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++PD+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+F+ISTTL+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  +MLDFGLARQF   +    VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + +K+  V +SD FDWE
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFT--NSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Mouse
Match: Ttbk2 (tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:2155779])

HSP 1 Score: 347.436 bits (890), Expect = 8.830e-99
Identity = 183/300 (61.00%), Postives = 231/300 (77.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++PD+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+F+ISTTL+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  +MLDFGLARQF   +    VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + +K+  V +SD FDWE
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFT--NSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Mouse
Match: Ttbk2 (tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:2155779])

HSP 1 Score: 347.051 bits (889), Expect = 2.602e-98
Identity = 183/300 (61.00%), Postives = 231/300 (77.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++PD+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+F+ISTTL+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  +MLDFGLARQF   +    VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + +K+  V +SD FDWE
Sbjct:   70 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFT--NSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 367          
BLAST of Tau tubulin kinase vs. UniProt
Match: sp|Q3UVR3|TTBK2_MOUSE (Tau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=Ttbk2 PE=1 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 6.177e-98
Identity = 183/300 (61.00%), Postives = 231/300 (77.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++PD+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+F+ISTTL+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  +MLDFGLARQF   +    VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + +K+  V +SD FDWE
Sbjct:    1 MSGGGEQPDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGKQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCFMLDFGLARQFT--NSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSTFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Tau tubulin kinase vs. UniProt
Match: sp|Q6IQ55|TTBK2_HUMAN (Tau-tubulin kinase 2 OS=Homo sapiens OX=9606 GN=TTBK2 PE=1 SV=2)

HSP 1 Score: 343.969 bits (881), Expect = 7.478e-97
Identity = 183/300 (61.00%), Postives = 230/300 (76.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+ S G ++KERWK+++K+GGGGFGEIY+ +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR    G+F+ISTTL+L  QIL+SIE+IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQF   +    VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG IK  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + +K+  V +SD FDWE
Sbjct:    1 MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFT--NSCGDVRPPRAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWE 298          
BLAST of Tau tubulin kinase vs. UniProt
Match: sp|Q6PCN3|TTBK1_MOUSE (Tau-tubulin kinase 1 OS=Mus musculus OX=10090 GN=Ttbk1 PE=1 SV=3)

HSP 1 Score: 339.732 bits (870), Expect = 4.677e-95
Identity = 177/300 (59.00%), Postives = 230/300 (76.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+     V+K+RWK++KK+GGGGFGEIYE +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRN+KF+YV M LQG+NLADLRR    G+F++STTL+L  QIL+SIE IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQ+   + +  VRPPR+VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVG IK  Y+H   L+ +P+EF  FL HI  LDYF KPDY+++ ++  + MK + + ++++FDWE
Sbjct:   14 MSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYT--NTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWE 311          
BLAST of Tau tubulin kinase vs. UniProt
Match: sp|Q5TCY1|TTBK1_HUMAN (Tau-tubulin kinase 1 OS=Homo sapiens OX=9606 GN=TTBK1 PE=1 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 5.304e-95
Identity = 177/300 (59.00%), Postives = 230/300 (76.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   ++ D+     V+K+RWK++KK+GGGGFGEIYE +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRN+KF+YV M LQG+NLADLRR    G+F++STTL+L  QIL+SIE IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQ+   + +  VRPPR+VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVG IK  Y+H   L+ +P+EF  FL HI  LDYF KPDY+++ ++  + MK + + ++++FDWE
Sbjct:   14 MSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYT--NTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWE 311          
BLAST of Tau tubulin kinase vs. UniProt
Match: sp|Q8IMC6|ASATR_DROME (Tau-tubulin kinase homolog Asator OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=2)

HSP 1 Score: 337.806 bits (865), Expect = 1.114e-94
Identity = 181/292 (61.99%), Postives = 223/292 (76.37%), Query Frame = 3
Query:  153 DLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            DL   G V+KERWK+++K+GGGGFGEIYE  D I +++VA+K+ES++ PKQVL+MEV+VLKKLQG +H C+  G GRND+F+YV M LQGKNLA+LRR    G+FS+STTL+L LQIL +IE+IHS+GFLHRDIKPSNF++G      R VYMLDFGLARQ+    G+ +VR PR  AGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG  K  YDH   L+ LP++ K FL HIQ L Y  +PDY M+  L   CMK + V +SD +DWE
Sbjct:  161 DLLQPGHVVKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSNFSVGRLPYNCRRVYMLDFGLARQYTT--GTGEVRCPRAAAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHRILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWE 450          
BLAST of Tau tubulin kinase vs. TrEMBL
Match: gnl|BL_ORD_ID|175766282 (tr|A0A1A7WKG4|A0A1A7WKG4_9TELE Tau tubulin kinase 2 OS=Iconisemion striatum OX=60296 GN=TTBK2 PE=4 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 1.229e-104
Identity = 184/300 (61.33%), Postives = 234/300 (78.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+ + +  D+ S GDV+++RWK+++K+GGGGFGEIYE +D + +  VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR M  G+FS+STTL+L  QIL++IE+IHS+GFLHRDIKPSNFA+G  A T R  YMLDFGLARQF   + + +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG +K  YDH   L+ LP+EF  FL HI  LDYF KPDY+++ ++    MKS  V ++D +DWE
Sbjct:    1 MSGAVEHTDILSVGDVVRDRWKVVRKIGGGGFGEIYEVLDQLSQATVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRTMTRGTFSVSTTLRLGKQILEAIESIHSVGFLHRDIKPSNFAMGRLASTCRCCYMLDFGLARQFT--NSNQEVRPPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFMVGQLPWRKIKDKEQVGNLKETYDHKLMLKHLPSEFGTFLDHILTLDYFTKPDYQLLMSVFEKAMKSHNVLENDPYDWE 298          
BLAST of Tau tubulin kinase vs. TrEMBL
Match: gnl|BL_ORD_ID|173478837 (tr|A0A1A8N2T4|A0A1A8N2T4_9TELE Tau tubulin kinase 2 (Fragment) OS=Nothobranchius pienaari OX=704102 GN=TTBK2 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 3.926e-104
Identity = 180/300 (60.00%), Postives = 233/300 (77.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+ + +  D+ S GDV+++RWK+ +K+GGGGFGEIYE +D + +  VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR M  G+FS+STTL+L  Q+L++IE+IHS+GFLHRDIKPSNFA+G  A T R  YMLDFGLARQF   + + +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKE VG++K  YDH   L+ LP EF  FL HI  LDY+ KPDY+++ ++  + MK+  V ++D +DWE
Sbjct:    1 MSGAVEHTDILSVGDVVRDRWKVARKIGGGGFGEIYEVLDQLSQATVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRTMTRGTFSVSTTLRLGKQMLEAIESIHSVGFLHRDIKPSNFAMGRLASTCRCCYMLDFGLARQFT--NSNQEVRPPRPVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFLVGQLPWRKIKDKEHVGKLKDTYDHRLMLKHLPAEFGVFLEHIFSLDYYTKPDYQLLMSVFDNSMKTYNVVENDPYDWE 298          
BLAST of Tau tubulin kinase vs. TrEMBL
Match: gnl|BL_ORD_ID|23850247 (tr|V3ZM49|V3ZM49_LOTGI Protein kinase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_133319 PE=4 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.875e-103
Identity = 181/294 (61.56%), Postives = 227/294 (77.21%), Query Frame = 3
Query:  153 DLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWELN 1034
            DL S   ++K+RWK++KK+GGGGFGEIYE  D + K+ VA+KLES+K PKQVL+MEV+VLKKLQG  H C+  G GRN+K++YV M+LQGKNLA+LRR    G F +STTL+L  QIL +IE+IH +GFLHRDIKPSNF++G      R VYMLDFGLARQ+   + S +VRPPR  AGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E I GQLPWR++KDKEQVG +K  YDH + L+++P+EF+  L HIQ+L+Y+ KPDY M+ NL   CM+ K +  SD++DWE N
Sbjct:    5 DLLSPNQLVKDRWKVLKKIGGGGFGEIYEATDLVNKECVALKLESAKQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKYNYVVMSLQGKNLAELRRGQPKGCFGLSTTLRLGSQILKAIESIHDVGFLHRDIKPSNFSMGKPPSNSRKVYMLDFGLARQYT--NASGEVRPPRAAAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFIVGQLPWRKIKDKEQVGLMKEKYDHIQLLKNMPSEFRAILEHIQKLEYYDKPDYNMLHNLFEQCMRRKNIKDSDAYDWEKN 296          
BLAST of Tau tubulin kinase vs. TrEMBL
Match: gnl|BL_ORD_ID|15737587 (tr|R7V2U7|R7V2U7_CAPTE Protein kinase domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_198680 PE=4 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 4.092e-103
Identity = 181/292 (61.99%), Postives = 221/292 (75.68%), Query Frame = 3
Query:  153 DLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            DL   G ++KERWK++KK+GGGGFGEIYE +D + K+ VA+KLES+K PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M+LQG+NLA+LRR    G F++ TTL+L  QIL  IE IHS+GFLHRDIKPSNFA+G     +  VYMLDFGLARQ+   +G  +VR PR  AGFRGTVRYAS++AH N EMGRHDDLWS FYM  E + GQLPWR+MKDKEQVG +K  YD   FL+ LP E KPFL HIQ LDY+ KPDY  ++ L+  CM+ K V + D +DWE
Sbjct:    5 DLLQVGHIVKERWKVVKKVGGGGFGEIYEALDMVSKESVALKLESAKQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMSLQGRNLAELRRNQSKGCFTVGTTLRLGTQILSGIEAIHSVGFLHRDIKPSNFAMGRLNNDKHKVYMLDFGLARQYTNTNG--EVRAPRAAAGFRGTVRYASLSAHKNKEMGRHDDLWSLFYMLVEFVMGQLPWRKMKDKEQVGNLKEKYDTGIFLKHLPAELKPFLEHIQSLDYYDKPDYNRLQGLLSQCMQRKGVKEDDPYDWE 294          
BLAST of Tau tubulin kinase vs. TrEMBL
Match: gnl|BL_ORD_ID|18205746 (tr|A0A267DEE2|A0A267DEE2_9PLAT Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022436g3 PE=4 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 4.282e-103
Identity = 184/300 (61.33%), Postives = 226/300 (75.33%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M S T E DL + G ++K+RW++ KK+GGGGFGEIYE  D + K+ VA+KLES+K  KQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQGKNLA+LRR    GSF++STT++L  QIL++IE IHSIGFLHRDIKPSNF++G      R V+MLDFGLARQ+   DG   VR PR  AGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVG+IK  YDH++ L+ LP+EF+PFL H+ +L YF KPDY  +  L+  C K K +  S+ FDWE
Sbjct:    1 MNSVTSEADLLAVGSLVKDRWQVTKKIGGGGFGEIYEAQDVLNKEPVALKLESAKQAKQVLKMEVAVLKKLQGKDHVCRFLGCGRNDRFNYVVMELQGKNLAELRRSQPRGSFTVSTTVRLGRQILEAIEAIHSIGFLHRDIKPSNFSMGRGEPNCRKVFMLDFGLARQYTNSDGD--VRAPRVTAGFRGTVRYASVNAHQNREMGRHDDLWSLFYMLVEFACGQLPWRKLKDKEQVGRIKETYDHSQMLRYLPSEFRPFLEHVSKLAYFDKPDYRYLCGLLDQCAKRKSIRLSEPFDWE 298          
BLAST of Tau tubulin kinase vs. Ensembl Cavefish
Match: ttbk1a (tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-100609-4])

