slc6a-12

Overview
Nameslc6a-12 (AKN21432.1)
Smed IDSMED30023180
Length (bp)2194
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc6a-12 (SMED30023180) t-SNE clustered cells

Violin plots show distribution of expression levels for slc6a-12 (SMED30023180) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc6a-12 (SMED30023180) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc6a-12 (SMED30023180) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023180

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023180SMESG000055640.1 SmedASXL_012750SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30023180SMESG000055640.1 dd_Smed_v4_8727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023180SMESG000055640.1 dd_Smed_v4_8727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023180SMESG000055640.1 dd_Smed_v6_8727_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023180SMESG000055640.1 dd_Smed_v4_8727_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
distal tubuleSMED30023180SMESG000055640.1 Smed-slc6a-12smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
flame cellSMED30023180SMESG000055640.1 Smed-slc6a-12smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc6a-12 vs. Ensembl Human
Match: SLC6A5 (solute carrier family 6 member 5 [Source:HGNC Symbol;Acc:HGNC:11051])

HSP 1 Score: 394.815 bits (1013), Expect = 1.043e-125
Identity = 211/567 (37.21%), Postives = 330/567 (58.20%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLK------------NITLDSFNSSIR--WRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            ++ R  WS+K++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+F  EVS+GQF    P  +W   P   G G +M+ IS L+++YYNV++ + L+YL  SF  VLPW  C N WNT  C     ++  +        ++            N+T+ +F S     + S +EE++ Y  L I+  I   G     + +C  +AW++ Y  L   +K+ GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L    VW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA    + +I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  I+DE  K     + ++T    +   ++G P+ T+ G Y+FQ+VD Y+   A++IIA+FE   +++ Y  ++    IE+M     +P  +W   C   +TP  L  +       +E P+   +  YP WS+  GW +    ++ +P+M  +++ M+    R + R
Sbjct:  188 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIG--FQPNIFWKV-CWAFVTPTILTFILCFSFYQWE-PMTYGSYRYPNWSMVLGWLMLACSVIWIPIM--FVIKMHLAPGRFIER 747          
BLAST of slc6a-12 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 387.882 bits (995), Expect = 4.917e-125
Identity = 219/548 (39.96%), Postives = 329/548 (60.04%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLT-FVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK--IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY   S   VLPW+ C N WNT  C    D   SNLT   +   L +      N S++  S +EE++    L ++  I   G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ ++G  L G++ GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE     I  K  ++ T  V +   L+G+PLT++AG Y   ++D Y+   ++++I+     A+ + Y ++     I++M   +  P   +   C   ++P  +  + +  +I + QP+   +  YP W++  G+ +A+  ++ +P+ A++ L    G+
Sbjct:   26 KRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLD--ASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGV-DVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYV-TLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMM---LGFPPPLFFQICWRFVSPAIIFFILVFTVIQY-QPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGD 565          
BLAST of slc6a-12 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 387.882 bits (995), Expect = 4.917e-125
Identity = 219/548 (39.96%), Postives = 329/548 (60.04%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLT-FVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK--IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY   S   VLPW+ C N WNT  C    D   SNLT   +   L +      N S++  S +EE++    L ++  I   G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ ++G  L G++ GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE     I  K  ++ T  V +   L+G+PLT++AG Y   ++D Y+   ++++I+     A+ + Y ++     I++M   +  P   +   C   ++P  +  + +  +I + QP+   +  YP W++  G+ +A+  ++ +P+ A++ L    G+
Sbjct:   26 KRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLD--ASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGV-DVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYV-TLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMM---LGFPPPLFFQICWRFVSPAIIFFILVFTVIQY-QPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGD 565          
BLAST of slc6a-12 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 387.882 bits (995), Expect = 1.131e-124
Identity = 219/548 (39.96%), Postives = 329/548 (60.04%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLT-FVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK--IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY   S   VLPW+ C N WNT  C    D   SNLT   +   L +      N S++  S +EE++    L ++  I   G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ ++G  L G++ GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE     I  K  ++ T  V +   L+G+PLT++AG Y   ++D Y+   ++++I+     A+ + Y ++     I++M   +  P   +   C   ++P  +  + +  +I + QP+   +  YP W++  G+ +A+  ++ +P+ A++ L    G+
Sbjct:   45 KRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLD--ASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGV-DVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYV-TLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMM---LGFPPPLFFQICWRFVSPAIIFFILVFTVIQY-QPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGD 584          
BLAST of slc6a-12 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 387.497 bits (994), Expect = 5.269e-124
Identity = 219/548 (39.96%), Postives = 329/548 (60.04%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLT-FVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK--IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY   S   VLPW+ C N WNT  C    D   SNLT   +   L +      N S++  S +EE++    L ++  I   G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ ++G  L G++ GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE     I  K  ++ T  V +   L+G+PLT++AG Y   ++D Y+   ++++I+     A+ + Y ++     I++M   +  P   +   C   ++P  +  + +  +I + QP+   +  YP W++  G+ +A+  ++ +P+ A++ L    G+
Sbjct:   99 KRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLD--ASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGV-DVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYV-TLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMM---LGFPPPLFFQICWRFVSPAIIFFILVFTVIQY-QPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGD 638          
BLAST of slc6a-12 vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 336.265 bits (861), Expect = 3.979e-105
