Cytochrome c oxidase assembly protein COX11

Overview
NameCytochrome c oxidase assembly protein COX11
Smed IDSMED30023183
Length (bp)934
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome c oxidase assembly protein COX11 (SMED30023183) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome c oxidase assembly protein COX11 (SMED30023183) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome c oxidase assembly protein COX11 (SMED30023183) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome c oxidase assembly protein COX11 (SMED30023183) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023183

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023183SMESG000043656.1 dd_Smed_v4_3144_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Human
Match: COX11 (cytochrome c oxidase copper chaperone COX11 [Source:HGNC Symbol;Acc:HGNC:2261])

HSP 1 Score: 226.483 bits (576), Expect = 1.529e-72
Identity = 102/204 (50.00%), Postives = 141/204 (69.12%), Query Frame = 3
Query:  168 PKLSKKYYYKHRYDSTKA-RSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            PK S  +      +  +  ++++ Y+    V M G +YA VP+YR +CQ TG+GG+         D I  M P++ R I + F+ D   +L WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYNI+P+EAG+YF+KIQCFCFEEQRLNP++EVDMP+FFY+DP F +D  ++  + I L+YTFF AKE  KLP+PG+
Sbjct:   74 PKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHAS--DKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGY 275          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Human
Match: COX11 (cytochrome c oxidase copper chaperone COX11 [Source:HGNC Symbol;Acc:HGNC:2261])

HSP 1 Score: 226.483 bits (576), Expect = 1.529e-72
Identity = 102/204 (50.00%), Postives = 141/204 (69.12%), Query Frame = 3
Query:  168 PKLSKKYYYKHRYDSTKA-RSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            PK S  +      +  +  ++++ Y+    V M G +YA VP+YR +CQ TG+GG+         D I  M P++ R I + F+ D   +L WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYNI+P+EAG+YF+KIQCFCFEEQRLNP++EVDMP+FFY+DP F +D  ++  + I L+YTFF AKE  KLP+PG+
Sbjct:   74 PKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHAS--DKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGY 275          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Human
Match: COX11 (cytochrome c oxidase copper chaperone COX11 [Source:HGNC Symbol;Acc:HGNC:2261])

HSP 1 Score: 141.739 bits (356), Expect = 2.927e-40
Identity = 62/127 (48.82%), Postives = 87/127 (68.50%), Query Frame = 3
Query:  222 RSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQC 602
            ++++ Y+    V M G +YA VP+YR +CQ TG+GG+         D I  M P++ R I + F+ D   +L WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYNI+P+EAG+YF+KIQ 
Sbjct:   93 KTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHAS--DKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQA 217          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Human
Match: COX11 (cytochrome c oxidase copper chaperone COX11 [Source:HGNC Symbol;Acc:HGNC:2261])

HSP 1 Score: 141.739 bits (356), Expect = 2.927e-40
Identity = 62/127 (48.82%), Postives = 87/127 (68.50%), Query Frame = 3
Query:  222 RSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQC 602
            ++++ Y+    V M G +YA VP+YR +CQ TG+GG+         D I  M P++ R I + F+ D   +L WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYNI+P+EAG+YF+KIQ 
Sbjct:   93 KTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHAS--DKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQA 217          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Human
Match: COX11 (cytochrome c oxidase copper chaperone COX11 [Source:HGNC Symbol;Acc:HGNC:2261])

HSP 1 Score: 141.739 bits (356), Expect = 3.757e-40
Identity = 62/126 (49.21%), Postives = 87/126 (69.05%), Query Frame = 3
Query:  222 RSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQ 599
            ++++ Y+    V M G +YA VP+YR +CQ TG+GG+         D I  M P++ R I + F+ D   +L WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYNI+P+EAG+YF+KIQ
Sbjct:   93 KTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHAS--DKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQ 216          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Celegans
Match: cox-11 (Cytochrome OXidase assembly protein [Source:UniProtKB/TrEMBL;Acc:S6F574])

HSP 1 Score: 198.364 bits (503), Expect = 3.395e-62
Identity = 92/187 (49.20%), Postives = 127/187 (67.91%), Query Frame = 3
Query:  210 STKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLP 770
            S   R+  YY++   +   G T+A +P YR FC++T  GG T +A  K +D I  MK    R I V+F+ D  +++ W F P Q  + + PGETALAFY A NPTD+PI+GI++YN+ P++A  YF+KIQCFCFEEQ LNP ++VD+P+FFY+DP + +D  L + + ILL+YTFF AK  LKLP P
Sbjct:   55 SADTRNYTYYVMSLVIVAIGCTFAAIPAYRIFCEQTSFGGLTQVA--KDFDKIANMKKCEDRLIRVQFNSDVPSSMRWEFKPQQHEIYVHPGETALAFYTARNPTDKPIIGISSYNLTPFQAAYYFNKIQCFCFEEQILNPGEQVDLPVFFYIDPDYVNDPALEYLDSILLSYTFFEAKSGLKLPDP 239          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Celegans
Match: cox-11 (Cytochrome OXidase assembly protein [Source:UniProtKB/TrEMBL;Acc:S6F574])