HSP 1 Score: 344.739 bits (883), Expect = 3.372e-102
Identity = 194/369 (52.57%), Postives = 255/369 (69.11%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWELNXXXXXXXXXXXNIDTNMERRNSAIISTGTGPQIHVAKSSRQNNGDVQNHVAIEEFRNKPSKTVKESV 1235
            M  S+++ D+     ++K+RWK++KK+GGGGFGEIYE VD + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H CK  G GRNDKF+YV M LQG+NLADLRR    G+F++STTL+L  QIL++IE IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQ+   +G  +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVGQ+K  YDH   L+ +P+EF  FL H+  LDY+ KPDY+++ ++  + MK + +T+++ +DWE    + T   ++SN  T    R +A +  G           R+N  DV     + +  N P     ES 
Sbjct:   30 MNGSSEQQDILPPNCMVKDRWKVLKKIGGGGFGEIYEAVDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGRNDKFNYVVMQLQGRNLADLRRSQPRGTFTMSTTLRLGKQILEAIEAIHSVGFLHRDIKPSNFAMGRLPSTVRKCYMLDFGLARQYTNTNG--EVRPPRTVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGQVKERYDHRMLLKHMPSEFHVFLDHVLALDYYTKPDYQLLMSVFENSMKERIITENELYDWE---KTGTDTMLTSNSATQQHTRPTAAMVGGVNVTPVPGDLQRENTDDVLQDEHLSDQENAPPAGRPEST 393          
BLAST of Tau tubulin kinase vs. Ensembl Cavefish
Match: ttbk1b (tau tubulin kinase 1b [Source:ZFIN;Acc:ZDB-GENE-100609-5])

HSP 1 Score: 339.347 bits (869), Expect = 3.367e-100
Identity = 201/427 (47.07%), Postives = 277/427 (64.87%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWELNXXXXXXXXXXXNIDTNMERRNSAIISTGTGPQIHVAKSSRQNNGDVQNHVAIEEFRNKPSKTVKESVLKAKKSHLDMPDNGD--NGVSVGKSSYRHAVSNIAGKSEKSQNARNTMPPISPRSTFA 1403
            M  + ++ D+     ++KERWK++KK+GGGGFGEIYE +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG  H CK  G GRN+KF+YV M LQG+NLADLRR    G+FS+STTL+L  QIL+SIE IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQ+   +G  +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVGQIK  Y+H   L+ +P+EF  FL H+  LDY+ KPDY ++ ++  + MK +++T+++ FDWE     +     ++       R+ +AI+       +   +  R+N  DV     + +  N P   +     +A  +    P  G+  +     ++  R ++S     +E+ + A   + P+SPR   A
Sbjct:   14 MNGAGEQVDILPPNCMVKERWKVLKKIGGGGFGEIYEALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFSMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTNG--EVRPPRTVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFTVGQLPWRKIKDKEQVGQIKERYEHKMLLKHMPSEFYIFLDHVLGLDYYTKPDYLLLMSVFENSMKEREITENEPFDWEKAGTDSLSSNSTATPPQQNTRQTAAIVGVVNVTPM-TGELPRENTDDVLQDEHLSDQENAPPVLLPIRPCEAALA----PPGGEAWDDTDFNRNKLRISISKTQVTAEEDEQA-GVVRPVSPRGGEA 432          
BLAST of Tau tubulin kinase vs. Ensembl Cavefish
Match: ttbk2b (tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8246])

HSP 1 Score: 336.65 bits (862), Expect = 1.912e-97
Identity = 174/300 (58.00%), Postives = 224/300 (74.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+ + ++ D+ S G+V++ERW++    GG G    YE +D + +  VA+K+ES++ PKQVL+MEV+VLK+LQ   H C+  G GRND+F+YV M LQG+NLADLRR M  G+FS+STTL+L  QIL++IE+IHS+GFLHRDIKPSNFA+G  + T R  YMLDFGLARQF   +   +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG +K  YDH   L+ LP+EF  FL HI  LDYF KPDY+++ ++    MKS  V ++D +DWE
Sbjct:    1 MSGAAEQADILSVGNVVRERWRVKIGGGGFGEI--YEVLDQLNQCNVALKVESAQQPKQVLKMEVAVLKRLQ-KDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRTMSQGTFSVSTTLRLGRQILEAIESIHSVGFLHRDIKPSNFAMGRLSSTCRTCYMLDFGLARQFT--NSCQEVRPPRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFMVGQLPWRKVKDKEQVGNLKETYDHHLMLKHLPSEFIVFLEHISNLDYFTKPDYQLLMSVFEKSMKSYNVMENDPYDWE 295          
BLAST of Tau tubulin kinase vs. Ensembl Cavefish
Match: ttbk2b (tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8246])

HSP 1 Score: 293.123 bits (749), Expect = 1.585e-87
Identity = 162/300 (54.00%), Postives = 209/300 (69.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+ + ++ D+ S G+V++ERW++IKK+GGGGFGEIYE +D + +  VA+K+ES++ PKQVL+MEV+VLK+LQG  H C+  G GRND+F+YV M LQG+NLADLRR M  G+FS+STTL+L  QIL++IE+IHS+GFLHRDIKP                                     PR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG +K  YDH   L+ LP+EF  FL HI  LDYF KPDY+++ ++    MKS  V ++D +DWE
Sbjct:    1 MSGAAEQADILSVGNVVRERWRVIKKIGGGGFGEIYEVLDQLNQCNVALKVESAQQPKQVLKMEVAVLKRLQGKDHVCRFVGCGRNDRFNYVVMELQGRNLADLRRTMSQGTFSVSTTLRLGRQILEAIESIHSVGFLHRDIKP-------------------------------------PRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFMVGQLPWRKVKDKEQVGNLKETYDHHLMLKHLPSEFIVFLEHISNLDYFTKPDYQLLMSVFEKSMKSYNVMENDPYDWE 263          
BLAST of Tau tubulin kinase vs. Ensembl Cavefish
Match: csnk1g1 (casein kinase 1 gamma 1 [Source:NCBI gene;Acc:103023720])

HSP 1 Score: 132.88 bits (333), Expect = 2.611e-32
Identity = 83/261 (31.80%), Postives = 138/261 (52.87%), Query Frame = 3
Query:  267 VAIKLESSKLPKQVLRMEVSVLKKLQGTKHAC-KCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETR-RIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDW 1025
            VAIKLE  K     L +E    K L  T     + Y +G   K++ + + L G +L DL   +   +FS+ T L + +Q++  +E +HS   ++RD+KP NF IG     +  I++++DFGLA++++ P+    + P R+     GT RY S+N H   E  R DDL +  +MF   + G LPW+ +K        +++G  K N       ++ P E   +L +++ LD+F+KPDYE ++ L  +  + K  T   ++DW
Sbjct:   70 VAIKLEPVKSRAPQLHLEYRFYKTLGSTAEGLPQVYYFGPCGKYNAMVLELLGPSLEDLF-DLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHI-PYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTELFERKGYTFDYTYDW 328          
BLAST of Tau tubulin kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004926.1 (pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gene:ENSPMAG00000004461.1 transcript:ENSPMAT00000004926.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 262.692 bits (670), Expect = 4.443e-80
Identity = 129/225 (57.33%), Postives = 166/225 (73.78%), Query Frame = 3
Query:  354 HACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            H C+  G GRNDKF+YV M LQG+NLADLRR    G+FS+STTL+L  Q+L++IE+IH++GFLHRDIKPSNFA+G    T    +MLD+GLARQ+   + S +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVG IK  YDH   L+ +P +F  FL H+  LDY  +P+Y+ + +     M+ + +T+++ +DWE
Sbjct:    3 HVCRFIGCGRNDKFNYVVMQLQGRNLADLRRSQPRGTFSLSTTLRLGRQMLEAIESIHAVGFLHRDIKPSNFAMGRLPSTTHKCFMLDYGLARQYT--NSSGEVRPPRAVAGFRGTVRYASINAHRNKEMGRHDDLWSLFYMLVEFTVGQLPWRKIKDKEQVGLIKERYDHRLLLRHMPTDFHIFLDHVSTLDYCTRPNYQSIHSCALHIMRERSITENEPYDWE 225          
BLAST of Tau tubulin kinase vs. Ensembl Sea Lamprey
Match: csnk1g2a (casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6445])