Identity = 195/582 (33.51%), Postives = 313/582 (53.78%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWN-FAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWV----LPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKS--INELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELLRSNTTISATLD 2010
            S  R  W+ K+EF+L+ +GY+V +GNIWRFP +C ++GGGAFLIPYF  L I G PMF  E+ +GQF       IW    P+F G+G+ + CI   ++++YN ++A  +Y+  +S + +    +PW+ CGN WNT  C                 D  N+T+    + +   + +EE+YLY  L + KS   ++LGG    + +C +  +I+ Y  L    +S GK+V+ TA APY++L++++I+G +LPG+  G+ +Y+ P ++ L    VW+ AATQIF+SLGP +G L++++S+N FN N  R +    II C +SF+    +FS +G+M+ +TN      V E    L F+ YPQA+A +     WS +FF+ L+TLG+DS FA  E  I G  DE  +   K R  +   + ++   +  P  +  G ++   +D Y   ++V+ I   E  A+ +FY   +    I  M      P  YW   C  C      +I  + +  +  +P+   +  +P WS+  GW L +L ++ +PV AI  L+   G   + FR   T ++    R N+  S   D
Sbjct:   97 SMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRCS----------------DDLNVTISRNGTPLT--TPSEEYYLYKVLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDE-SRFLSKNRKWFVLVICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLG--FYPGIYWRV-CWTCSPVFISVIFIMTVYNSSFKPIQMASYTFPWWSVILGWFLRLLSVLAIPVFAIIYLLSGTGTLYERFRWAITPQQ----RRNSATSLAAD 652          
BLAST of slc6a-12 vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 333.569 bits (854), Expect = 6.992e-105
Identity = 209/604 (34.60%), Postives = 321/604 (53.15%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWV-LPWSKCGNYWNTEYCYS-YNDI-VKSNLTFVQFIDLKNITLDSFNS---------SIRWR----------SSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKI--RHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWY-STPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDK-NKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELL-RSNTTISATLDIEKN 2022
            ER  WS+  +F++S IGY++G+GN+WRFPYLC +NGGGAFLIPY   L  CGAP+F+ E S GQ   +   G++   PIF G+G +   ++  L++YY VV++W   YL  SF    +PW  C + WNT  C S Y  I   SN T  +F ++K +T D  +           + W           S  +EF+ +  L I+  +   GG    + +  ++ WI+ Y+C+   VK  GKVVY TA  PY++L  ++I+G  L G+ +G++FYL P +  LL  KVW  A TQ+F+S G   G L+++ S+NKFN N+ + +  +  +   +S +  F IFS IG MA       + +V ++GPGL F+AYP  +  LP    WS LFFL +L LG+DS F T E     I DE  +I+ K   R I+   + ++  L+GL   T  G Y+FQ+ D+Y ++  A++ +  FE  A+++     +   H   M+S +      W   C    TP     V +  +I ++    D  N  YP W   FGW L++  ++ +P  AI+I       W K     +  +K++LL R +  I   ++  +N
Sbjct:    9 EREQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGISSGLENPGGIRWDLALFLLLVWIICYLCIFKGVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMA-TQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQFCTMEGFFTAIIDEFPQIRRKKYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECIAISWSLGIDRWYEH---MKSMIGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRIDAYNYDYPVWGHIFGWFLSLSSMLCIPGYAIWI-------WFKT--PGTVQEKIKLLCRPDIEIKGAMENAEN 599          
BLAST of slc6a-12 vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 315.079 bits (806), Expect = 6.659e-98
Identity = 184/567 (32.45%), Postives = 300/567 (52.91%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWY-STPIAVIIIALFESFALAF---FYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYIL------IMYKGNWRKVFRANSTFK 1962
            +R  W+ K +F++S + Y+VG+GN+WRFPYLC +NGGG+FL+ Y  F  +   P+FL EV++GQ+       +W   P+F G+G   V I+ +   Y+ V+VAW ++Y+  S  WV PW  C NYWN   C +  +          F +L  I     ++    ++S E+F+    L+ T  I+E GG    +      AW++ Y  L   +    K VYF AL PYVL+ +++I+G  L G+  GI FYL P    LL   VW  A TQ+FYS G  +G LI++ S NKFN N  + +  +  I   +S    FA+FSI+G+M+++    DI+++++ G GLAF+AYP+  + LP   +++VLFFL +  LG+DS     E L   + D    ++ K +        L    +G+P+ T +G++   + D Y ++  A++ +  FE   LA+    +N +K +   E++   + K + Y    C     P + L++F+  ++ +    +   K +P W+  FGW L+   +V +P  AIY L      +  K   RK    + +F+
Sbjct:   29 DRGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWNDATCVTGKE---------NFTELARIKALVASAGGHTQTSVEQFWEKRVLHDTGDISEFGGIQWELFFIMAAAWLIVYFALWKGITQARKFVYFCALFPYVLIFILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQ-KDISEIVKPGVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQVCMMEGLFTALEDAFPILR-KYKKQSLGIFCLFFFCIGIPMVTHSGSHWLTLFDAYGASGYALLFVVFFEVVGLAYGFGAHNIRKALH--EMIGVTLPKGIEYVWKFC----APATSLVLFVFCVVYYHPVKYPDGKDFPFWANAFGWFLSSCSMVVIPGYAIYYLFFTNKHLTLKERVRKGLNLDGSFE 578          
BLAST of slc6a-12 vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 313.923 bits (803), Expect = 2.829e-97
Identity = 187/566 (33.04%), Postives = 308/566 (54.42%), Query Frame = 1
Query:  295 RAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIW-NFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWR--SSAEEFYLYNTL----------NITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN-----WRKV 1938
            R  WS K++F+LS +G++V +GNIWRFPYLC +NGGG FLIPY   + + G P+F  E+ +GQ+        W    P+F G+G+ ++  +  +  +YNV++AW L+YL  SF++ LPW+ C N +N+  CY              + +       S N S+     S+AEE++    L          ++ +S+ +LG     I +   V +++ Y  +   + + GKVV+FTAL PYV+L ++ I+G  LPG   GI++YL P ++ L    VW  AATQ+F+SLGP +G L++ +S+N F+ N+   +     I C +SF   F IFS++G+M+  +    I  V + GPGL FV YP+A++ +P    WSVLFFL L+TLG+DS F   E +I G++DE   +K K R ++   +    +++G+ + T  G  I + +  Y T   ++I    E+  +A+ Y  ++ +  ++ M     +P  YW   C  C  P  LL +  +  IN++   + ++  YP  +   G   A+     +P++ IY  +  +GN     W++V
Sbjct:   40 REQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYE-----------PHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSG-KPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILK-KNREVFVGCLFAFYMVIGIAMCTEGGILIMEWLIIYGTTWGLLIAVFCEAMVIAYIYGLRQFVHDVKEMMG--FRPGNYW-KFCWSCAAPFILLSMITSNFINYQALTY-QDYTYPTAANVIGIIFALSGASFIPLVGIYKFVNARGNTISEKWQRV 588          
BLAST of slc6a-12 vs. Ensembl Celegans
Match: snf-6 (Sodium-dependent acetylcholine transporter [Source:UniProtKB/Swiss-Prot;Acc:O76689])

HSP 1 Score: 257.684 bits (657), Expect = 2.730e-75
Identity = 162/587 (27.60%), Postives = 305/587 (51.96%), Query Frame = 1
Query:  295 RAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAE---------------EFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADE-CQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYW--LTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN-----WRKVFRANSTFKKMELLRSN 1986
            R  WSNK +++L+ IG++ GVG+ W+FP+L  ++GG AFL+PY   L +   PMF  E+ +GQF+  +   +W   P+F G+G++ V ISG  ++++N++ AW L+YL  SF++ +PWS C N W+ E C        +  T +Q  ++    L + +  +   SS E               +++  + L ++K +++ G  N ++ +C +  WI  ++CL   VKS GKVVY   + P+++LTV++ +   L GS   + ++L P+W+ L+ + VW  AA Q FYS+    GGL ++AS+++F+ NI +   ++ I+  + S  G    FS IG   Y   I+     I  G  L FV   +A+A +    +++ LFF+ +L +   +     ET++  I DE  ++++   RH+ T +V  L IL+ +P    +G +  +++  +     +++IA  E  A+ + Y    ++ + + +         +W  L   +C +  +++L        + +     ++  +P WSI   W +A   ++ +P++ I+   + KG      WR ++  ++    M + R+ 