HSP 1 Score: 189.119 bits (479), Expect = 1.674e-59
Identity = 88/172 (51.16%), Postives = 120/172 (69.77%), Query Frame = 3
Query:  255 VFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLP 770
            +   G T+A +P YR FC++T  GG T +A  K +D I  MK    R I V+F+ D  +++ W F P Q  + + PGETALAFY A NPTD+PI+GI++YN+ P++A  YF+KIQCFCFEEQ LNP ++VD+P+FFY+DP + +D  L + + ILL+YTFF AK  LKLP P
Sbjct:    5 IVAIGCTFAAIPAYRIFCEQTSFGGLTQVA--KDFDKIANMKKCEDRLIRVQFNSDVPSSMRWEFKPQQHEIYVHPGETALAFYTARNPTDKPIIGISSYNLTPFQAAYYFNKIQCFCFEEQILNPGEQVDLPVFFYIDPDYVNDPALEYLDSILLSYTFFEAKSGLKLPDP 174          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Fly
Match: CG31648 (gene:FBgn0051648 transcript:FBtr0079098)

HSP 1 Score: 213.001 bits (541), Expect = 4.604e-68
Identity = 96/187 (51.34%), Postives = 128/187 (68.45%), Query Frame = 3
Query:  216 KARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            +A+S++YYI   GV + GL+YA VP+Y  FCQ    GG T        + +  MK I  R + + F+ D  +++ WNF P Q  +K+ PGETALAFY A NPTD+P++GI+TYN++P+EAG YF+KIQCFCFEEQ+LNP +EVDMP+FFY+DP    D  L   + I L+YTFF AKE LKL  P +
Sbjct:   49 RAKSTLYYITAGGVLIVGLSYAAVPLYSIFCQAYSYGGTTTQGH--DAEKVEHMKKIEDRVLKIRFNADIGSSMRWNFKPQQYEIKVAPGETALAFYTARNPTDKPVIGISTYNVIPFEAGAYFNKIQCFCFEEQQLNPHEEVDMPVFFYIDPEITADPALETCDTITLSYTFFEAKEGLKLNFPSY 233          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Zebrafish
Match: cox11 (cytochrome c oxidase assembly homolog 11 (yeast) [Source:ZFIN;Acc:ZDB-GENE-050506-82])

HSP 1 Score: 236.498 bits (602), Expect = 6.319e-77
Identity = 114/231 (49.35%), Postives = 154/231 (66.67%), Query Frame = 3
Query:  117 RVMLGLSFTKFLKLNTFPKL-----SKKYYYKHRYDS----TKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDI--IHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            R +   S  +FL+  T   L     +K +  KH+  +     K ++ + YI   GV M G++YA VP+YR +CQ TG+GG    A V  +D   +  MKP+R R I V F+ D   ++ WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYN++P+EAG+YF+KIQCFCFEEQRLNP +EVDMP+FFY+DP FD+D  +   + I L+YTFF AKE   LPLPG+
Sbjct:   32 RRLATSSSQQFLRRTTQRLLNQSRGAKTHKRKHQSQADDWKKKNKTILTYIAAAGVGMIGMSYAAVPLYRLYCQATGLGG----AAVAGHDTEQVATMKPVRDRIIKVTFNADTHASIQWNFRPQQSEIYVVPGETALAFYRARNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDEDPRMARVDTITLSYTFFEAKEGQHLPLPGY 258          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Zebrafish
Match: cox11 (cytochrome c oxidase assembly homolog 11 (yeast) [Source:ZFIN;Acc:ZDB-GENE-050506-82])

HSP 1 Score: 236.498 bits (602), Expect = 6.319e-77
Identity = 114/231 (49.35%), Postives = 154/231 (66.67%), Query Frame = 3
Query:  117 RVMLGLSFTKFLKLNTFPKL-----SKKYYYKHRYDS----TKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDI--IHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            R +   S  +FL+  T   L     +K +  KH+  +     K ++ + YI   GV M G++YA VP+YR +CQ TG+GG    A V  +D   +  MKP+R R I V F+ D   ++ WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYN++P+EAG+YF+KIQCFCFEEQRLNP +EVDMP+FFY+DP FD+D  +   + I L+YTFF AKE   LPLPG+
Sbjct:   32 RRLATSSSQQFLRRTTQRLLNQSRGAKTHKRKHQSQADDWKKKNKTILTYIAAAGVGMIGMSYAAVPLYRLYCQATGLGG----AAVAGHDTEQVATMKPVRDRIIKVTFNADTHASIQWNFRPQQSEIYVVPGETALAFYRARNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDEDPRMARVDTITLSYTFFEAKEGQHLPLPGY 258          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Zebrafish
Match: cox11 (cytochrome c oxidase assembly homolog 11 (yeast) [Source:ZFIN;Acc:ZDB-GENE-050506-82])