HSP 1 Score: 136.732 bits (343), Expect = 1.863e-34
Identity = 84/262 (32.06%), Postives = 141/262 (53.82%), Query Frame = 3
Query:  261 DKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIG-GSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDW 1025
            + VAIKLE  K     L +E    K+L   +   + Y +G   K++ + + L G +L DL   + + +F++ T L + +Q+L  +E +HS   ++RD+KP NF IG  S   + I++++DFGLA++++ P+    + P R+     GT RY S+N H   E  R DDL +  +MF   + G LPW+ +K        +++G  K         ++ P E   +L +++ LD+F++PDYE M+NL  D  + K  +    FDW
Sbjct:   62 EYVAIKLEPMKSRAPQLHLEYRFYKQLGNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLF-DLCNRTFTLKTVLMIAIQLLTRMEYVHSRNLIYRDVKPENFLIGRQSTNKQHIIHIIDFGLAKEYIDPETKKHI-PYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFERPDYEYMRNLFMDLFERKGYSFDYEFDW 321          
BLAST of Tau tubulin kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008477.1 (pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gene:ENSPMAG00000007664.1 transcript:ENSPMAT00000008477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 3.490e-28
Identity = 85/261 (32.57%), Postives = 130/261 (49.81%), Query Frame = 3
Query:  261 DKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDW 1025
            ++VAIKLE  K     L +E  + K LQG          G    ++ + M L G ++ DL     S  FS+ T L L  Q++  IE +HS  F+HRDIKP NF +G   +   +VY++D GLA+++     + Q  P R+     GT RYAS+N H  +E  R DDL S  Y+      G LPW+ +K        E++ + K++       ++ P+EF  +L   + L +  KPDY  ++ L R+    +  +    FDW
Sbjct:   34 EEVAIKLECVKTKHPQLHIESKIYKLLQGGVGIPVIKWCGAEGDYNVMVMELLGPSMEDLF-NFCSRKFSLKTVLLLADQMISRIEYLHSKNFIHRDIKPDNFLMG-LGKKGNLVYIIDLGLAKKYR-DSRTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEMLCKTYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDW 291          
BLAST of Tau tubulin kinase vs. Ensembl Sea Lamprey
Match: csnk1g1 (casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494092])

HSP 1 Score: 93.5893 bits (231), Expect = 2.271e-21
Identity = 61/189 (32.28%), Postives = 104/189 (55.03%), Query Frame = 3
Query:  261 DKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRI-VYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMK 824
            + VAIKLE  K     L +E    K+L   +   + Y +G   K++ + + L G +L DL   +   +FS+ T L + +Q++  +E +HS   ++RD+KP NF +G    ++   ++++DFGLA++++ P+    + P R+     GT RY S+N H   E  R DDL +  +MF   + G LPW+ +K
Sbjct:   56 EYVAIKLEPMKSRAPQLHLEYRFYKQLGNAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLF-DLCDRTFSLKTVLMIAMQLISRMEYVHSRSLIYRDVKPENFLVGRQGTSKHHNIHIIDFGLAKEYIDPETKKHI-PYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLK 242          
BLAST of Tau tubulin kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001691.1 (pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1 gene:ENSPMAG00000001522.1 transcript:ENSPMAT00000001691.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 5.102e-16
Identity = 59/169 (34.91%), Postives = 91/169 (53.85%), Query Frame = 3
Query:  234 YECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVE 740
            Y  ++    ++VA+KLES K     L  E  + K LQG         YG+   ++ + M L G +L DL     S  F++ T L L  Q++  IE +H+  F+HRDIKP NF +G      ++ +++DFGLA+++   + + Q  P R+     GT RYAS+NAH  +E
Sbjct:   32 YLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLF-NFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGIGRHCNKL-FLIDFGLAKKY-RDNRTRQHIPYREDKNLTGTARYASINAHLGIE 197          
BLAST of Tau tubulin kinase vs. Ensembl Yeast
Match: HRR25 (Conserved casein kinase; regulates diverse events including: vesicular traffic, DNA repair, the CVT pathway, monopolar attachment of sister kinetochores at meiosis I, and ribosomal subunit biogenesis; monopolin subunit; binds the RNAPII CTD; phosphorylates COPII coat subunits; interacts with Sit4p phosphatase; antagonizes calcineurin signaling, reducing nuclear accumulation of Crz1p; phosphorylates Dsn1p, the kinetochore receptor for monopolin; homolog of mammalian CK1delta [Source:SGD;Acc:S000006125])

HSP 1 Score: 114.39 bits (285), Expect = 9.844e-27
Identity = 85/272 (31.25%), Postives = 132/272 (48.53%), Query Frame = 3
Query:  234 YECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWEL 1031
            Y   + I  ++VAIKLES +     L  E  V + L G         +GR  +++ + + L G +L DL        FS  T + L LQ+   I+ IH   F+HRDIKP NF +G        V+++DFGL++++   +    + P R+     GT RYAS+N H  +E  R DDL S  Y+      G LPW+ +K        +++ + KLN         LP EF+ ++A+ + L + +KPDY  +  L +D     +      FDW +
Sbjct:   24 YHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHR-RFSFKTVIMLALQMFCRIQYIHGRSFIHRDIKPDNFLMG-VGRRGSTVHVIDFGLSKKYRDFNTHRHI-PYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETLCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTM 292          
BLAST of Tau tubulin kinase vs. Ensembl Yeast
Match: YCK1 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck2p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK1 has a paralog, YCK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001177])

HSP 1 Score: 114.39 bits (285), Expect = 1.163e-26
Identity = 83/272 (30.51%), Postives = 136/272 (50.00%), Query Frame = 3
Query:  234 YECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIG--GSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDW 1025
            +E  + I    VAIK E  K     LR E    K L GT +    Y +G+    + + + L G +L DL        FS+ T +Q+ +Q++  IE++H+   ++RDIKP NF IG  G  +   I +++DFG+A+Q+  P     + P R+     GT RY S+N H   E  R DD+ +  ++F+  + G LPW+ +K        E++G+ K + +     Q LP +F  +L  ++ L + + PDYE  + L+   +     T    +DW
Sbjct:   84 FEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNIPYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGR-KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANNI-HLIDFGMAKQYRDPKTKQHI-PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQGLPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDW 352          
BLAST of Tau tubulin kinase vs. Ensembl Yeast
Match: YCK2 (Palmitoylated plasma membrane-bound casein kinase I (CK1) isoform; shares redundant functions with Yck1p in morphogenesis, proper septin assembly, endocytic trafficking, and glucose sensing; stabilized by Sod1p binding in the presence of glucose and oxygen, causing glucose repression of respiratory metabolism; involved in the phosphorylation and regulation of glucose sensor Rgt2p; YCK2 has a paralog, YCK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005098])

HSP 1 Score: 113.62 bits (283), Expect = 2.775e-26
Identity = 85/277 (30.69%), Postives = 139/277 (50.18%), Query Frame = 3
Query:  234 YECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADL-----RRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIG--GSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDW 1025
            +E  + I    VAIK E  K     L+ E    K L GT    + Y +G+    + + + L G +L DL     RR      FS+ T +Q+ +Q++  IE++H+   ++RDIKP NF IG  G  +  + V+++DFG+A+Q+  P     + P R+     GT RY S+N H   E  R DD+ +  ++F+  + GQLPW+ +K        E++G+ K   +     Q LP +F  +L  ++ L + + PDYE  + L+   +     T    +DW
Sbjct:   91 FEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRR------FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANK-VHLIDFGMAKQYRDPKTKQHI-PYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYDW 359          
BLAST of Tau tubulin kinase vs. Ensembl Yeast
Match: YCK3 (Palmitoylated vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of Vps41p; shares essential functions with Hrr25p; regulates vesicle fusion in AP-3 pathway [Source:SGD;Acc:S000000925])

HSP 1 Score: 106.686 bits (265), Expect = 3.855e-24
Identity = 80/283 (28.27%), Postives = 130/283 (45.94%), Query Frame = 3
Query:  252 IVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIG-----------------GSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMK------DKEQVGQI--KLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDW 1025
            +  + VAIK E        LR E    + L G       Y +G+    + + + L G +L DL  +     FS+ TT  +  Q++D +  IH    ++RDIKP NF I                   S     ++YM+DFG+A+Q+  P     + P R+     GT RY S+N H   E  R DDL S  ++F+  + G LPW+ +K        E++G    KLN D      ++P +F  +L + + L + + PDY+ + +L+ D ++   +     +DW
Sbjct:   52 MANEPVAIKFEPRHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLF-EWCGRKFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNNDPNLIYMVDFGMAKQYRDPRTKQHI-PYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLKFDEDPDYDYLISLMDDALRLNDLKDDGHYDW 332          
BLAST of Tau tubulin kinase vs. Ensembl Yeast
Match: MPS1 (Dual-specificity kinase; autophosphorylation required for function; required for spindle pole body (SPB) duplication and spindle checkpoint function; contributes to bi-orientation by promoting formation of force-generating kinetochore-microtubule attachments in meiosis I; substrates include SPB proteins Spc42p, Spc110p, and Spc98p, mitotic exit network protein Mob1p, kinetochore protein Cnn1p, and checkpoint protein Mad1p; substrate of APCC(Cdh1); similar to human Mps1p [Source:SGD;Acc:S000002186])