Sbjct:   64 RGNWSNKSDYLLAVIGFTAGVGSFWKFPFLVFQHGGAAFLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFKGIGFAQVTISGFFAVFFNIISAWTLFYLINSFSFSIPWSNCANSWSGENC--------TLGTRIQCKEMNGTLLVNGSCIVEHASSNETTVIPLHDLGSIPSLKYFQNDVLMLSKGVDDFGTLNWYLGLCVLACWIAVFLCLFQGVKSSGKVVYVAVIVPFIILTVLLTRLLTLDGSLAAVFYFLTPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSRFHNNIYKDIWLVLIVDVIVSLVGCLLTFSAIGFTCYEFAISLDKFHIRDGFHLVFVFLAEALAGVSVAPLYAGLFFIMILLVVHATQMFVVETIVSSICDEYPERLRRNRRHVLT-TVCALFILLSIPFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVDNMLDNAKWIVGYWPPCYIFWKILFKFICPMVYLAILCFLWLDWNSIQY----ESYQFPYWSILTAWCIASFPLILIPIVGIWQFCIAKGTITQKWWRVLYPDDAWGPAMAIHRAE 637          
BLAST of slc6a-12 vs. Ensembl Fly
Match: Ntl (gene:FBgn0267326 transcript:FBtr0079478)

HSP 1 Score: 361.303 bits (926), Expect = 1.127e-115
Identity = 201/549 (36.61%), Postives = 314/549 (57.19%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLP--LTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
             + R  W +K EF+LS +GY++G+GN+WRFPYLC  +GG AFLIPY   + + G P+F  E+ IGQF+    TG++   P+  G G + V ++     YY+V++++ +  +   F   +PW  C N WNT+ C + +D+ K N                  SS  +++SA+EF+    L I+  I++LGG     L   I+ WI+ Y CL+  +KSVGKVVYFT   PY+LL +++I+G+ LPG+W GIKFYL P+W  LL +KVW  AA Q+F+ +GP WGG+++MASF+ F  N    S +I  I   +S    F +FS++G ++  + I  +  V   G GLAFV YP+A+ALLP   +W+++FF  L  LG+DS+F   E ++  I DE   ++    H    ++   +I +GL   + T  G +I Q+ DWYS+ IAVI+I L E   +A+ Y  K  +  +E M  +  +P  YW       +TP+ ++ + I  I+      ++ N  YP+W+I  GW+     ++ +P+   YI+I  +  
Sbjct:   21 DENRGQWKSKSEFILSLLGYAIGIGNVWRFPYLCYRSGGAAFLIPYLLMVILAGIPLFYMEILIGQFSSTGCTGMFRMTPLLKGTGIAQVVVNAYCVCYYSVIISYPIRMIFYCFFKKVPWEDCSNSWNTDDCVTASDMGKQN------------------SSDVFKTSADEFFHLEVLRISTDISDLGGMVWEQLTALIITWIIIYFCLMRGIKSVGKVVYFTVPFPYLLLFILLIRGATLPGAWKGIKFYLYPEWHRLLDLKVWADAAVQMFFGIGPGWGGIVNMASFSSFRNNAKCDSVLIVSINVFTSLLAGFVVFSVLGFLSEKSGIP-VESVATGGAGLAFVTYPEAIALLPVPQLWALMFFFMLFLLGIDSVFVQLEAIMSSILDEWYWVRS---HKCKLTLISCLIFLGLSSIMCTNGGMFILQLFDWYSSAIAVIVICLVEIIMVAWIYGIKNFMLDVEFMLGK--RPTLYWRIVWQ-VVTPVIIIFILITSIVFIRTITYN-NIPYPQWAIIIGWASCFTSVMWIPLYIFYIMIRKRAT 543          
BLAST of slc6a-12 vs. Ensembl Fly
Match: Gat (gene:FBgn0039915 transcript:FBtr0089972)

HSP 1 Score: 361.688 bits (927), Expect = 3.109e-115
Identity = 215/595 (36.13%), Postives = 329/595 (55.29%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYS---------YNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYS-TPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRA------NSTFKKMELLRSNTTISATLDIEKNSL 2028
            +R  WS+K++F+LS +G ++G+GN+WRFPYLC +NGGGAF++PY   LF+ G PMF  E+++GQ   +   G++  APIF G+G++   +S  +++YY V++AW ++Y  MS    +PW  C N+WNT  C S         ++ I+      V  +   NIT      S+      +EF+    L I+  I E+G     +    ++ WIL Y C+   VK  GKVVYFTAL PYVLLT+++++G  LPG+  GIKFY++P +  L + +VW  A TQIF+S G   G L+++ S+NKF  N+ + + ++  +   +S +  F IFS+IG MA+      +  V  SGPGLAF+ YP A+  LPG  +WS LFF  LL +G+DS F T E  I  I DE  ++  K + I+ A V  L  LVGL   T+ G YIFQI+D Y+ +   ++ +  FE  ++++ Y   +    I+ M   +      W   C C  TP   L VF   I+ +  PV   +  YP W+  FGW  A+  ++ +P+   ++     G   +  RA      + T  + ++LR     +   +IE NSL
Sbjct:   57 DRGSWSSKMDFILSVVGLAIGLGNVWRFPYLCYKNGGGAFILPYIITLFLAGIPMFFMELALGQMLTIGGLGVFKIAPIFKGIGYAAAVMSCWMNVYYIVILAWAVFYFFMSMRADVPWRTCNNWWNTVNCVSQYERKNLHCWDKIINGTTQKVCSVSALNIT------SLELTDPVKEFWERRALQISHGIEEIGNIRWELAGTLLLVWILCYFCIWKGVKWTGKVVYFTALFPYVLLTILLVRGITLPGALEGIKFYIIPNFSKLTNSEVWIDAVTQIFFSYGLGLGTLVALGSYNKFTNNVYKDALIVCTVNSSTSMFAGFVIFSVIGFMAH-EQQRPVADVAASGPGLAFLVYPSAVLQLPGSPMWSCLFFFMLLLIGLDSQFCTMEGFITAIIDEWPQLLRKRKEIFIAIVCALSYLVGLTCITQGGMYIFQILDSYAVSGFCLLWLIFFECVSISWCYGVDRFYDGIKDM---IGYYPTVWWKFCWCVTTPAICLGVFFFNIVQW-TPVKYLDYSYPWWAHAFGWFTALSSMLYIPLYMFWLWKRTPGELSEKIRALVRIDEDVTRLREKMLRE----AYAKEIEFNSL 636          
BLAST of slc6a-12 vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0072362)

HSP 1 Score: 360.918 bits (925), Expect = 5.083e-115
Identity = 203/574 (35.37%), Postives = 321/574 (55.92%), Query Frame = 1
Query:  262 RIKLF*IMSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIW-NFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKS--INELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIY-ILIMYKGNWRKVFRANSTFKKME 1971
            RI +  +  + R  W  K EF+L+ IG++V +GN+WRFPY+C +NGGGAFL+PY  FL   G P+F  E+++GQF       IW    P   G+G+++  I   + +YYN ++ W +YYL  SF   LPW+ C N WNTE C          +T   F +L               S A+EF+    L   K   ++ +G     + +C    ++L Y  L   V+S GKVV+ TALAPYV+L +++++G  LPG+  GIK+YL P+W  L + KVW  AA+QIF+SLGP +G L++++S+NKFN N  R + +   I C++SF   F IFS++G+MAY+   T I +V   GPGL F+ YP+A+A + G   WS++FFL L+TLG+DS F   E +I  + DE  ++ G+ R ++   +   + L  LP  T  G  +   ++ Y   +A++ +   E+  + +FY   +  + +E M    SKP  +W   C   ++P+ LL +FI  I+ +++ +  +  +YP WS   GW++    ++ +P+  IY      KG  R+  R   +F+  +
Sbjct:   63 RILVVSVTERTRETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCM--------QVTSENFTELAT-------------SPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQK-TSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLG--SKPGLFWRI-CWTYISPVFLLTIFIFSIMGYKE-MLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFASKGGCRQ--RLQESFQPED 608          
BLAST of slc6a-12 vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0343316)

HSP 1 Score: 360.918 bits (925), Expect = 5.083e-115
Identity = 203/574 (35.37%), Postives = 321/574 (55.92%), Query Frame = 1
Query:  262 RIKLF*IMSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIW-NFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKS--INELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIY-ILIMYKGNWRKVFRANSTFKKME 1971
            RI +  +  + R  W  K EF+L+ IG++V +GN+WRFPY+C +NGGGAFL+PY  FL   G P+F  E+++GQF       IW    P   G+G+++  I   + +YYN ++ W +YYL  SF   LPW+ C N WNTE C          +T   F +L               S A+EF+    L   K   ++ +G     + +C    ++L Y  L   V+S GKVV+ TALAPYV+L +++++G  LPG+  GIK+YL P+W  L + KVW  AA+QIF+SLGP +G L++++S+NKFN N  R + +   I C++SF   F IFS++G+MAY+   T I +V   GPGL F+ YP+A+A + G   WS++FFL L+TLG+DS F   E +I  + DE  ++ G+ R ++   +   + L  LP  T  G  +   ++ Y   +A++ +   E+  + +FY   +  + +E M    SKP  +W   C   ++P+ LL +FI  I+ +++ +  +  +YP WS   GW++    ++ +P+  IY      KG  R+  R   +F+  +
Sbjct:   63 RILVVSVTERTRETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCM--------QVTSENFTELAT-------------SPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQK-TSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLG--SKPGLFWRI-CWTYISPVFLLTIFIFSIMGYKE-MLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFASKGGCRQ--RLQESFQPED 608          