HSP 1 Score: 209.149 bits (531), Expect = 1.247e-66
Identity = 100/202 (49.50%), Postives = 136/202 (67.33%), Query Frame = 3
Query:  117 RVMLGLSFTKFLKLNTFPKL-----SKKYYYKHRYDS----TKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDI--IHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDD 689
            R +   S  +FL+  T   L     +K +  KH+  +     K ++ + YI   GV M G++YA VP+YR +CQ TG+GG    A V  +D   +  MKP+R R I V F+ D   ++ WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYN++P+EAG+YF+KIQCFCFEEQRLNP +EVDMP+FFY+DP FD+D
Sbjct:   32 RRLATSSSQQFLRRTTQRLLNQSRGAKTHKRKHQSQADDWKKKNKTILTYIAAAGVGMIGMSYAAVPLYRLYCQATGLGG----AAVAGHDTEQVATMKPVRDRIIKVTFNADTHASIQWNFRPQQSEIYVVPGETALAFYRARNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDED 229          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Xenopus
Match: tmem241 (transmembrane protein 241 [Source:Xenbase;Acc:XB-GENE-971853])

HSP 1 Score: 192.971 bits (489), Expect = 4.318e-61
Identity = 87/159 (54.72%), Postives = 113/159 (71.07%), Query Frame = 3
Query:  300 TFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            T    TG+GG        S + I  M+P++ R I V F+ D   +L WNF P Q  + +VPGETALAFY+A N T+ P++GI+TYN++PYEAG+YF+KIQCFCFEEQRLNP +EVDMP+FF++DP F DD  +   + I L+YTFF AKE  KLPLPG+
Sbjct:    1 TTISATGLGGTAVAGH--SSEQIEAMEPVKDRVIKVTFNADVHASLHWNFRPQQGEIYVVPGETALAFYKAKNSTENPVIGISTYNVVPYEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFFIDPEFADDPRMAKVDTITLSYTFFEAKEGQKLPLPGY 157          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Xenopus
Match: tmem241 (transmembrane protein 241 [Source:Xenbase;Acc:XB-GENE-971853])

HSP 1 Score: 184.111 bits (466), Expect = 5.593e-58
Identity = 80/134 (59.70%), Postives = 104/134 (77.61%), Query Frame = 3
Query:  375 MKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            M+P++ R I V F+ D   +L WNF P Q  + +VPGETALAFY+A N T+ P++GI+TYN++PYEAG+YF+KIQCFCFEEQRLNP +EVDMP+FF++DP F DD  +   + I L+YTFF AKE  KLPLPG+
Sbjct:    1 MEPVKDRVIKVTFNADVHASLHWNFRPQQGEIYVVPGETALAFYKAKNSTENPVIGISTYNVVPYEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFFIDPEFADDPRMAKVDTITLSYTFFEAKEGQKLPLPGY 134          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Mouse
Match: Cox11 (cytochrome c oxidase assembly protein 11, copper chaperone [Source:MGI Symbol;Acc:MGI:1917052])

HSP 1 Score: 225.713 bits (574), Expect = 1.929e-72
Identity = 99/187 (52.94%), Postives = 137/187 (73.26%), Query Frame = 3
Query:  216 KARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            + ++ + Y+    V M G +YA VP+YR +CQ TG+GG+       S D I  M P++ R I V F+ D   +L WNF P Q  + +VPGETALAFY+A NPTD+P++GI+TYN++P+EAG+YF+KIQCFCFEEQRLNP++EVDMP+FFY+DP F +D  +++ + I L+YTFF AKE  KLP+PG+
Sbjct:   90 RNKTVLTYVAAAAVGMLGASYAAVPLYRLYCQTTGLGGSAVAG--HSSDQIENMVPVKDRVIKVTFNADVHASLQWNFRPQQTEIYVVPGETALAFYKAKNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMVNVDLITLSYTFFEAKEGHKLPVPGY 274          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Mouse
Match: Cox11 (cytochrome c oxidase assembly protein 11, copper chaperone [Source:MGI Symbol;Acc:MGI:1917052])

HSP 1 Score: 186.422 bits (472), Expect = 5.054e-59
Identity = 80/134 (59.70%), Postives = 108/134 (80.60%), Query Frame = 3
Query:  375 MKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            M P++ R I V F+ D   +L WNF P Q  + +VPGETALAFY+A NPTD+P++GI+TYN++P+EAG+YF+KIQCFCFEEQRLNP++EVDMP+FFY+DP F +D  +++ + I L+YTFF AKE  KLP+PG+
Sbjct:    1 MVPVKDRVIKVTFNADVHASLQWNFRPQQTEIYVVPGETALAFYKAKNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMVNVDLITLSYTFFEAKEGHKLPVPGY 134          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. UniProt/SwissProt
Match: sp|Q9Y6N1|COX11_HUMAN (Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Homo sapiens OX=9606 GN=COX11 PE=1 SV=3)