HSP 1 Score: 58.5362 bits (140), Expect = 7.232e-9
Identity = 52/227 (22.91%), Postives = 96/227 (42.29%), Query Frame = 3
Query:  318 EVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPD-----------GSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMK 965
            E+ +L+KL+  K   +   Y   D   Y+ M     +L+ +  Q        +     T ++L  I+ +H  G +H D+KP+NF +      + I+ ++DFG+A    +P+           G+     P  +     T    + +  N  ++GR  D+WS   + Y+MI G+ P+   + + ++  I +N          P+   PF  H    +   K   E+MK
Sbjct:  486 EIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-----VKGILKIIDFGIAN--AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI-MN----------PDVKIPFPEHTSNNEKIPKSAIELMK 694          
BLAST of Tau tubulin kinase vs. Ensembl Nematostella
Match: EDO46789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP40])

HSP 1 Score: 323.553 bits (828), Expect = 2.211e-100
Identity = 177/292 (60.62%), Postives = 217/292 (74.32%), Query Frame = 3
Query:  153 DLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            DL   GDV+++RWKIIKK+GGGGFGEIY  +D + KD VAIKLES    KQVL+MEV+VLKKLQG  H CK    GRN+ F+Y+ M+LQG NLA+LRR    G FS ST L+L  QIL S+++IH  GFLHRDIKPSNFA+G + +T  I YMLDFGL+RQF   +G  +VRPPR+ AGFRGTVRYAS+NAH N EMGRHDDLWS FY+  E   GQLPWR+MKDKEQVG++K  YD    L+S+P EFK F+ HI +L Y  KPDY+M+  L+   +K K + +SD +DWE
Sbjct:    3 DLLKPGDVVRQRWKIIKKIGGGGFGEIYRGLDQVTKDYVAIKLESVHQSKQVLKMEVAVLKKLQGVDHICKFISCGRNESFNYLVMSLQGSNLAELRRSQPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIKPSNFAMGNTPDTVHICYMLDFGLSRQFTKANG--EVRPPRNTAGFRGTVRYASINAHENKEMGRHDDLWSFFYLMVEFTVGQLPWRKMKDKEQVGKMKKTYDIANLLKSMPGEFKQFVDHISKLKYEDKPDYKMLLGLLEQIIKRKGIKESDPYDWE 292          
BLAST of Tau tubulin kinase vs. Ensembl Nematostella
Match: EDO34289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPP6])

HSP 1 Score: 133.265 bits (334), Expect = 1.040e-32
Identity = 87/262 (33.21%), Postives = 138/262 (52.67%), Query Frame = 3
Query:  261 DKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIG-GSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDW 1025
            + VAIKLE  K     L +E    K L   +   + + +G   K++ + M L G +L DL   + +  FS+ T L + LQ++  IE +HS   ++RDIKP NF IG  SA   + + ++DFGLA++++ P+    + P R+     GT RY S+N H   E  R DDL +  +MF   + G LPW+ +K        +++G  K         ++ P E   +L +++ LD+F+ PDYE ++ L RD M+ K   +   FDW
Sbjct:   70 EHVAIKLEPMKSRAPQLHLEYRFYKALGNAEGIPQVHYFGPCGKYNALVMELLGPSLEDLF-DLCNRQFSLKTVLMVALQLISRIEYVHSKNMIYRDIKPENFLIGRKSAGKEKTINIIDFGLAKEYIDPETKKHI-PYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENHPEEMATYLRYVRRLDFFETPDYEYLRKLFRDLMERKGYVEDFEFDW 329          
BLAST of Tau tubulin kinase vs. Ensembl Nematostella
Match: EDO34742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG2])

HSP 1 Score: 124.405 bits (311), Expect = 3.011e-30
Identity = 89/263 (33.84%), Postives = 131/263 (49.81%), Query Frame = 3
Query:  261 DKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWEL 1031
            ++VAIKLE  K     L +E    K +QG          G    ++ + M L G +L DL     +  FSI T L L  Q +  IE +HS  F+HRDIKP NF +G   +   +VY++DFGLA+++  P  + Q  P R+     GT RYAS+N H  +E  R DDL S  Y+      G LPW+ +K        E++ + K++       +  P+EF  +L + + L +  KPDY  ++ L R+    +  T    FDW L
Sbjct:   33 EEVAIKLECVKTKHPQLHIEAKFYKMMQGGVGIPTIKWCGTEGDYNVLVMELLGPSLEDLF-NFCNRKFSIKTVLLLADQTISRIEYVHSKNFIHRDIKPDNFLMG-LGKKGNLVYIIDFGLAKKYRDPR-THQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGFPSEFATYLNNCRSLRFDDKPDYSYLRQLFRNLFHRQGYTYDYVFDWNL 292          
BLAST of Tau tubulin kinase vs. Ensembl Nematostella
Match: EDO46523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ6])

HSP 1 Score: 114.005 bits (284), Expect = 3.599e-27
Identity = 83/272 (30.51%), Postives = 134/272 (49.26%), Query Frame = 3
Query:  234 YECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWEL 1031
            Y  ++    ++VA+KLES K     L  E  + K LQG         YG+   ++ + M L G +L DL     S  F++ T L L  Q++  IE +H+  F+HRDIKP NF +G      ++ +++DFGLA+++     + Q  P R+     GT RYAS+NAH  +E  R DD+ S  Y+        LPW+ +K        E++ + K++       +  P EF  +L + + L + + PDY  ++ L R   ++        FDW +
Sbjct:   34 YLAINTTNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPSVRYYGQERDYNVLVMELLGPSLEDLF-NFCSRRFTMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGVGKHCNKL-FLIDFGLAKKY-RDSRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNYQYDYIFDWTM 302          
BLAST of Tau tubulin kinase vs. Ensembl Nematostella
Match: EDO48738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM1])

HSP 1 Score: 103.605 bits (257), Expect = 9.926e-24
Identity = 80/270 (29.63%), Postives = 130/270 (48.15%), Query Frame = 3
Query:  234 YECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDW 1025
            Y CV     ++ A+KLES K     L  E  + K L G         + + + ++ + M L G +L DL     +  F++ T L L  Q++  IE +H+  F+HRDIKP NF +G      ++ Y++DFGLA+++     + Q    R+     GT RYAS+NAH  +E  R DD+ S  Y+        LPW+ +K        E++ + K++       +  P EF  +L + + L + + PDY  ++ L R   ++        FDW
Sbjct:   29 YLCVHTENGEEKAVKLESQKARHPQLLYESKLYKILAGGSGIPAIRHFSQENDYNVLVMDLLGPSLEDLF-NFCNRKFNMKTVLMLADQMIARIEYVHNKNFIHRDIKPDNFLMGIGRHCNKL-YLIDFGLAKKYR-DSRTKQHISYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRSNLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFSMYLNYCKGLRFEEAPDYMYLRQLFRILFRTLNHQYDYIFDW 295          
BLAST of Tau tubulin kinase vs. Ensembl Medaka
Match: ttbk2a (tau tubulin kinase 2 [Source:NCBI gene;Acc:101174145])

HSP 1 Score: 326.635 bits (836), Expect = 2.419e-92
Identity = 180/302 (59.60%), Postives = 229/302 (75.83%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQ-GKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKP-SNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   +  D+ S   ++KERWK+++K+GGGGFGEIYE +D + +  VA+K+ES++ PKQVL+MEV+VLKKLQ   H C+  G GRND+F+YV M LQ G+NLADLRR M  G+FSISTTL+L  QIL++IE+IHS+GFLHRDIKP SNFA+G    T R  YMLDFGLARQF   +   +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++K+KEQVG++K  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + MK+  V ++D +DWE
Sbjct:    1 MSGGVEPADILSVLSLVKERWKVVRKIGGGGFGEIYEAMDLLTRASVALKVESAQQPKQVLKMEVAVLKKLQ-KDHICRFVGCGRNDRFNYVVMELQQGRNLADLRRSMPRGTFSISTTLRLGHQILEAIESIHSVGFLHRDIKPQSNFAMGRFPSTCRTCYMLDFGLARQFT--NSCQEVRPPRPVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFLVGQLPWRKIKEKEQVGKLKETYDHCLMLRHLPAEFGVFLDHISNLDYFTKPDYQLLMSVFDNSMKTYNVVENDPYDWE 299          
BLAST of Tau tubulin kinase vs. Ensembl Medaka
Match: ttbk1a (tau tubulin kinase 1 [Source:NCBI gene;Acc:105354132])

HSP 1 Score: 306.99 bits (785), Expect = 5.886e-89
Identity = 169/304 (55.59%), Postives = 225/304 (74.01%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGT----KHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M  ++++ D+     ++K+RWK++KK+GGGGFGEIYE +D + ++ VA+K+ES++ PKQVL+MEV+VLKKLQG     +H      +  N  F +V +  QG+NLADLRR    G+F++STTL+L  QIL+SIE IHS+GFLHRDIKPSNFA+G    T R  YMLDFGLARQ+   +G  +VRPPR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E   GQLPWR++KDKEQVGQIK  +DH   L+ +P+EF  FL H+  LDY+ KPDY+++ ++  + MK + +T+++ FDWE
Sbjct:   14 MNGTSEQADILPPNCMVKDRWKVLKKIGGGGFGEIYEALDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGETLLHEHEDPVVSFLGNKLFFFVWLA-QGRNLADLRRSQPRGTFTMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTNG--EVRPPRTVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGQIKERFDHKMLLKHMPSEFSIFLDHVLALDYYTKPDYQLLMSVFENSMKERIITENEPFDWE 314          
BLAST of Tau tubulin kinase vs. Ensembl Medaka
Match: ttbk2b (tau-tubulin kinase 2 [Source:NCBI gene;Acc:101157747])