BLAST of slc6a-12 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0087125)

HSP 1 Score: 359.762 bits (922), Expect = 1.580e-114
Identity = 202/574 (35.19%), Postives = 330/574 (57.49%), Query Frame = 1
Query:  283 MSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIW-NFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCY--------------SYNDIV----KSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKS--INELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVF 1941
            +S ER  WS K++F+LS IG++V + N+WRFPYLC +NGGGAFL+PY   L + G P+F  E+++GQ         W    P+F G+G+++V I+  +  YYNV++AW L +   SF   LPW+ C N WNT  C               +Y+D+     +S L    +++  ++   +      ++S+A E++    L + +S  I++LG     + +C ++ +++ Y  L   + + GKVV+FTAL PY +L +++I+G  LPGS+LGI++YL P +  +   +VW  AATQ+F+SLGP +G L++ AS+NK++ N+ + + +   I   +SF   F IFS++G+MA+   +  I  V   GPGL FV YP A+A +P    W+++FF+ LLTLG+DS F   E +I  ++DE  KIK + R ++ A +  L  +VGL   T+ G Y F ++D Y+   ++++   FE+ A+++ Y   +    I  M      P RYW   C   + PI LL + +  +I +E P+   +  YP W+   GW +A   +V +P +AI+ L+   G+ R+ F
Sbjct:   23 ISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVR-IEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIK-RNRELFVAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIG--FPPGRYWQV-CWRFVAPIFLLFITVYGLIGYE-PLTYADYVYPSWANALGWCIAGSSVVMIPAVAIFKLLSTPGSLRQRF 590          
BLAST of slc6a-12 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 403.675 bits (1036), Expect = 1.964e-129
Identity = 212/556 (38.13%), Postives = 330/556 (59.35%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIV-------KSNLTFVQ-------------FIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVM 1893
            ++ R  WSNK++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+FL EVS+GQF    P  +W   P   G G +M+ IS L+++YYN+++ W LYYL  S    LPW+ C N WNT  C   + ++         N+T ++                L N+T+D+      + S +EE++ YN L+I+K I   G     +  C  +AW++ Y  L   +KS GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L   KVW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA+   +  I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  ++DE  K   K +  +T    L   ++G P+ T +G Y+ Q+VD ++   +++IIA+FE   +++ Y  ++    IE+M     +P ++W   C   +TP  L  +    +  ++   ++ +  YP WS+  GW + I  ++ +P+M
Sbjct:  174 NKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKT----YVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVP-IESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIG--FQPNKFWRV-CWAFVTPTILTFILALSLYQWKVMTYE-DYTYPNWSMVLGWLMVICSVIWIPIM 720          
BLAST of slc6a-12 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 403.29 bits (1035), Expect = 2.307e-129
Identity = 212/556 (38.13%), Postives = 330/556 (59.35%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIV-------KSNLTFVQ-------------FIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVM 1893
            ++ R  WSNK++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+FL EVS+GQF    P  +W   P   G G +M+ IS L+++YYN+++ W LYYL  S    LPW+ C N WNT  C   + ++         N+T ++                L N+T+D+      + S +EE++ YN L+I+K I   G     +  C  +AW++ Y  L   +KS GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L   KVW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA+   +  I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  ++DE  K   K +  +T    L   ++G P+ T +G Y+ Q+VD ++   +++IIA+FE   +++ Y  ++    IE+M     +P ++W   C   +TP  L  +    +  ++   ++ +  YP WS+  GW + I  ++ +P+M
Sbjct:  166 NKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKT----YVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVP-IESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIG--FQPNKFWRV-CWAFVTPTILTFILALSLYQWKVMTYE-DYTYPNWSMVLGWLMVICSVIWIPIM 712          
BLAST of slc6a-12 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 403.29 bits (1035), Expect = 2.673e-129
Identity = 212/556 (38.13%), Postives = 330/556 (59.35%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIV-------KSNLTFVQ-------------FIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVM 1893
            ++ R  WSNK++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+FL EVS+GQF    P  +W   P   G G +M+ IS L+++YYN+++ W LYYL  S    LPW+ C N WNT  C   + ++         N+T ++                L N+T+D+      + S +EE++ YN L+I+K I   G     +  C  +AW++ Y  L   +KS GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L   KVW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA+   +  I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  ++DE  K   K +  +T    L   ++G P+ T +G Y+ Q+VD ++   +++IIA+FE   +++ Y  ++    IE+M     +P ++W   C   +TP  L  +    +  ++   ++ +  YP WS+  GW + I  ++ +P+M
Sbjct:  174 NKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKT----YVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVP-IESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIG--FQPNKFWRV-CWAFVTPTILTFILALSLYQWKVMTYE-DYTYPNWSMVLGWLMVICSVIWIPIM 720          
BLAST of slc6a-12 vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 398.282 bits (1022), Expect = 4.255e-129
Identity = 225/550 (40.91%), Postives = 335/550 (60.91%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            +  R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQFT L   G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY  MS   +LPW+ C N WNT  C       ++N TF     + +   +  N + R  S +EE++    LNI+  I   G     IL C  V+W + ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GIK+YL PQW+ +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I +  C +S Y  F IFSI+G MA+   + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  + DE      IK K     T  V ++  L+G+PLTT+AG Y   ++D Y+   +++II+      + + Y +K     +E+M   +  P   +   C   ++P  +  + I  +I + +P+   +  YP WS+  G+++A+  ++ +P+ A++ + M +G+
Sbjct:   19 NSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVSTHRANATFANMSAVVSGVTEIVNRTKR-TSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAVSWFVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCGTSVYAGFVIFSILGFMAHHLGV-DVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAVVDEIGTDWIIKNKT--YVTLGVAIIGFLLGVPLTTQAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHKNYFKDVEMM---LGFPPPIFFRICWRYVSPFIITFILIFTVIQY-KPITYNDYVYPGWSLVIGFAMALSSVICIPIYALFKIAMSEGS 560          
BLAST of slc6a-12 vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 398.282 bits (1022), Expect = 5.641e-129
Identity = 225/550 (40.91%), Postives = 335/550 (60.91%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            +  R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQFT L   G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY  MS   +LPW+ C N WNT  C       ++N TF     + +   +  N + R  S +EE++    LNI+  I   G     IL C  V+W + ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GIK+YL PQW+ +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I +  C +S Y  F IFSI+G MA+   + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  + DE      IK K     T  V ++  L+G+PLTT+AG Y   ++D Y+   +++II+      + + Y +K     +E+M   +  P   +   C   ++P  +  + I  +I + +P+   +  YP WS+  G+++A+  ++ +P+ A++ + M +G+