HSP 1 Score: 226.483 bits (576), Expect = 7.342e-72
Identity = 102/204 (50.00%), Postives = 141/204 (69.12%), Query Frame = 3
Query:  168 PKLSKKYYYKHRYDSTKA-RSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            PK S  +      +  +  ++++ Y+    V M G +YA VP+YR +CQ TG+GG+         D I  M P++ R I + F+ D   +L WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYNI+P+EAG+YF+KIQCFCFEEQRLNP++EVDMP+FFY+DP F +D  ++  + I L+YTFF AKE  KLP+PG+
Sbjct:   74 PKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHAS--DKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGY 275          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. UniProt/SwissProt
Match: sp|Q6P8I6|COX11_MOUSE (Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Mus musculus OX=10090 GN=Cox11 PE=1 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 1.349e-71
Identity = 99/187 (52.94%), Postives = 137/187 (73.26%), Query Frame = 3
Query:  216 KARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            + ++ + Y+    V M G +YA VP+YR +CQ TG+GG+       S D I  M P++ R I V F+ D   +L WNF P Q  + +VPGETALAFY+A NPTD+P++GI+TYN++P+EAG+YF+KIQCFCFEEQRLNP++EVDMP+FFY+DP F +D  +++ + I L+YTFF AKE  KLP+PG+
Sbjct:   90 RNKTVLTYVAAAAVGMLGASYAAVPLYRLYCQTTGLGGSAVAG--HSSDQIENMVPVKDRVIKVTFNADVHASLQWNFRPQQTEIYVVPGETALAFYKAKNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMVNVDLITLSYTFFEAKEGHKLPVPGY 274          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. UniProt/SwissProt
Match: sp|A3KMZ6|COX11_BOVIN (Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Bos taurus OX=9913 GN=COX11 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.790e-71
Identity = 101/208 (48.56%), Postives = 142/208 (68.27%), Query Frame = 3
Query:  168 PKLSKKYYYKHRYDSTKARSSVY-YIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGFLTSK 788
            PK +  Y      D  +   +V  Y+    V M G +YA VP+YR +CQ TG+GG+         D I  M P++ R I + F+ D   +L WNF P Q  + +VPGETALAFY+A NPTD+P++GI+TYN++P+EAG+YF+KIQCFCFEEQRLNP++EVDMP+FFY+DP F +D  +++ + I L+YTFF AKE   LP+PG+ +++
Sbjct:   69 PKSTNPYTRSQEEDWRRRNKTVLTYMAAAAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHAS--DQIENMVPVKDRIIKITFNADVHASLQWNFRPQQTEIYVVPGETALAFYKAKNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMVNVDLITLSYTFFEAKEGHTLPVPGYNSNQ 274          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. UniProt/SwissProt
Match: sp|Q5R7U6|COX11_PONAB (Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Pongo abelii OX=9601 GN=COX11 PE=3 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 2.738e-70
Identity = 102/207 (49.28%), Postives = 143/207 (69.08%), Query Frame = 3
Query:  159 NTFPKLSKKYYYKHRYDSTKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKI-QCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            N F +  K+ + +      + ++++ Y+    V M G +YA VP+YR +CQ TG+GG+         D I  M P++ R I + F+ D   +L WNF P Q  + +VPGETALAFYRA NPTD+P++GI+TYNI+P+EAG+YF+KI QCFCFEEQRLNP++EVDMP+FFY+DP F +D  ++  + I L+YTFF AKE  KLP+PG+
Sbjct:   78 NPFTRAQKEEWRR------RNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHAS--DKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGY 276          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. UniProt/SwissProt
Match: sp|O21243|COXZ_RECAM (Cytochrome c oxidase assembly protein ctaG OS=Reclinomonas americana OX=48483 GN=CTAG PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.978e-58
Identity = 87/179 (48.60%), Postives = 119/179 (66.48%), Query Frame = 3
Query:  216 KARSSVYYIIG-TGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKE 749
            K R S+  +I    + M G +Y  VP+YR FCQ TG GG T +A ++S  +  K +    R ITV F+ D    + W FHP+Q+ +K++ GETALAFY A NPTD  I+GI+TYN+ P +AG YF+KIQCFCFEEQRL P + +DMP+FF++DPA  DD  +   + I L+YTFF  ++
Sbjct:    3 KNRKSIAILIAAVSITMIGFSYGSVPLYRIFCQVTGFGGTTQVADLESDILTLKDEQQENRIITVRFNGDVSDTMPWKFHPIQQEIKVMVGETALAFYSAENPTDSSIIGISTYNVNPQQAGIYFNKIQCFCFEEQRLKPHETIDMPVFFFIDPAILDDPKMSDIDSITLSYTFFNVED 181          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. TrEMBL
Match: A0A0R3U4S3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1664 PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 3.614e-79