HSP 1 Score: 292.352 bits (747), Expect = 3.380e-87
Identity = 162/300 (54.00%), Postives = 205/300 (68.33%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M       D+ + GDV+++RWK+I+K+GGGGFGEIYE +D + +  VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR M  G+FS+STTL+L  QIL++IE+IHS+GFLHRDIKP                                     PR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++KDKEQVG +K  YDH   L+ LP+EF  FL HI  LDYF KPDY+++ ++    MKS  V ++D +DWE
Sbjct:    1 MNGGVDHTDILTVGDVVRDRWKVIRKIGGGGFGEIYEVLDQLSQATVALKVESAQQPKQVLKMEVAVLKKLQGKNHVCRFVGCGRNDRFNYVVMELQGRNLADLRRTMSRGTFSVSTTLRLGKQILEAIESIHSVGFLHRDIKP-------------------------------------PRPVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFMVGQLPWRKIKDKEQVGNLKETYDHRLMLKHLPSEFSTFLDHIMTLDYFTKPDYQLLTSMFDSAMKSHNVLENDPYDWE 263          
BLAST of Tau tubulin kinase vs. Ensembl Medaka
Match: ttbk2a (tau tubulin kinase 2 [Source:NCBI gene;Acc:101174145])

HSP 1 Score: 285.804 bits (730), Expect = 7.705e-85
Identity = 160/300 (53.33%), Postives = 206/300 (68.67%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M+   +  D+ S   ++KERWK+++K+GGGGFGEIYE +D + +  VA+K+ES++ PKQVL+MEV+VLKKLQG  H C+  G GRND+F+YV M LQG+NLADLRR M  G+FSISTTL+L  QIL++IE+IHS+GFLHRDIKP                                     PR VAGFRGTVRYAS+NAH N EMGRHDDLWS FYM  E + GQLPWR++K+KEQVG++K  YDH   L+ LP EF  FL HI  LDYF KPDY+++ ++  + MK+  V ++D +DWE
Sbjct:    1 MSGGVEPADILSVLSLVKERWKVVRKIGGGGFGEIYEAMDLLTRASVALKVESAQQPKQVLKMEVAVLKKLQGKDHICRFVGCGRNDRFNYVVMELQGRNLADLRRSMPRGTFSISTTLRLGHQILEAIESIHSVGFLHRDIKP-------------------------------------PRPVAGFRGTVRYASVNAHKNKEMGRHDDLWSLFYMLVEFLVGQLPWRKIKEKEQVGKLKETYDHCLMLRHLPAEFGVFLDHISNLDYFTKPDYQLLMSVFDNSMKTYNVVENDPYDWE 263          
BLAST of Tau tubulin kinase vs. Ensembl Medaka
Match: csnk1g1 (casein kinase 1 gamma 1 [Source:NCBI gene;Acc:101164710])

HSP 1 Score: 132.109 bits (331), Expect = 3.654e-32
Identity = 81/260 (31.15%), Postives = 139/260 (53.46%), Query Frame = 3
Query:  267 VAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRR-IVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDK------EQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDW 1025
            VAIKLE  K     L +E    K L  ++   + + +G   K++ + + L G +L DL   +   +FS+ T L + +Q++  +E +HS   ++RD+KP NF IG     +  I++++DFGLA++++ P+    + P R+     GT RY S+N H   E  R DDL +  +MF   + G LPW+ +K        +++G  K N       ++ P E   +L +++ LD+F+KPDYE ++ L  +  + K  T   ++DW
Sbjct:   77 VAIKLEPVKSRAPQLHLEYRFYKTLGTSEGVPQVFYFGPCGKYNAMVLELLGPSLEDLF-DLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHIIHIIDFGLAKEYIDPETKKHI-PYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYEYLRALFTELFERKGYTFDYTYDW 334          
BLAST of Tau tubulin kinase vs. Planmine SMEST
Match: SMESG000026133.1 (SMESG000026133.1)

HSP 1 Score: 2329.29 bits (6035), Expect = 0.000e+0
Identity = 1333/1333 (100.00%), Postives = 1333/1333 (100.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWELNXXXXXXXXXXXNIDTNMERRNSAIISTGTGPQIHVAKSSRQNNGDVQNHVAIEEFRNKPSKTVKESVLKAKKSHLDMPDNGDNGVSVGKSSYRHAVSNIAGKSEKSQNARNTMPPISPRSTFANQKEKMFDIKFSEEIETPRNAVQSEITSHEKHSSVIDSHXXXXXXXXXXEPELVNKPSRLPVLMKTXXXXXXXXXXEYEPDQPFFQNHKTTEDSVLFADNYETNFESENQKHRGISAALAVVPNSMKVTGNLPPKPATSSTPSNLVKNTEKLNKNSINLRGNFLQSVGGSVATHAVNDDQFDVSNAPDATKAVLLSNQXXXXXXXXXXXLSDHFEDDKYHVNQFKQQESDTKENTATKDSKLNGQIKPQSYISSGDNLSTTNHNDSSKRSRRQPMIVTEKSSAKIQAQLADKSRASSSILSRLNNQEEDSSNCKSKESHEMEMTLSKAKTTTTSGYISSVSKYDVNQKPSYEAIGQSGDDKNHNYLSQRHPYYGVVDSTSCSASANVLSHKHNNEMQKSNSNISRLPPKSSEQRYKVNKYSTNQDTSDLSISRSSRRNGASKSNHQNSSSNPKSGFHISSKDSANKHNYYDLKRSSNLQFSNHHTFQNLNHSDHGVIVSQGTYNSSNHHNSRRDPSNFNNHQSDLKLGMKDHSSSSRTFDSYRDSDRPTPKPRSHHRSQSHTNREVANSIINGHGDSTIIRQKXXXXXXXXXXXXXXXXXXXXXXHSFDRYNLXXXXXXXXXXXXXXNNKKPNPTSSGSQKPVVCKHXXXXXXXXXXXXXXXXDCVQCQNYGVKKCTTHYSQKXXXXXXXXXXXXXXXXANSLTRSGSIVMKSKSDLNLSMAGLIQNRHSGKGQRSSHGKAQHXXXXXXXXXXXXTAKNYSTSPNHRTDSSIHRXXXXXXXXXXXADLLNHYLRHSKTLSNSNMQNKSSKPHQHVQSSSNSILKPKPKPNPHGQYNNMSTSTSVTSGIHRHVYKKXXXXXXXXXXXXXXXXTTSTTNQANSSFNPKPPSSGKYHQTHVFRNRQYTSTK 4127
            MTSSTQEPDLASEGDVIKERWKIIKKLGGGGFGEIYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFSISTTLQLTLQILDSIENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWELNSVSTTPVTVSSNIDTNMERRNSAIISTGTGPQIHVAKSSRQNNGDVQNHVAIEEFRNKPSKTVKESVLKAKKSHLDMPDNGDNGVSVGKSSYRHAVSNIAGKSEKSQNARNTMPPISPRSTFANQKEKMFDIKFSEEIETPRNAVQSEITSHEKHSSVIDSHNRSASRRNRREPELVNKPSRLPVLMKTSSSDSNNKSNEYEPDQPFFQNHKTTEDSVLFADNYETNFESENQKHRGISAALAVVPNSMKVTGNLPPKPATSSTPSNLVKNTEKLNKNSINLRGNFLQSVGGSVATHAVNDDQFDVSNAPDATKAVLLSNQECDDDDEDNCNLSDHFEDDKYHVNQFKQQESDTKENTATKDSKLNGQIKPQSYISSGDNLSTTNHNDSSKRSRRQPMIVTEKSSAKIQAQLADKSRASSSILSRLNNQEEDSSNCKSKESHEMEMTLSKAKTTTTSGYISSVSKYDVNQKPSYEAIGQSGDDKNHNYLSQRHPYYGVVDSTSCSASANVLSHKHNNEMQKSNSNISRLPPKSSEQRYKVNKYSTNQDTSDLSISRSSRRNGASKSNHQNSSSNPKSGFHISSKDSANKHNYYDLKRSSNLQFSNHHTFQNLNHSDHGVIVSQGTYNSSNHHNSRRDPSNFNNHQSDLKLGMKDHSSSSRTFDSYRDSDRPTPKPRSHHRSQSHTNREVANSIINGHGDSTIIRQKNNYYTSSINNMNNNLSPNDMNDHSFDRYNLRPRSSSRESISKYSNNKKPNPTSSGSQKPVVCKHNSSPSRRRSTSFNNNNDCVQCQNYGVKKCTTHYSQKNNSNLVLNTNSSGVLVANSLTRSGSIVMKSKSDLNLSMAGLIQNRHSGKGQRSSHGKAQHSSQSPSVVSQYSTAKNYSTSPNHRTDSSIHRSLTSSINRSSSADLLNHYLRHSKTLSNSNMQNKSSKPHQHVQSSSNSILKPKPKPNPHGQYNNMSTSTSVTSGIHRHVYKKVIREDSVDSDISVSHITTSTTNQANSSFNPKPPSSGKYHQTHVFRNRQYTSTK
Sbjct:    1 MTSSTQEPDLASEGDVIKERWKIIKKLGGGGFGEIYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFSISTTLQLTLQILDSIENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWELNSVSTTPVTVSSNIDTNMERRNSAIISTGTGPQIHVAKSSRQNNGDVQNHVAIEEFRNKPSKTVKESVLKAKKSHLDMPDNGDNGVSVGKSSYRHAVSNIAGKSEKSQNARNTMPPISPRSTFANQKEKMFDIKFSEEIETPRNAVQSEITSHEKHSSVIDSHNRSASRRNRREPELVNKPSRLPVLMKTSSSDSNNKSNEYEPDQPFFQNHKTTEDSVLFADNYETNFESENQKHRGISAALAVVPNSMKVTGNLPPKPATSSTPSNLVKNTEKLNKNSINLRGNFLQSVGGSVATHAVNDDQFDVSNAPDATKAVLLSNQECDDDDEDNCNLSDHFEDDKYHVNQFKQQESDTKENTATKDSKLNGQIKPQSYISSGDNLSTTNHNDSSKRSRRQPMIVTEKSSAKIQAQLADKSRASSSILSRLNNQEEDSSNCKSKESHEMEMTLSKAKTTTTSGYISSVSKYDVNQKPSYEAIGQSGDDKNHNYLSQRHPYYGVVDSTSCSASANVLSHKHNNEMQKSNSNISRLPPKSSEQRYKVNKYSTNQDTSDLSISRSSRRNGASKSNHQNSSSNPKSGFHISSKDSANKHNYYDLKRSSNLQFSNHHTFQNLNHSDHGVIVSQGTYNSSNHHNSRRDPSNFNNHQSDLKLGMKDHSSSSRTFDSYRDSDRPTPKPRSHHRSQSHTNREVANSIINGHGDSTIIRQKNNYYTSSINNMNNNLSPNDMNDHSFDRYNLRPRSSSRESISKYSNNKKPNPTSSGSQKPVVCKHNSSPSRRRSTSFNNNNDCVQCQNYGVKKCTTHYSQKNNSNLVLNTNSSGVLVANSLTRSGSIVMKSKSDLNLSMAGLIQNRHSGKGQRSSHGKAQHSSQSPSVVSQYSTAKNYSTSPNHRTDSSIHRSLTSSINRSSSADLLNHYLRHSKTLSNSNMQNKSSKPHQHVQSSSNSILKPKPKPNPHGQYNNMSTSTSVTSGIHRHVYKKVIREDSVDSDISVSHITTSTTNQANSSFNPKPPSSGKYHQTHVFRNRQYTSTK 1333          
BLAST of Tau tubulin kinase vs. Planmine SMEST
Match: SMESG000030545.1 (SMESG000030545.1)