Sbjct:   28 NSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVSTHRANATFANMSAVVSGVTEIVNRTKR-TSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAVSWFVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCGTSVYAGFVIFSILGFMAHHLGV-DVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAVVDEIGTDWIIKNKTY--VTLGVAIIGFLLGVPLTTQAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHKNYFKDVEMM---LGFPPPIFFRICWRYVSPFIITFILIFTVIQY-KPITYNDYVYPGWSLVIGFAMALSSVICIPIYALFKIAMSEGS 569          
BLAST of slc6a-12 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 412.535 bits (1059), Expect = 1.739e-134
Identity = 225/553 (40.69%), Postives = 337/553 (60.94%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYC---YSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            + +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +PIF G+G+ M+ +S  + +YYNVV+    YY   S N +LPW+ C N WNTE C    S N     N++      L N+T+   N +++  S +EE++  + LNI+  I + G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   + T  V ++  L+G+PLTT+AG Y   ++D Y+   +++II+     A+ + Y ++     IE+M   +  P   +   C    +P  +  + I  +I + +P+   +  YP W++  G+ +A+  ++ +P+ A++ +   +G+
Sbjct:   24 NPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQH--SLLNLTM-GLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGV-DVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKT--LVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMM---LGFPPPLFFQFCWRFFSPAIIFFILIFTVIQY-RPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGH 566          
BLAST of slc6a-12 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 412.535 bits (1059), Expect = 1.786e-134
Identity = 225/553 (40.69%), Postives = 337/553 (60.94%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYC---YSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            + +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +PIF G+G+ M+ +S  + +YYNVV+    YY   S N +LPW+ C N WNTE C    S N     N++      L N+T+   N +++  S +EE++  + LNI+  I + G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   + T  V ++  L+G+PLTT+AG Y   ++D Y+   +++II+     A+ + Y ++     IE+M   +  P   +   C    +P  +  + I  +I + +P+   +  YP W++  G+ +A+  ++ +P+ A++ +   +G+
Sbjct:   22 NPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQH--SLLNLTM-GLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGV-DVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKT--LVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMM---LGFPPPLFFQFCWRFFSPAIIFFILIFTVIQY-RPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGH 564          
BLAST of slc6a-12 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 412.535 bits (1059), Expect = 1.838e-134
Identity = 225/553 (40.69%), Postives = 337/553 (60.94%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYC---YSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            + +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +PIF G+G+ M+ +S  + +YYNVV+    YY   S N +LPW+ C N WNTE C    S N     N++      L N+T+   N +++  S +EE++  + LNI+  I + G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   + T  V ++  L+G+PLTT+AG Y   ++D Y+   +++II+     A+ + Y ++     IE+M   +  P   +   C    +P  +  + I  +I + +P+   +  YP W++  G+ +A+  ++ +P+ A++ +   +G+
Sbjct:   19 NPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQH--SLLNLTM-GLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGV-DVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKT--LVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMM---LGFPPPLFFQFCWRFFSPAIIFFILIFTVIQY-RPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGH 561          
BLAST of slc6a-12 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 412.535 bits (1059), Expect = 1.864e-134
Identity = 225/553 (40.69%), Postives = 337/553 (60.94%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYC---YSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            + +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +PIF G+G+ M+ +S  + +YYNVV+    YY   S N +LPW+ C N WNTE C    S N     N++      L N+T+   N +++  S +EE++  + LNI+  I + G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   + T  V ++  L+G+PLTT+AG Y   ++D Y+   +++II+     A+ + Y ++     IE+M   +  P   +   C    +P  +  + I  +I + +P+   +  YP W++  G+ +A+  ++ +P+ A++ +   +G+
Sbjct:   22 NPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQH--SLLNLTM-GLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGV-DVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKT--LVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMM---LGFPPPLFFQFCWRFFSPAIIFFILIFTVIQY-RPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGH 564          
BLAST of slc6a-12 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 412.149 bits (1058), Expect = 2.000e-134
Identity = 225/553 (40.69%), Postives = 337/553 (60.94%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYC---YSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            + +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +PIF G+G+ M+ +S  + +YYNVV+    YY   S N +LPW+ C N WNTE C    S N     N++      L N+T+   N +++  S +EE++  + LNI+  I + G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   + T  V ++  L+G+PLTT+AG Y   ++D Y+   +++II+     A+ + Y ++     IE+M   +  P   +   C    +P  +  + I  +I + +P+   +  YP W++  G+ +A+  ++ +P+ A++ +   +G+
Sbjct:   15 NPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQH--SLLNLTM-GLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGV-DVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKT--LVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMM---LGFPPPLFFQFCWRFFSPAIIFFILIFTVIQY-RPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGH 557          
BLAST of slc6a-12 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 396.741 bits (1018), Expect = 1.020e-126
Identity = 218/568 (38.38%), Postives = 329/568 (57.92%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCY-------------SYNDIVKSNLTFVQFIDLKNITLDSFNSSIR--WRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            ++ R  WS+K++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+F  EVS+GQF    P  +W   P   G G +M+ IS L+++YYNV++ + L+YL  SF  VLPW  C N WNT  C               +  I   N TF       N+T+ +F S     + S +EE++ Y  L I+  I   G     +  C  +AW++ Y  L   +KS GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L    VW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA    + +I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  I+DE  K     + ++T    +   ++G P+ T+ G Y+FQ+VD Y+   A++IIA+FE   +++ Y  ++    IE+M     KP  +W   C   +TP  L  +       +E P+   +  YP WS+  GW +    ++ +P+M  +++ MY    R + R