Identity = 122/219 (55.71%), Postives = 151/219 (68.95%), Query Frame = 3
Query:  117 RVMLGLSFTKFLKLNTFPKLSKKYYYKHRYDSTKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPG 773
            R +LGLS        +F + S+++         + ++ +YY    GVFM GL YAGVP+YR +C K+G G NT+ ARV S DI+  MKP+R R ITVEF  D  +++ WNF P Q+ L IVPGETALAFY A NPT  PIVGIATY +LP EA KYF+KIQCFCFEEQRLNP +EVD+P+FF+LDP FD+D  LM T  I L YTFF AK+  KL +PG
Sbjct:    4 RSLLGLSALSVHAYRSFSRNSQEF---------RKKTVLYYSGACGVFMLGLGYAGVPLYRIYCAKSGSGSNTEGARVTSSDIVAAMKPVRNRKITVEFSADTYSHMAWNFKPSQRRLTIVPGETALAFYTAKNPTSRPIVGIATYTVLPLEAAKYFNKIQCFCFEEQRLNPDEEVDLPVFFFLDPEFDNDPRLMRTNRITLHYTFFEAKKE-KLMVPG 212          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. TrEMBL
Match: A0A068YH89 (Cytochrome c oxidase assembly protein COX11 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000923400 PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 6.507e-79
Identity = 115/188 (61.17%), Postives = 144/188 (76.60%), Query Frame = 3
Query:  210 STKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPG 773
            S + ++ +YY  G G+FM GL YAGVP+YR +C K+G G NTD ARV + D I +MKP+R+R +TVEF  D  +++ WNF PLQK L IVPGETALAFY A NPT +PIVGIATY +LP EA KYF+KIQCFCFEEQRLNP +EVD+P+FF+LDP FD+D +LM T  + L YTFF AK+  K+ +PG
Sbjct:   26 SYRRKTVLYYSTGLGIFMLGLGYAGVPLYRIYCAKSGRGSNTDGARVSNSDFIARMKPVRERRVTVEFSADTYSHMAWNFKPLQKRLTIVPGETALAFYTAKNPTSKPIVGIATYTVLPIEAAKYFNKIQCFCFEEQRLNPGEEVDLPVFFFLDPEFDEDPHLMRTNRLTLHYTFFEAKKE-KMLVPG 212          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. TrEMBL
Match: A0A068WUY9 (Cytochrome c oxidase assembly protein COX11 OS=Echinococcus granulosus OX=6210 GN=EgrG_000923400 PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 4.234e-78
Identity = 114/186 (61.29%), Postives = 144/186 (77.42%), Query Frame = 3
Query:  216 KARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPG 773
            + ++++YY  G G+FM GL YAGVP+YR +C K+G G NTD ARV + D I +MKP+R+R ITVEF  D  +++ W+F PLQK L IVPGETALAFY A NPT +PIVGIATY +LP EA KYF+KIQCFCFEEQRLNP +EVD+P+FF+LDP FD+D +LM T  + L YTFF AK+  K+ +PG
Sbjct:   28 RRKTALYYSTGLGIFMLGLGYAGVPLYRIYCAKSGRGSNTDGARVSNADFIARMKPVRERRITVEFSADTYSHMAWSFKPLQKRLTIVPGETALAFYTAKNPTSKPIVGIATYTVLPIEAAKYFNKIQCFCFEEQRLNPGEEVDLPVFFFLDPEFDEDPHLMRTNRLTLHYTFFEAKKE-KMLVPG 212          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. TrEMBL
Match: W6U4H3 (Cytochrome c oxidase assembly protein COX11 OS=Echinococcus granulosus OX=6210 GN=EGR_09108 PE=3 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 9.621e-78
Identity = 114/186 (61.29%), Postives = 144/186 (77.42%), Query Frame = 3
Query:  216 KARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPG 773
            + ++++YY  G G+FM GL YAGVP+YR +C K+G G NTD ARV + D I +MKP+R+R ITVEF  D  +++ W+F PLQK L IVPGETALAFY A NPT +PIVGIATY +LP EA KYF+KIQCFCFEEQRLNP +EVD+P+FF+LDP FD+D +LM T  + L YTFF AK+  K+ +PG
Sbjct:   45 RRKTALYYSTGLGIFMLGLGYAGVPLYRIYCAKSGRGSNTDGARVSNADFIARMKPVRERRITVEFSADTYSHMAWSFKPLQKRLTIVPGETALAFYTAKNPTSKPIVGIATYTVLPIEAAKYFNKIQCFCFEEQRLNPGEEVDLPVFFFLDPEFDEDPHLMRTNRLTLHYTFFEAKKE-KMLVPG 229          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. TrEMBL
Match: A0A3P7PBS8 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS11267 PE=3 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.233e-77
Identity = 117/195 (60.00%), Postives = 143/195 (73.33%), Query Frame = 3
Query:  198 HRYDSTKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGFLT 782
            HR ++ +  S++YY     VFM G +YAGVP+YR +C K G G NT+ ARVKS D + KMKPI+ R ITVEF  D  + + WNF P QKS+ IVPGETALAFY A NPTD PI GIATY I+P +A KYF+KIQCFCFEEQRLNP +EVD+P+FF+LDP FDDD  LM   +++L YTFF AK+  KL +PG  T
Sbjct:   20 HRSENLRRISAIYYCTALSVFMLGFSYAGVPLYRIYCAKVGGGTNTENARVKS-DRVEKMKPIKDRKITVEFSADTYSRMAWNFKPAQKSVTIVPGETALAFYTARNPTDRPITGIATYTIVPLDAAKYFNKIQCFCFEEQRLNPGEEVDLPVFFFLDPEFDDDPRLMRVSNLVLHYTFFEAKKE-KLMIPGIST 212          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Cavefish
Match: cox11 (cytochrome c oxidase assembly protein COX11, mitochondrial [Source:NCBI gene;Acc:103039244])