HSP 1 Score: 380.948 bits (977), Expect = 2.251e-111
Identity = 195/300 (65.00%), Postives = 243/300 (81.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M S+ QE DL +  +++K+RWK+I+KLGGGGFGEIYEC+D   ++KVA+KLESS++ KQVL+MEV+VLKKLQGT H CK  G GRND+F+YVAMTLQGKNLADLRR  K+ +FSIST L+L+ QIL SI++IH+ GFLHRDIKPSNF++G    +   V MLDFGLARQ++LPDG+  +R PR V GFRGTVRYAS+NAH N EMGRHDDLWSAFYM  EM+TG LPWR++KDK+QVGQIK N++HT+ L+ LP+EFK  L+HIQ L YF  PDYE +KNLI  CM+ K ++  + FDWE
Sbjct:    1 MPSTKQETDLLNPSNIVKDRWKVIRKLGGGGFGEIYECLDSHTQEKVALKLESSRIAKQVLKMEVAVLKKLQGTAHVCKFLGCGRNDRFNYVAMTLQGKNLADLRRAQKNSAFSISTMLRLSAQILQSIQDIHNSGFLHRDIKPSNFSMGRLPLSSHTVVMLDFGLARQYILPDGNGDIRAPRPVTGFRGTVRYASVNAHMNREMGRHDDLWSAFYMMAEMVTGSLPWRKLKDKDQVGQIKQNFEHTQLLRHLPSEFKLLLSHIQSLTYFDAPDYEYLKNLIYQCMRRKGISSDELFDWE 300          
BLAST of Tau tubulin kinase vs. Planmine SMEST
Match: SMESG000048011.1 (SMESG000048011.1)

HSP 1 Score: 357.836 bits (917), Expect = 5.519e-110
Identity = 187/300 (62.33%), Postives = 237/300 (79.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M S +   DL   G+V+K+RW++I+K+GGGGFGEIYE  D   +D+VA+KLESS+ PKQVL+MEV+VLKK+QG +H+C+  G GRND+F+Y+ M+LQG+NLA+LRR    G FS+ST L+L  QILDSIE IH +GFLHRD+KPSNFA+G   +T RIVY+LDFGL+RQ++  D   +VR PR +AGFRGTVRYAS NAH N EMGRHDDLWS FYM  EM+TGQLPWR++KDKEQVGQIK ++DHT  L+ LP+EF+ FL H+Q L YF  PDY M++NL  +CM  K+V +SD FDWE
Sbjct:    1 MGSESDSSDLLQAGNVVKDRWRVIRKIGGGGFGEIYEAFDEATQDRVALKLESSRQPKQVLKMEVAVLKKIQGREHSCRFVGCGRNDRFNYLVMSLQGRNLAELRRNTPRGIFSVSTMLKLGRQILDSIETIHMVGFLHRDVKPSNFAMGRLPQTARIVYILDFGLSRQYLNVDD--EVRTPRPIAGFRGTVRYASTNAHMNREMGRHDDLWSMFYMLVEMVTGQLPWRKLKDKEQVGQIKQSFDHTILLRHLPSEFRLFLEHVQSLTYFDSPDYTMLRNLFDECMLRKRVHESDLFDWE 298          
BLAST of Tau tubulin kinase vs. Planmine SMEST
Match: SMESG000030545.1 (SMESG000030545.1)

HSP 1 Score: 379.407 bits (973), Expect = 1.282e-109
Identity = 195/300 (65.00%), Postives = 243/300 (81.00%), Query Frame = 3
Query:  129 MTSSTQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE 1028
            M S+ QE DL +  +++K+RWK+I+KLGGGGFGEIYEC+D   ++KVA+KLESS++ KQVL+MEV+VLKKLQGT H CK  G GRND+F+YVAMTLQGKNLADLRR  K+ +FSIST L+L+ QIL SI++IH+ GFLHRDIKPSNF++G    +   V MLDFGLARQ++LPDG+  +R PR V GFRGTVRYAS+NAH N EMGRHDDLWSAFYM  EM+TG LPWR++KDK+QVGQIK N++HT+ L+ LP+EFK  L+HIQ L YF  PDYE +KNLI  CM+ K ++  + FDWE
Sbjct:    1 MPSTKQETDLLNPSNIVKDRWKVIRKLGGGGFGEIYECLDSHTQEKVALKLESSRIAKQVLKMEVAVLKKLQGTAHVCKFLGCGRNDRFNYVAMTLQGKNLADLRRAQKNSAFSISTMLRLSAQILQSIQDIHNSGFLHRDIKPSNFSMGRLPLSSHTVVMLDFGLARQYILPDGNGDIRAPRPVTGFRGTVRYASVNAHMNREMGRHDDLWSAFYMMAEMVTGSLPWRKLKDKDQVGQIKQNFEHTQLLRHLPSEFKLLLSHIQSLTYFDAPDYEYLKNLIYQCMRRKGISSDELFDWE 300          
BLAST of Tau tubulin kinase vs. Planmine SMEST
Match: SMESG000068893.1 (SMESG000068893.1)