Sbjct:  182 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFC-MTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIG--FKPNIFWKV-CWAFVTPTILTFILCFSFYQWE-PMTYGSYRYPNWSMVLGWLMLACSVIWIPIM--FVIKMYLAPGRFIER 741          
BLAST of slc6a-12 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 396.741 bits (1018), Expect = 1.020e-126
Identity = 218/568 (38.38%), Postives = 329/568 (57.92%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCY-------------SYNDIVKSNLTFVQFIDLKNITLDSFNSSIR--WRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            ++ R  WS+K++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+F  EVS+GQF    P  +W   P   G G +M+ IS L+++YYNV++ + L+YL  SF  VLPW  C N WNT  C               +  I   N TF       N+T+ +F S     + S +EE++ Y  L I+  I   G     +  C  +AW++ Y  L   +KS GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L    VW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA    + +I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  I+DE  K     + ++T    +   ++G P+ T+ G Y+FQ+VD Y+   A++IIA+FE   +++ Y  ++    IE+M     KP  +W   C   +TP  L  +       +E P+   +  YP WS+  GW +    ++ +P+M  +++ MY    R + R
Sbjct:  182 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFC-MTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIG--FKPNIFWKV-CWAFVTPTILTFILCFSFYQWE-PMTYGSYRYPNWSMVLGWLMLACSVIWIPIM--FVIKMYLAPGRFIER 741          
BLAST of slc6a-12 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 396.741 bits (1018), Expect = 1.020e-126
Identity = 218/568 (38.38%), Postives = 329/568 (57.92%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCY-------------SYNDIVKSNLTFVQFIDLKNITLDSFNSSIR--WRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            ++ R  WS+K++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+F  EVS+GQF    P  +W   P   G G +M+ IS L+++YYNV++ + L+YL  SF  VLPW  C N WNT  C               +  I   N TF       N+T+ +F S     + S +EE++ Y  L I+  I   G     +  C  +AW++ Y  L   +KS GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L    VW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA    + +I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  I+DE  K     + ++T    +   ++G P+ T+ G Y+FQ+VD Y+   A++IIA+FE   +++ Y  ++    IE+M     KP  +W   C   +TP  L  +       +E P+   +  YP WS+  GW +    ++ +P+M  +++ MY    R + R
Sbjct:  182 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFC-MTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIG--FKPNIFWKV-CWAFVTPTILTFILCFSFYQWE-PMTYGSYRYPNWSMVLGWLMLACSVIWIPIM--FVIKMYLAPGRFIER 741          
BLAST of slc6a-12 vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 385.571 bits (989), Expect = 2.949e-124
Identity = 218/547 (39.85%), Postives = 328/547 (59.96%), Query Frame = 1
Query:  295 RAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDS-FNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK--IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY   S   VLPW+ C N WNT  C    D   SNLT        +  L   FN +++  S +EE++    L ++  I   G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ ++G  L G++ GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE     I  K  ++ T  V +   L+G+PLT++AG Y   ++D Y+   ++++I+     ++ + Y ++     I++M   +  P   +   C   ++P  +  + I  +I + +P+   +  YP W++  G+ +A+  ++ +P+ A++ L    G+
Sbjct:   27 RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLD--ASNLTNGSRPAALSGNLSHLFNYTLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGV-DVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYV-TLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNYFQDIQMM---LGFPPPLFFQICWRFVSPAIIFFILIFTVIQY-RPITYNHYQYPGWAVAIGFLMALSSVICIPLYALFQLCRTDGD 565          
BLAST of slc6a-12 vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 385.571 bits (989), Expect = 2.949e-124
Identity = 218/547 (39.85%), Postives = 328/547 (59.96%), Query Frame = 1
Query:  295 RAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDS-FNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK--IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY   S   VLPW+ C N WNT  C    D   SNLT        +  L   FN +++  S +EE++    L ++  I   G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ ++G  L G++ GI +YL PQW  +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE     I  K  ++ T  V +   L+G+PLT++AG Y   ++D Y+   ++++I+     ++ + Y ++     I++M   +  P   +   C   ++P  +  + I  +I + +P+   +  YP W++  G+ +A+  ++ +P+ A++ L    G+
Sbjct:   27 RGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLD--ASNLTNGSRPAALSGNLSHLFNYTLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGV-DVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYV-TLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNYFQDIQMM---LGFPPPLFFQICWRFVSPAIIFFILIFTVIQY-RPITYNHYQYPGWAVAIGFLMALSSVICIPLYALFQLCRTDGD 565          
BLAST of slc6a-12 vs. UniProt/SwissProt
Match: sp|A7Y2W8|SC6A9_XENLA (Sodium- and chloride-dependent glycine transporter 1 OS=Xenopus laevis OX=8355 GN=slc6a9 PE=2 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 2.421e-131
Identity = 224/551 (40.65%), Postives = 332/551 (60.25%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYC---YSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            +R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQF      G+W  +PIF G+G+ M+ +S  + +YYNVV+    YY   S N VLPW+ C N WNT  C    S N     NL+  Q            N +++  S +EE++  + L I++ I + G     +L C  V+W++ ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GI +YL PQW  +L   VW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA    + D+++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  + DE      I+ K   + T  V ++  L+G+PLTT+AG Y   ++D Y+   +++II+     A+ + Y ++K    IE+M   +  P   +   C   ++P  +  + I  +I + +P+   +  YP W+I  G+ +A+  ++ +P+ AI+ +   +G+
Sbjct:   21 KRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRVLPWTYCNNLWNTNNCAGVLSPNSSASFNLSSQQ---NLLNLTLGLNQTLKRTSPSEEYWRRHVLKISEDIGDFGEVQLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAINGILYYLTPQWDKILHAMVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGV-DVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAVVDEIGNDWIIRWKT--LVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRKYFKDIEMM---LGFPPPLFFQICWRFISPGIIFFILIFTVIQY-RPIQYNDYLYPDWAITIGFLMALSSVICIPLYAIFKIWCSEGD 561          
BLAST of slc6a-12 vs. UniProt/SwissProt
Match: sp|A7Y2X0|SC6A5_XENLA (Sodium- and chloride-dependent glycine transporter 2 OS=Xenopus laevis OX=8355 GN=slc6a5 PE=2 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.774e-128