HSP 1 Score: 232.261 bits (591), Expect = 1.981e-75
Identity = 106/214 (49.53%), Postives = 148/214 (69.16%), Query Frame = 3
Query:  144 KFLKLNTFPKLSKKYYYKHRYD-STKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYD--IIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            +F+      K ++K       D   + ++++ YI   GV M GLTYA VP+YR +CQ TG+GG      +  +D  ++  MKP++ R I V F+ D   +L WNF P Q  + +VPGETALAFY+A NPTD+P++GI+TY+I+P++AG+YF+KIQCFCFEEQRLNP +EVDMP+FFY+DP FD+D  +   + I L+YTFF AK+  KLPLPG+
Sbjct:   42 RFVNQTRGAKTNRKKTQNQEDDWKQRNKTALTYIAAAGVGMIGLTYASVPLYRLYCQATGLGGTA----IAGHDGELVETMKPVKDRVIKVTFNADTHASLQWNFRPQQSEIYVVPGETALAFYKARNPTDKPVIGISTYSIVPFDAGQYFNKIQCFCFEEQRLNPYEEVDMPVFFYIDPEFDEDPRMAWVDSITLSYTFFEAKDGQKLPLPGY 251          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002247.1 (pep scaffold:Pmarinus_7.0:GL482303:14298:18185:-1 gene:ENSPMAG00000002046.1 transcript:ENSPMAT00000002247.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.868 bits (577), Expect = 1.117e-74
Identity = 101/189 (53.44%), Postives = 135/189 (71.43%), Query Frame = 3
Query:  210 STKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGF 776
            + K R+S+ YII T   M GL+YA VP+YR +CQ TG+GG          + +  M+P+R+R I V F+ D    L+WNF P Q  + +VPGETALAFYRA NP+ +P+VGI+TYN++P+EAG+YF+KIQCFCFEEQRLNP +EVDMP+FFY+DP F +D  + +   I L+YTFF AK+   L LPG+
Sbjct:   15 TRKNRTSLAYIIATVTGMLGLSYAAVPLYRLYCQATGLGGQAVAGH--GTEGVATMRPVRERAIRVIFNADVHAGLLWNFRPQQSEVNVVPGETALAFYRAKNPSSKPVVGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFAEDPRMANVNTITLSYTFFEAKDGQFLSLPGY 201          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Yeast
Match: COX11 (Protein required for delivery of copper to Cox1p; mitochondrial inner membrane protein; association with mitochondrial ribosomes suggests that copper delivery may occur during translation of Cox1p [Source:SGD;Acc:S000006053])