HSP 1 Score: 345.125 bits (884), Expect = 1.784e-101
Identity = 184/298 (61.74%), Postives = 227/298 (76.17%), Query Frame = 3
Query:  138 STQEPDLASEGDVIKERWXXXXXXXXXXXXXXYECVDPIVKDKVAIKLESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKNLADLRRQMKSGSFXXXXXXXXXXXXXXXXENIHSIGFLHRDIKPSNFAIGGSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAHNNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFLQSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWEL 1031
            ++   DL   G +IKERW++ KK+GGGGFG+IYE +D   ++KVA+KLES++  KQVL+MEV+VLKKLQG  H C+ YG GRNDKF+YV M+LQGKNL +LRR    G FSIS+ ++LT Q+L+ IE+IHS+GFLHRDIKPSNFA+G    T R VYMLDFGLARQ+V  DG  +VRPPR VAGFRGTVRYAS NAH N E+GRHDDLWS  Y+  EM+TGQLPWR++KDKEQVG++K N DH   L+ +P EFK  L HIQEL YF KPDY  ++NL+   M  K    +D FDWE+
Sbjct:    5 TSDSSDLLEPGYIIKERWRVNKKIGGGGFGQIYEAIDLSSQEKVALKLESAQQSKQVLKMEVAVLKKLQGLDHVCRFYGCGRNDKFNYVVMSLQGKNLGELRRATSKGIFSISSMVRLTKQMLECIESIHSVGFLHRDIKPSNFAMGRLPSTFRKVYMLDFGLARQYVNTDG--EVRPPRPVAGFRGTVRYASANAHFNKELGRHDDLWSLLYLAVEMVTGQLPWRKVKDKEQVGKLKQNVDHNLLLRHMPLEFKQILDHIQELHYFAKPDYSKLQNLLDQTMARKLFKFTDPFDWEI 300          
The following BLAST results are available for this feature:
BLAST of Tau tubulin kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTBK21.909e-10361.33tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
TTBK21.557e-9761.00tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
TTBK11.105e-9559.00tau tubulin kinase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
TTBK13.865e-9560.69tau tubulin kinase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
TTBK22.684e-8554.00tau tubulin kinase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttbk-78.589e-8951.65Tau TuBulin Kinase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
R13H9.54.858e-5240.19pep chromosome:WBcel235:IV:5065746:5066987:-1 gene... [more]
ttbk-27.340e-5240.19Tau TuBulin Kinase [Source:UniProtKB/TrEMBL;Acc:O... [more]
F35C11.31.864e-5036.84pep chromosome:WBcel235:II:8246776:8248263:1 gene:... [more]
M05D6.12.031e-5036.84pep chromosome:WBcel235:II:8473819:8475406:-1 gene... [more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asator4.985e-9961.99gene:FBgn0039908 transcript:FBtr0300344[more]
Asator9.565e-9761.99gene:FBgn0039908 transcript:FBtr0344869[more]
Asator9.565e-9761.99gene:FBgn0039908 transcript:FBtr0332908[more]
Asator2.062e-9661.99gene:FBgn0039908 transcript:FBtr0332904[more]
Asator2.922e-9661.99gene:FBgn0039908 transcript:FBtr0332905[more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttbk2a1.718e-9960.67tau tubulin kinase 2a [Source:ZFIN;Acc:ZDB-GENE-12... [more]
ttbk2a5.060e-9960.67tau tubulin kinase 2a [Source:ZFIN;Acc:ZDB-GENE-12... [more]
ttbk2a5.060e-9960.67tau tubulin kinase 2a [Source:ZFIN;Acc:ZDB-GENE-12... [more]
ttbk2b6.937e-9959.00tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ttbk1a1.897e-9759.67tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-10... [more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col24a18.874e-10161.67collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
col24a13.723e-9861.33collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
col24a17.507e-9861.33collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
col24a12.892e-9562.64collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
col24a17.024e-8654.33collagen, type XXIV, alpha 1 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttbk23.340e-10161.00tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:21... [more]
Ttbk14.915e-9959.33tau tubulin kinase 1 [Source:MGI Symbol;Acc:MGI:21... [more]
Ttbk28.830e-9961.00tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:21... [more]
Ttbk28.830e-9961.00tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:21... [more]
Ttbk22.602e-9861.00tau tubulin kinase 2 [Source:MGI Symbol;Acc:MGI:21... [more]
back to top
BLAST of Tau tubulin kinase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UVR3|TTBK2_MOUSE6.177e-9861.00Tau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=T... [more]
sp|Q6IQ55|TTBK2_HUMAN7.478e-9761.00Tau-tubulin kinase 2 OS=Homo sapiens OX=9606 GN=TT... [more]
sp|Q6PCN3|TTBK1_MOUSE4.677e-9559.00Tau-tubulin kinase 1 OS=Mus musculus OX=10090 GN=T... [more]
sp|Q5TCY1|TTBK1_HUMAN5.304e-9559.00Tau-tubulin kinase 1 OS=Homo sapiens OX=9606 GN=TT... [more]
sp|Q8IMC6|ASATR_DROME1.114e-9461.99Tau-tubulin kinase homolog Asator OS=Drosophila me... [more]
back to top
BLAST of Tau tubulin kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|1757662821.229e-10461.33tr|A0A1A7WKG4|A0A1A7WKG4_9TELE Tau tubulin kinase ... [more]
gnl|BL_ORD_ID|1734788373.926e-10460.00tr|A0A1A8N2T4|A0A1A8N2T4_9TELE Tau tubulin kinase ... [more]
gnl|BL_ORD_ID|238502471.875e-10361.56tr|V3ZM49|V3ZM49_LOTGI Protein kinase domain-conta... [more]
gnl|BL_ORD_ID|157375874.092e-10361.99tr|R7V2U7|R7V2U7_CAPTE Protein kinase domain-conta... [more]
gnl|BL_ORD_ID|182057464.282e-10361.33tr|A0A267DEE2|A0A267DEE2_9PLAT Protein kinase doma... [more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttbk1a3.372e-10252.57tau tubulin kinase 1a [Source:ZFIN;Acc:ZDB-GENE-10... [more]
ttbk1b3.367e-10047.07tau tubulin kinase 1b [Source:ZFIN;Acc:ZDB-GENE-10... [more]
ttbk2b1.912e-9758.00tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ttbk2b1.585e-8754.00tau tubulin kinase 2b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
csnk1g12.611e-3231.80casein kinase 1 gamma 1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004926.14.443e-8057.33pep scaffold:Pmarinus_7.0:GL480178:196:11423:1 gen... [more]
csnk1g2a1.863e-3432.06casein kinase 1, gamma 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000008477.13.490e-2832.57pep scaffold:Pmarinus_7.0:GL482342:316:9736:-1 gen... [more]
csnk1g12.271e-2132.28casein kinase 1, gamma 1 [Source:NCBI gene;Acc:494... [more]
ENSPMAT00000001691.15.102e-1634.91pep scaffold:Pmarinus_7.0:GL476581:539457:546336:1... [more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRR259.844e-2731.25Conserved casein kinase; regulates diverse events ... [more]
YCK11.163e-2630.51Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK22.775e-2630.69Palmitoylated plasma membrane-bound casein kinase ... [more]
YCK33.855e-2428.27Palmitoylated vacuolar membrane-localized casein k... [more]
MPS17.232e-922.91Dual-specificity kinase; autophosphorylation requi... [more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO467892.211e-10060.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342891.040e-3233.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347423.011e-3033.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465233.599e-2730.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487389.926e-2429.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tau tubulin kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttbk2a2.419e-9259.60tau tubulin kinase 2 [Source:NCBI gene;Acc:1011741... [more]
ttbk1a5.886e-8955.59tau tubulin kinase 1 [Source:NCBI gene;Acc:1053541... [more]
ttbk2b3.380e-8754.00tau-tubulin kinase 2 [Source:NCBI gene;Acc:1011577... [more]
ttbk2a7.705e-8553.33tau tubulin kinase 2 [Source:NCBI gene;Acc:1011741... [more]
csnk1g13.654e-3231.15casein kinase 1 gamma 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Tau tubulin kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026133.10.000e+0100.00SMESG000026133.1[more]
SMESG000030545.12.251e-11165.00SMESG000030545.1[more]
SMESG000048011.15.519e-11062.33SMESG000048011.1[more]
SMESG000030545.11.282e-10965.00SMESG000030545.1[more]
SMESG000068893.11.784e-10161.74SMESG000068893.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023193 ID=SMED30023193|Name=Tau tubulin kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=4469bp
ATTTTTTAAAGTATTAACAACCAATGTATTTCGATCAACAAAAGATTTAT
TAGAGAATTTATTATTTATTATGTGTTTTTAACAGATTAAAATCAGTTTT
TAAATTATTTTAAAAATAGAAATGTTTAATGACTTCTTCAACTCAAGAAC
CTGATTTAGCATCTGAAGGAGACGTTATCAAAGAGCGATGGAAGATCATC
AAAAAACTTGGTGGGGGTGGTTTTGGAGAAATCTATGAATGTGTTGATCC
AATAGTCAAAGATAAGGTGGCCATTAAATTAGAATCATCTAAACTACCGA
AACAAGTGTTGAGAATGGAGGTTTCAGTGTTAAAAAAGTTACAAGGGACC
AAACATGCATGTAAATGTTATGGTTATGGACGTAATGATAAATTCAGTTA
CGTCGCAATGACACTTCAGGGTAAAAATCTTGCTGATCTCAGGCGACAAA
TGAAGTCTGGTTCTTTCTCTATTTCGACAACTCTACAGTTGACACTACAA
ATTTTGGATTCAATTGAAAATATTCATAGCATTGGTTTTCTCCATCGTGA
CATTAAACCGTCAAATTTTGCAATTGGAGGCTCAGCAGAAACCAGACGAA
TAGTCTATATGTTAGATTTTGGCCTTGCCCGCCAATTTGTTCTACCCGAC
GGTAGCTTCCAAGTTCGTCCACCAAGAGATGTCGCTGGTTTTCGTGGAAC
AGTTAGATATGCATCGATGAATGCTCACAACAACGTTGAAATGGGTCGTC
ATGATGATTTGTGGTCAGCATTTTATATGTTTTATGAAATGATTACTGGT
CAGTTGCCATGGCGTCGAATGAAAGACAAGGAACAGGTCGGCCAAATCAA
ATTGAACTACGATCACACTAAATTTCTTCAATCATTACCGAATGAATTCA
AGCCATTTCTAGCACATATTCAAGAACTTGATTATTTTAAGAAACCCGAT
TATGAAATGATGAAAAATCTCATTCGAGATTGTATGAAATCGAAAAAGGT
TACACAATCTGATTCTTTTGATTGGGAACTCAACTCGGTATCCACAACCC
CAGTGACAGTATCATCCAATATAGATACTAATATGGAGAGACGTAATTCT
GCTATTATTTCGACTGGAACTGGTCCACAAATACATGTTGCTAAAAGTTC
CCGGCAAAACAATGGTGACGTTCAAAATCATGTGGCCATTGAAGAATTTC
GAAATAAACCATCAAAGACCGTCAAAGAATCTGTATTAAAGGCGAAAAAG
TCCCATTTGGATATGCCTGATAATGGGGACAACGGAGTATCTGTCGGTAA
AAGCAGTTATCGACACGCAGTGTCAAATATTGCTGGAAAATCTGAAAAAA
GTCAAAATGCTCGCAATACTATGCCTCCGATATCTCCTCGGTCTACTTTC
GCCAATCAAAAAGAAAAGATGTTTGATATAAAATTTTCCGAAGAAATCGA
AACACCAAGAAATGCGGTCCAATCAGAAATTACCTCCCATGAAAAGCACT
CTTCTGTAATTGATAGTCACAACAGATCGGCCAGTCGAAGAAATCGTCGT
GAACCGGAACTGGTAAATAAACCCAGTAGATTACCGGTTCTTATGAAAAC
AAGTTCAAGTGATTCTAATAACAAATCTAATGAATATGAACCCGATCAGC
CGTTTTTTCAAAATCATAAAACCACCGAAGATTCCGTATTGTTTGCAGAT
AACTATGAAACAAATTTTGAATCAGAAAATCAAAAACATCGCGGAATTTC
AGCAGCACTGGCTGTGGTACCAAATTCGATGAAAGTAACTGGGAATTTGC
CTCCGAAACCAGCAACCTCTTCAACTCCGTCAAATCTCGTGAAAAACACC
GAAAAACTAAATAAAAATTCCATCAATCTTCGGGGAAACTTTCTTCAGAG
TGTTGGTGGCAGTGTGGCGACTCATGCAGTGAACGATGATCAATTCGATG
TCAGTAACGCGCCTGACGCTACGAAAGCAGTACTTTTAAGTAATCAAGAA
TGTGATGATGATGACGAAGACAATTGCAATTTATCCGATCATTTTGAAGA
CGATAAATATCACGTAAATCAGTTCAAACAACAAGAGTCTGATACAAAGG
AAAATACCGCAACGAAAGATAGCAAATTAAACGGTCAAATCAAACCCCAA
TCCTACATAAGCAGTGGAGATAATTTATCTACTACTAATCACAATGATTC
TTCCAAACGATCTCGTCGACAACCGATGATAGTCACTGAAAAGTCTTCAG
CAAAAATTCAAGCTCAACTCGCTGATAAATCTCGAGCGTCAAGTTCGATT
TTGAGTCGGTTAAACAATCAAGAAGAAGACAGTTCGAATTGCAAGAGTAA
AGAATCCCATGAAATGGAAATGACTTTGTCCAAAGCAAAAACGACGACGA
CATCGGGCTATATTTCATCGGTATCAAAATACGACGTGAACCAGAAACCG
AGTTATGAGGCTATCGGTCAAAGTGGGGACGATAAAAACCACAACTACCT
CAGTCAGCGGCATCCCTATTATGGAGTGGTCGATTCTACGAGTTGCAGTG
CTTCGGCTAACGTTTTAAGTCATAAACACAACAATGAAATGCAAAAGTCC
AATTCCAATATCTCTCGATTACCTCCGAAAAGCTCCGAACAACGTTACAA
AGTCAATAAATACTCCACCAATCAAGACACTTCAGATTTATCTATATCGA
GATCTAGTCGTCGTAACGGTGCTTCGAAATCTAATCATCAAAATTCGAGC
TCTAATCCTAAATCCGGATTCCACATATCGAGTAAAGATTCAGCCAACAA
ACACAATTACTATGACCTCAAACGATCATCTAATCTTCAATTCAGTAATC
ATCACACATTTCAGAACCTTAATCACTCGGATCATGGGGTGATTGTTTCA
CAGGGAACCTATAACAGCTCAAATCATCACAATTCTCGACGAGATCCCAG
CAATTTTAACAATCACCAATCTGACCTGAAATTGGGAATGAAAGATCACT
CTTCGTCATCAAGGACATTCGATTCATATCGCGACAGTGATAGACCAACT
CCGAAACCTCGTTCGCATCATCGATCTCAAAGTCACACAAATCGTGAAGT
CGCCAACAGTATCATCAATGGCCACGGTGATAGCACAATAATTCGTCAGA
AAAATAACTATTACACTTCCTCCATCAACAACATGAACAATAATCTATCA
CCAAATGACATGAATGACCATTCTTTCGACAGATATAATCTCAGGCCCCG
CAGTTCCAGTCGAGAGTCGATCAGTAAATATAGCAACAACAAAAAACCCA
ATCCTACGTCATCTGGAAGCCAAAAGCCTGTTGTCTGCAAACACAACTCG
TCTCCATCGCGACGTCGAAGCACCAGTTTCAATAATAACAACGATTGCGT
GCAATGTCAAAATTACGGGGTGAAAAAGTGTACTACTCATTACAGCCAGA
AAAACAACAGCAATCTTGTTCTCAACACGAATTCCAGTGGAGTTTTAGTG
GCAAACTCTCTCACCAGAAGCGGAAGCATTGTCATGAAAAGCAAATCGGA
TTTGAACCTTTCAATGGCCGGTCTGATTCAAAATCGCCATTCGGGAAAAG
GACAACGCAGTAGTCATGGAAAAGCCCAGCATTCCTCTCAGTCTCCGTCG
GTAGTTTCCCAGTATTCCACGGCGAAAAATTACTCGACTTCACCAAACCA
CCGAACAGACTCGTCTATTCATCGCTCGTTGACTTCATCAATTAATCGCA
GCAGCAGTGCCGATCTCCTCAACCATTATTTGAGACATTCAAAAACCTTA
TCGAACAGTAACATGCAAAATAAATCGTCCAAACCCCATCAGCACGTCCA
ATCGTCGTCGAATTCCATTCTGAAACCGAAACCGAAACCGAATCCTCACG
GTCAATACAACAACATGTCGACTTCCACATCCGTTACGTCGGGAATCCAC
CGGCACGTGTATAAAAAAGTAATACGTGAAGACTCCGTCGACAGTGATAT
CTCAGTGAGTCACATTACGACTTCAACGACAAATCAAGCCAATTCCTCTT
TCAATCCCAAACCGCCTTCGTCGGGGAAATATCACCAGACTCACGTGTTT
CGGAACCGGCAATATACGTCCACGAAAATCATCAACTAGATCGAAATGCC
CATTATTATATACTGCATTATATACACCGGCCTTATCATATTCTATATAC
CAACAGAGTTTTTGTTGCTTTTTTTTATTTGATATTTTTTCATCGTCTTA
TTACTTTGATTTTCGGACAAATTTTTACATTATATAATAATAATAATTAT
AATTATTGAAATTTCATAACAACCCAATGAAAAAATTCAGTAATTTGCTC
AAAAAATTTATTAATTTTATTATCAGATTATTCTATGTCTCTCTCTCCCT
CTCTCTCTCTTTATGTCTATATTTATACATACGAAAAACAATTCAACATA
GATTTAAGCAATAAAACTA
back to top