Identity = 213/568 (37.50%), Postives = 341/568 (60.04%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYN-------------DIVKSNLTFVQFIDLKNITLDSFNS--SIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            ++ R  WSNK++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+F  EV++GQF    P  +W   P   G G +M+ IS L+++YYN+++ + ++YL  S  +VLPW+ C N WNT  C   +             +I   N TF       N+T+ +F S  +  + S +EE++ YN L I+  I   G     ++ C  +AWI+ Y  L   +K+ GKVVY TA  PYV+L +++ +G  LPG+  GI ++++P+W+ L+   VW  AATQIF+SL  AWGGLI+++S+NKF+ N+ R + ++  I   +S +  F IFS+IG MA+I N+ DI +V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  ++DE  K+    + ++T    +   ++G P+ T+ G Y+ Q+VD Y+   +++IIA+FE   +++ Y  ++    IE+M     +P R+W   C   +TP  L  +       +E P+   + HYP WS+  GW +    ++ +P+M +  + +  G + +  +
Sbjct:  181 NKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFKNGGGAFLIPYLTMLALAGLPIFYLEVALGQFASQGPISVWKAIPALQGCGIAMLIISVLIAIYYNIIMCYTIFYLFASLVYVLPWASCNNPWNTPDCKDKDRLLLDSCIISSQPNIQIKNSTFC-MTAYPNLTMVNFTSHGNKSFVSGSEEYFKYNMLKISAGIEYPGEIRWPLVFCLFLAWIIVYASLAKGIKTSGKVVYSTATFPYVVLVILLFRGVTLPGAGDGIWWFIMPKWEKLMDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNLYRDTLIVTCINSATSIFAGFVIFSVIGFMAHILNV-DIEKVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKLLRTHKPLFTLVCCVAFFIMGFPMITQGGIYMLQLVDNYAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIG--FQPSRFWKI-CWAFVTPTILTFILGFSFYQWE-PMTYGSYHYPSWSMVMGWLMLACSVIWIPIMFVIKMFLAPGTFIERLK 742          
BLAST of slc6a-12 vs. UniProt/SwissProt
Match: sp|Q761V0|SC6A5_MOUSE (Sodium- and chloride-dependent glycine transporter 2 OS=Mus musculus OX=10090 GN=Slc6a5 PE=1 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 7.887e-126
Identity = 218/568 (38.38%), Postives = 329/568 (57.92%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCY-------------SYNDIVKSNLTFVQFIDLKNITLDSFNSSIR--WRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            ++ R  WS+K++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+F  EVS+GQF    P  +W   P   G G +M+ IS L+++YYNV++ + L+YL  SF  VLPW  C N WNT  C               +  I   N TF       N+T+ +F S     + S +EE++ Y  L I+  I   G     +  C  +AW++ Y  L   +KS GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L    VW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA    + +I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  I+DE  K     + ++T    +   ++G P+ T+ G Y+FQ+VD Y+   A++IIA+FE   +++ Y  ++    IE+M     KP  +W   C   +TP  L  +       +E P+   +  YP WS+  GW +    ++ +P+M  +++ MY    R + R
Sbjct:  190 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFC-MTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIG--FKPNIFWKV-CWAFVTPTILTFILCFSFYQWE-PMTYGSYRYPNWSMVLGWLMLACSVIWIPIM--FVIKMYLAPGRFIER 749          
BLAST of slc6a-12 vs. UniProt/SwissProt
Match: sp|Q9Y345|SC6A5_HUMAN (Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3)

HSP 1 Score: 394.815 bits (1013), Expect = 5.007e-125
Identity = 211/567 (37.21%), Postives = 330/567 (58.20%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLK------------NITLDSFNSSIR--WRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            ++ R  WS+K++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+F  EVS+GQF    P  +W   P   G G +M+ IS L+++YYNV++ + L+YL  SF  VLPW  C N WNT  C     ++  +        ++            N+T+ +F S     + S +EE++ Y  L I+  I   G     + +C  +AW++ Y  L   +K+ GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L    VW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA    + +I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  I+DE  K     + ++T    +   ++G P+ T+ G Y+FQ+VD Y+   A++IIA+FE   +++ Y  ++    IE+M     +P  +W   C   +TP  L  +       +E P+   +  YP WS+  GW +    ++ +P+M  +++ M+    R + R
Sbjct:  188 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIG--FQPNIFWKV-CWAFVTPTILTFILCFSFYQWE-PMTYGSYRYPNWSMVLGWLMLACSVIWIPIM--FVIKMHLAPGRFIER 747          
BLAST of slc6a-12 vs. UniProt/SwissProt
Match: sp|P58295|SC6A5_RAT (Sodium- and chloride-dependent glycine transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a5 PE=1 SV=2)

HSP 1 Score: 394.43 bits (1012), Expect = 7.169e-125
Identity = 216/568 (38.03%), Postives = 329/568 (57.92%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCY-------------SYNDIVKSNLTFVQFIDLKNITLDSFNSSIR--WRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            ++ R  WS+K++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L + G P+F  EVS+GQF    P  +W   P   G G +M+ IS L+++YYNV++ + L+YL  SF  VLPW  C N WNT  C               +  I   N TF       N+T+ +F S     + S +EE++ Y  L I+  I   G     +  C  +AW++ Y  L   +K+ GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L    VW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA    + +I  V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  I+DE  K     + ++T    +   ++G P+ T+ G Y+FQ+VD Y+   A++IIA+FE   +++ Y  ++    IE+M     +P  +W   C   +TP  L  +       +E P+   +  YP WS+  GW +    ++ +P+M  +++ MY    R + R
Sbjct:  190 NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFC-MTAYPNLTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKV-NIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIG--FQPNIFWKV-CWAFVTPTILTFILCFSFYQWE-PMTYGSYRYPNWSMVLGWLMLACSVIWIPIM--FVIKMYLAPGRFIER 749          
BLAST of slc6a-12 vs. TrEMBL
Match: A0A0H3YF52 (Transporter OS=Schmidtea mediterranea OX=79327 GN=slc6a-12 PE=2 SV=1)

HSP 1 Score: 1152.12 bits (2979), Expect = 0.000e+0
Identity = 583/583 (100.00%), Postives = 583/583 (100.00%), Query Frame = 1
Query:  283 MSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELLRSNTTISATLDIEKNSLV 2031
            MSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPISLLIVFINIIINFEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELLRSNTTISATLDIEKNSLV
Sbjct:    1 MSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPISLLIVFINIIINFEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELLRSNTTISATLDIEKNSLV 583          
BLAST of slc6a-12 vs. TrEMBL
Match: A0A4S2M011 (Transporter OS=Opisthorchis felineus OX=147828 GN=CRM22_003815 PE=3 SV=1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 270/559 (48.30%), Postives = 374/559 (66.91%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFK 1962
             + R  W  +IEF+LS +GYSVG+GNIWRFPYLCM+NGGGAFL+PY  +L +CG  +F  E +IGQ TGLS   I++  P F+GLGW MV  SG+LS+YYN++VA+ +YY+GMSFNWVLPWS C N WNT  C+S++             +  N +L   ++ +R R++AEEF+ YN L I++ I+ L G    +L+  I AWILT+VC+   + S GKVVY TA APY+ LTVI+I+G  LPG+W GIKFY+VP W  L S+ VW +AATQIFYSLGPAWGGLI+  SFNK+  N+ R + +IPIIC  +S YG FAIFS+IGH+ Y T   D  Q ++ GPGLAF+AYPQA+ +LPG AIWSVLFFL L TLG+DS F+T E +  G+ D   +I GK R + T  V  +  L+GL L TRAG Y F+++D Y+T  +V++I   E+  +++ Y  ++L+  IE M   + K  RYW  S  C   P+  L + ++  ++  Q   +K + +P+W+I  GW+++ L  V  P+MAI  +  +  NWRK+FR +  ++