HSP 1 Score: 166.392 bits (420), Expect = 4.845e-50
Identity = 82/184 (44.57%), Postives = 115/184 (62.50%), Query Frame = 3
Query:  195 KHRYDSTKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPI-RKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAA 743
            + R    K R+  +Y     V   GL YA VP+YR  C +TG GG     R K  D   K+ P+  ++ I + F  +    L W F P Q+ + ++PGETALAFY+A N +D+ I+G+ATY+I P EA +YF+KIQCFCFEEQ+L   +E+DMP+FF++DP F  D  + + +DI+L YTFF A
Sbjct:   74 RARERKFKDRTVAFYFSSVAVLFLGLAYAAVPLYRAICARTGFGGIPITDRRKFTD--DKLIPVDTEKRIRISFTSEVSQILPWKFVPQQREVYVLPGETALAFYKAKNYSDKDIIGMATYSIAPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDFASDPAMRNIDDIILHYTFFRA 255          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Nematostella
Match: EDO36827 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH1])

HSP 1 Score: 202.601 bits (514), Expect = 3.169e-65
Identity = 86/184 (46.74%), Postives = 128/184 (69.57%), Query Frame = 3
Query:  216 KARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPL 767
            + +++  YI    V + G +YA VP+YR +CQ +G+GG   + + +S + + KM+   +R + + F+ D  + + W F P Q  +++ PGETALAFY A+N TD  I GI+TYN++P+EAG+YF+KIQCFCFEEQRLNP ++VDMP+FFY+DP F +D  +   + I L+YTFF +KEA K+ L
Sbjct:    1 RNKTTSIYIAAVAVTVLGCSYAAVPLYRLYCQASGLGGT--VKQAESGEKLEKMERKPERSLRIRFNADTSSTMQWKFKPQQSEVRVAPGETALAFYTATNATDTAITGISTYNVIPFEAGQYFNKIQCFCFEEQRLNPNEQVDMPVFFYIDPEFTEDPAMAKVDTITLSYTFFESKEAEKMGL 182          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Medaka
Match: cox11 (cytochrome c oxidase assembly protein COX11, mitochondrial [Source:NCBI gene;Acc:101159951])

HSP 1 Score: 149.828 bits (377), Expect = 4.286e-44
Identity = 66/128 (51.56%), Postives = 91/128 (71.09%), Query Frame = 3
Query:  216 KARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQ 599
            + R+ + YI   GV M GL+YA VP+YR +CQ TG+GG        + D +  MKP+R+R I V F+ D   ++ WNF P Q  + +VPGETALAFYRA NPTD+PI+GI+TYN++P++AG+YF+KIQ
Sbjct:   64 RNRTVLTYIAAAGVGMIGLSYASVPLYRLYCQATGLGGTAVAG--HNADQVETMKPVRERVIKVTFNADTHASIQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPIIGISTYNVVPFDAGQYFNKIQ 189          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Planmine SMEST
Match: SMESG000043656.1 (SMESG000043656.1)

HSP 1 Score: 458.759 bits (1179), Expect = 3.064e-165
Identity = 221/222 (99.55%), Postives = 221/222 (99.55%), Query Frame = 3
Query:  123 MLGLSFTKFLKLNTFPKLSKKYYYKHRYDSTKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGFLTSK 788
            MLGLSFTKFLK NTFPKLSKKYYYKHRYDSTKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGFLTSK
Sbjct:    1 MLGLSFTKFLKFNTFPKLSKKYYYKHRYDSTKARSSVYYIIGTGVFMFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGFLTSK 222          
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Planmine SMEST
Match: SMESG000043656.1 (SMESG000043656.1)