protein sequence of SMED30023193-orf-1

>SMED30023193-orf-1 ID=SMED30023193-orf-1|Name=SMED30023193-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1337bp
MTSSTQEPDLASEGDVIKERWKIIKKLGGGGFGEIYECVDPIVKDKVAIK
LESSKLPKQVLRMEVSVLKKLQGTKHACKCYGYGRNDKFSYVAMTLQGKN
LADLRRQMKSGSFSISTTLQLTLQILDSIENIHSIGFLHRDIKPSNFAIG
GSAETRRIVYMLDFGLARQFVLPDGSFQVRPPRDVAGFRGTVRYASMNAH
NNVEMGRHDDLWSAFYMFYEMITGQLPWRRMKDKEQVGQIKLNYDHTKFL
QSLPNEFKPFLAHIQELDYFKKPDYEMMKNLIRDCMKSKKVTQSDSFDWE
LNSVSTTPVTVSSNIDTNMERRNSAIISTGTGPQIHVAKSSRQNNGDVQN
HVAIEEFRNKPSKTVKESVLKAKKSHLDMPDNGDNGVSVGKSSYRHAVSN
IAGKSEKSQNARNTMPPISPRSTFANQKEKMFDIKFSEEIETPRNAVQSE
ITSHEKHSSVIDSHNRSASRRNRREPELVNKPSRLPVLMKTSSSDSNNKS
NEYEPDQPFFQNHKTTEDSVLFADNYETNFESENQKHRGISAALAVVPNS
MKVTGNLPPKPATSSTPSNLVKNTEKLNKNSINLRGNFLQSVGGSVATHA
VNDDQFDVSNAPDATKAVLLSNQECDDDDEDNCNLSDHFEDDKYHVNQFK
QQESDTKENTATKDSKLNGQIKPQSYISSGDNLSTTNHNDSSKRSRRQPM
IVTEKSSAKIQAQLADKSRASSSILSRLNNQEEDSSNCKSKESHEMEMTL
SKAKTTTTSGYISSVSKYDVNQKPSYEAIGQSGDDKNHNYLSQRHPYYGV
VDSTSCSASANVLSHKHNNEMQKSNSNISRLPPKSSEQRYKVNKYSTNQD
TSDLSISRSSRRNGASKSNHQNSSSNPKSGFHISSKDSANKHNYYDLKRS
SNLQFSNHHTFQNLNHSDHGVIVSQGTYNSSNHHNSRRDPSNFNNHQSDL
KLGMKDHSSSSRTFDSYRDSDRPTPKPRSHHRSQSHTNREVANSIINGHG
DSTIIRQKNNYYTSSINNMNNNLSPNDMNDHSFDRYNLRPRSSSRESISK
YSNNKKPNPTSSGSQKPVVCKHNSSPSRRRSTSFNNNNDCVQCQNYGVKK
CTTHYSQKNNSNLVLNTNSSGVLVANSLTRSGSIVMKSKSDLNLSMAGLI
QNRHSGKGQRSSHGKAQHSSQSPSVVSQYSTAKNYSTSPNHRTDSSIHRS
LTSSINRSSSADLLNHYLRHSKTLSNSNMQNKSSKPHQHVQSSSNSILKP
KPKPNPHGQYNNMSTSTSVTSGIHRHVYKKVIREDSVDSDISVSHITTST
TNQANSSFNPKPPSSGKYHQTHVFRNRQYTSTKIIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR009081PP-bd_ACP
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007224smoothened signaling pathway
GO:0008360regulation of cell shape
GO:0008589regulation of smoothened signaling pathway
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0021915neural tube development
GO:0030030cell projection organization
GO:0030900forebrain development
GO:0042733embryonic digit morphogenesis
GO:0060271cilium morphogenesis
GO:1902857positive regulation of non-motile cilium assembly
GO:1903828negative regulation of cellular protein localization
GO:1990403embryonic brain development
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005814centriole
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005929cilium
GO:0035869ciliary transition zone
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0045111intermediate filament cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 21..297
e-value: 1.1E-18
score: 78.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 22..276
e-value: 9.9E-31
score: 107.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 21..282
score: 27.072
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 3..345
e-value: 6.5E-91
score: 307.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 449..513
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 734..749
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 400..427
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1040..1083
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1298..1319
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 952..990
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1227..1269
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 701..733
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 400..426
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1227..1250
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1153..1203
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 650..758
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 952..978
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 486..513
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 815..881
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1042..1083
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 455..480
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 663..689
NoneNo IPR availablePANTHERPTHR11909CASEIN KINASE-RELATEDcoord: 5..302
NoneNo IPR availablePANTHERPTHR11909:SF201TAU-TUBULIN KINASE 2coord: 5..302
NoneNo IPR availableCDDcd14017STKc_TTBKcoord: 20..281
e-value: 1.19026E-138
score: 421.666
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 27..50
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 15..300