HSP 1 Score: 368.622 bits (945), Expect = 1.926e-130
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 3
Query:  261 MFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGFLTSK 788
            MFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGFLTSK
Sbjct:    1 MFGLTYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCDKDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYEAGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILLTYTFFAAKEALKLPLPGFLTSK 176          
The following BLAST results are available for this feature:
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COX111.529e-7250.00cytochrome c oxidase copper chaperone COX11 [Sourc... [more]
COX111.529e-7250.00cytochrome c oxidase copper chaperone COX11 [Sourc... [more]
COX112.927e-4048.82cytochrome c oxidase copper chaperone COX11 [Sourc... [more]
COX112.927e-4048.82cytochrome c oxidase copper chaperone COX11 [Sourc... [more]
COX113.757e-4049.21cytochrome c oxidase copper chaperone COX11 [Sourc... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cox-113.395e-6249.20Cytochrome OXidase assembly protein [Source:UniPr... [more]
cox-111.674e-5951.16Cytochrome OXidase assembly protein [Source:UniPr... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG316484.604e-6851.34gene:FBgn0051648 transcript:FBtr0079098[more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cox116.319e-7749.35cytochrome c oxidase assembly homolog 11 (yeast) [... [more]
cox116.319e-7749.35cytochrome c oxidase assembly homolog 11 (yeast) [... [more]
cox111.247e-6649.50cytochrome c oxidase assembly homolog 11 (yeast) [... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2414.318e-6154.72transmembrane protein 241 [Source:Xenbase;Acc:XB-G... [more]
tmem2415.593e-5859.70transmembrane protein 241 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cox111.929e-7252.94cytochrome c oxidase assembly protein 11, copper c... [more]
Cox115.054e-5959.70cytochrome c oxidase assembly protein 11, copper c... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y6N1|COX11_HUMAN7.342e-7250.00Cytochrome c oxidase assembly protein COX11, mitoc... [more]
sp|Q6P8I6|COX11_MOUSE1.349e-7152.94Cytochrome c oxidase assembly protein COX11, mitoc... [more]
sp|A3KMZ6|COX11_BOVIN2.790e-7148.56Cytochrome c oxidase assembly protein COX11, mitoc... [more]
sp|Q5R7U6|COX11_PONAB2.738e-7049.28Cytochrome c oxidase assembly protein COX11, mitoc... [more]
sp|O21243|COXZ_RECAM2.978e-5848.60Cytochrome c oxidase assembly protein ctaG OS=Recl... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3U4S33.614e-7955.71Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068YH896.507e-7961.17Cytochrome c oxidase assembly protein COX11 OS=Ech... [more]
A0A068WUY94.234e-7861.29Cytochrome c oxidase assembly protein COX11 OS=Ech... [more]
W6U4H39.621e-7861.29Cytochrome c oxidase assembly protein COX11 OS=Ech... [more]
A0A3P7PBS81.233e-7760.00Uncharacterized protein OS=Dibothriocephalus latus... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cox111.981e-7549.53cytochrome c oxidase assembly protein COX11, mitoc... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002247.11.117e-7453.44pep scaffold:Pmarinus_7.0:GL482303:14298:18185:-1 ... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
COX114.845e-5044.57Protein required for delivery of copper to Cox1p; ... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO368273.169e-6546.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cox114.286e-4451.56cytochrome c oxidase assembly protein COX11, mitoc... [more]
back to top
BLAST of Cytochrome c oxidase assembly protein COX11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000043656.13.064e-16599.55SMESG000043656.1[more]
SMESG000043656.11.926e-130100.00SMESG000043656.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023183 ID=SMED30023183|Name=Cytochrome c oxidase assembly protein COX11|organism=Schmidtea mediterranea sexual|type=transcript|length=934bp
CTTCTACCTAAAATGTCATTTAAAATTTAAAATATAGTAAGATATCAAGA
TCAAGATTTACTAATTTAATTTGATGTTTCTATTAATATTAAACATTTAT
TAATCATACAGCTAATCGAGTTATGTTAGGCCTTAGTTTTACAAAATTTT
TGAAGTTAAACACTTTTCCAAAACTTTCTAAGAAATATTATTACAAACAT
AGATATGATTCCACAAAAGCAAGAAGTAGTGTGTATTATATCATAGGAAC
TGGCGTGTTTATGTTCGGTCTAACTTATGCTGGGGTACCGATTTATAGAA
CATTTTGCCAAAAAACTGGAATTGGTGGAAACACCGATTTAGCACGAGTT
AAAAGTTATGATATTATTCATAAAATGAAACCCATTCGTAAGCGGCCTAT
TACAGTAGAATTCGACTGTGATAAAGACACAAATCTCATGTGGAATTTTC
ATCCATTACAAAAATCATTAAAAATTGTTCCAGGCGAAACAGCTCTAGCA
TTCTATAGAGCTTCTAATCCAACTGATGAACCTATTGTTGGAATTGCAAC
TTACAATATTCTGCCATATGAAGCTGGGAAATATTTCCATAAAATTCAGT
GTTTTTGTTTTGAAGAGCAAAGATTAAATCCAAAAGATGAAGTTGATATG
CCAATTTTTTTCTATCTCGATCCAGCATTCGATGACGATTTCAATTTAAT
GCATACCGAAGACATTTTATTGACTTACACGTTTTTCGCAGCGAAGGAAG
CATTAAAATTACCGTTGCCTGGATTTTTAACGTCGAAATGAAAGCTTTTT
TATAATCGTCATTATGATTGGTCGATTATCAGCCAATGAAAATTTAGTGT
TTTTATTTGTGTTGAAAATTTTTCGGAGAGGATATTTTTATGATTAGAAG
TTTAATTAATTTTTTAAAAGTTGCTTGTCGGTCG
back to top

protein sequence of SMED30023183-orf-1

>SMED30023183-orf-1 ID=SMED30023183-orf-1|Name=SMED30023183-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
MLGLSFTKFLKLNTFPKLSKKYYYKHRYDSTKARSSVYYIIGTGVFMFGL
TYAGVPIYRTFCQKTGIGGNTDLARVKSYDIIHKMKPIRKRPITVEFDCD
KDTNLMWNFHPLQKSLKIVPGETALAFYRASNPTDEPIVGIATYNILPYE
AGKYFHKIQCFCFEEQRLNPKDEVDMPIFFYLDPAFDDDFNLMHTEDILL
TYTFFAAKEALKLPLPGFLTSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR023471CtaG/Cox11_dom_sf
IPR007533Cyt_c_oxidase_assmbl_CtaG
Vocabulary: molecular function
TermDefinition
GO:0005507copper ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023471Cytochrome c oxidase assembly protein CtaG/Cox11, domain superfamilyGENE3DG3DSA:2.60.370.10coord: 83..214
e-value: 1.3E-52
score: 179.1
IPR023471Cytochrome c oxidase assembly protein CtaG/Cox11, domain superfamilySUPERFAMILYSSF110111Ctag/Cox11coord: 84..208
IPR007533Cytochrome c oxidase assembly protein CtaG/Cox11PFAMPF04442CtaG_Cox11coord: 55..205
e-value: 4.1E-58
score: 195.7
IPR007533Cytochrome c oxidase assembly protein CtaG/Cox11PIRSFPIRSF005413COX11coord: 18..217
e-value: 3.4E-67
score: 223.3
NoneNo IPR availablePANTHERPTHR21320:SF3CYTOCHROME C OXIDASE ASSEMBLY PROTEIN COX11, MITOCHONDRIALcoord: 20..216
NoneNo IPR availablePANTHERPTHR21320CYTOCHROME C OXIDASE ASSEMBLY PROTEIN COX11-RELATEDcoord: 20..216
NoneNo IPR availableTMHMMTMhelixcoord: 36..58