Sbjct:   45 EKPRLHWGKQIEFLLSCVGYSVGLGNIWRFPYLCMQNGGGAFLVPYILYLILCGTALFFMETAIGQSTGLSTIRIFSMIPFFSGLGWCMVFASGILSIYYNIIVAYTIYYIGMSFNWVLPWSHCDNEWNTPQCFSFSGN-----------ETNNQSLHGLSTGVR-RTAAEEFWRYNVLEISEDISILNGIQWKLLLALIAAWILTFVCMCKGILSSGKVVYVTATAPYIFLTVILIRGCTLPGAWYGIKFYIVPDWNRLKSIDVWISAATQIFYSLGPAWGGLITFGSFNKYTHNVQRDAILIPIICGSTSIYGGFAIFSVIGHLMYATGTNDTEQFVQQGPGLAFIAYPQALTMLPGAAIWSVLFFLMLFTLGIDSQFSTLEAVTTGLNDRFPRIVGKHRMLLTLVVCFVEFLLGLILVTRAGFYYFELLDTYATAFSVVVIGFLETIVISYLYGARRLLDDIEWMIGPMRKATRYWWISLWCVFVPVLTLAIIVSTFVSHAQSAEEKLRKFPEWAIIVGWTISCLSFVQFPIMAIVAVSRHGCNWRKLFRPDDEWE 591          
BLAST of slc6a-12 vs. TrEMBL
Match: A0A183A6B2 (Transporter OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2497 PE=3 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 273/558 (48.92%), Postives = 389/558 (69.71%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIY-TASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFK 1962
            +R+ WS +IEF LS IGYSVG+GN+WRFPYLCM+ GGGAFLIPYF +L  CG  +F  E +IGQ TGLS   I+N  P+F GLGW+MV  SG+LS+YYN+++AWVLY++GMSF+W LPWS C N WNT  C++Y++    NL   Q  D  N +L    S+   RS+AEEF+L+N L I+++IN +GG N  +L+    AWILT+VC+   ++S GKVVY TA  PY+ LTVI+I+G  LPG+W G+KFY++P W  L  ++VW  AATQIFYSLGPAWGGLI+ AS+NK++ N+ R + ++P IC ++SFYG FAIFS++GH+ YIT  +D TQ+I  GPGLAFVAYPQA+  LPG  +WSVLFFL LLTLGMDS FAT E +  G+ D+   +  + +H++ T +V ++  L+GL LTTRAG Y F+++D Y+T  +V++I   E+  +A+FY  K+L+  IE M   + +  R W     C L P+ +L++ ++  ++  +    K K +P W+I  GW +A L  V +P+MA+  ++ +  +W+K+  ++S ++
Sbjct:   62 QRSGWSKQIEFALSCIGYSVGLGNLWRFPYLCMKYGGGAFLIPYFIYLVACGMSLFFMETAIGQSTGLSTIRIFNMIPLFQGLGWAMVFASGILSIYYNIIIAWVLYFMGMSFHWNLPWSNCENLWNTAQCFTYSE----NLNMTQMAD--NFSLKWNTSAEVRRSAAEEFWLFNVLEISENINVIGGINWKLLVSLTAAWILTFVCMCKGIRSSGKVVYVTATMPYIFLTVILIRGCTLPGAWEGLKFYILPDWNRLADIEVWIAAATQIFYSLGPAWGGLITFASYNKYHHNVQRDAIILPAICGLTSFYGGFAIFSVLGHLMYITGQSDNTQLIRQGPGLAFVAYPQALCTLPGSPVWSVLFFLMLLTLGMDSQFATLEAVTTGLTDQFPHLFRR-KHVWLTLAVCVMEYLLGLILTTRAGFYYFELLDNYATAFSVVVIGFIETIVIAYFYGAKRLLDDIEWMLGPMHRLTRIWWILAWCLLVPLMILVIIVSTFVSHVEQAEAKQKQFPVWAIAVGWVIACLSFVEIPIMAVVAIVRHGWDWKKLLLSSSEWR 612          
BLAST of slc6a-12 vs. TrEMBL
Match: H2KQC2 (Transporter OS=Clonorchis sinensis OX=79923 GN=SLC6A5 PE=3 SV=1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 270/559 (48.30%), Postives = 371/559 (66.37%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFK 1962
             + R  W  +IEF+LS +GYSVG+GNIWRFPYLCM+NGGGAFL+PY  +L ICG  +F  E +IGQ TGLS   I++  P F+GLGW MV  SG+LS+YYN++VA+ +YY+GMSF WVLPWS C N WNT  C+S++    SN + +             ++ +R R++AEEF+ YN L I++ I+ L G    +L+  I AWILT+VC+   + S GKVVY TA APY+ LTVI+I+G  LPG+W GIKFY+VP W  L S+ VW +AATQIFYSLGPAWGGLI+  SFNK+  N+ R + +IPIIC  +S YG FAIFS+IGH+ + T   D  Q ++ GPGLAF+AYPQA+ +LPG AIWSVLFFL L TLG+DS F+T E +  G+ D   +I GK R + T  V  +  L+GL L TRAG Y F+++D Y+T  +V++I   ES  + + Y  ++L+  IE M   + K  RYW     C   P+  L + ++  ++  Q   +K K +P+W+I  GW+++ L  V  P+MAI  +  +  NWRK+FR +  ++
Sbjct:   45 EKPRHHWGKQIEFLLSCVGYSVGLGNIWRFPYLCMQNGGGAFLVPYILYLIICGTALFFMETAIGQSTGLSTIRIFSMIPFFSGLGWCMVFASGILSIYYNIIVAYTIYYIGMSFTWVLPWSHCDNEWNTPQCFSFSGNETSNQSLI-----------GLSTGVR-RTAAEEFWRYNVLEISEDISVLNGIQWKLLLALIAAWILTFVCMCKGILSSGKVVYVTATAPYIFLTVILIRGCTLPGAWYGIKFYIVPDWSRLKSIDVWISAATQIFYSLGPAWGGLITFGSFNKYTHNVQRDAILIPIICGSTSIYGGFAIFSVIGHLMHATGTNDTEQFVQQGPGLAFIAYPQALTMLPGAAIWSVLFFLMLFTLGIDSQFSTLEAVTTGLNDRFPRIVGKHRMLLTLVVCFVEFLLGLILVTRAGFYYFELLDTYATAFSVVVIGFLESIVIGYLYGAQRLLDDIEWMIGPMRKATRYWWILLWCFFVPVLTLAIIVSTFVSHAQSAEEKLKKFPEWAIIVGWTISCLSFVQFPIMAIVAVSRHGCNWRKLFRPDDEWE 591          
BLAST of slc6a-12 vs. TrEMBL
Match: A0A074ZG21 (Transporter OS=Opisthorchis viverrini OX=6198 GN=T265_06497 PE=3 SV=1)

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 270/572 (47.20%), Postives = 376/572 (65.73%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELLRSNTTISA 2001
             + R  W  +IEF+LS +GYSVG+GNIWRFPYLCM+NGGGAFL+PY  +L ICG  +F  E +IGQ TGLS   I++  P F+GLGW MV  SG+LS+YYN++VA+ +YY+GMSFNWVLPWS C N WNT  C+S++             D  N +L   ++ +R R++AEEF+ YN L I++ I+ L G    +L+  I AWILT+VC+   + S GKVVY TA APY+ LTVI+I+G  LPG+W GIKFY+VP W  L S+ VW +AATQIFYSLGPAWGGLI+  SFNK+  N+ R + +IPIIC  +S YG FAIFS+IGH+ + T   D  Q ++ GPGLAF+AYPQA+ +LPG AIWSVLFF  L TLG+DS F+T E +  G+ D   +I  + R + T +V  +  L+GL L TRAG Y F+++D Y+T  +V++I   ES  +++ Y  ++L+  IE M   + K  RYW     C   P+    + ++  ++  Q   +K K +P+W+I  GW+++ L  V  P+MAI  ++ +  NWRK+FR +  ++ +   R     S+
Sbjct:   50 EKPRHHWGKQIEFLLSCVGYSVGLGNIWRFPYLCMQNGGGAFLVPYILYLIICGTALFFMETAIGQSTGLSTIRIFSMIPFFSGLGWCMVFASGILSIYYNIIVAYTIYYIGMSFNWVLPWSHCNNPWNTPQCFSFSGN-----------DTNNQSLIGLSTGMR-RTAAEEFWRYNVLEISEDISVLNGIQWKLLLALIAAWILTFVCMCKGILSSGKVVYVTATAPYIFLTVILIRGCTLPGAWYGIKFYIVPDWSRLKSIDVWISAATQIFYSLGPAWGGLITFGSFNKYTHNVQRDAILIPIICGSTSIYGGFAIFSVIGHLMHATGTNDTEQFVQQGPGLAFIAYPQALTMLPGAAIWSVLFFFMLFTLGIDSQFSTLEAVTTGLNDRFPRIVRRRRMLLTLAVCFVEFLLGLILVTRAGFYYFELLDTYATAFSVVVIGFLESIVISYLYGAQRLLDDIEWMIGPMRKVTRYWWILLWCFFVPVLTFAIIVSTFVSHAQSAEEKLKKFPEWAIIIGWTISCLSFVQFPIMAIVAVVRHGCNWRKLFRPDDEWEIVVQTRRKECQSS 609          
BLAST of slc6a-12 vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 397.127 bits (1019), Expect = 1.374e-128
Identity = 224/550 (40.73%), Postives = 335/550 (60.91%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            +  R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQFT L   G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY  MS   +LPW+ C N WNT  C       + N +      + +   +  N + R  S +EE++    LNI+  I   G     IL C  ++W++ ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GIK+YL PQW+ +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I +  C +S Y  F IFSI+G MA+   + D++QV + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   I T  V ++  L+G+PLTTRAG Y   ++D Y+   +++II+      + + Y ++     +E+M   +  P   +   C   ++P+ +  + I  +I + +P+   +  YP+WS+  G+ +A+  ++ +PV A++ +   +G+
Sbjct:   24 NSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKR-TSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGV-DVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKT--IITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMM---LGFPPPIFFRICWRFISPLIISFILIFTVIQY-KPITYNDYVYPRWSLVIGFCMALSSVICIPVYALFKIATSEGS 565          
BLAST of slc6a-12 vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 396.741 bits (1018), Expect = 1.951e-128
Identity = 224/550 (40.73%), Postives = 335/550 (60.91%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGN 1926
            +  R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF+ PYF  L  CG P+F  E+S GQFT L   G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY  MS   +LPW+ C N WNT  C       + N +      + +   +  N + R  S +EE++    LNI+  I   G     IL C  ++W++ ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GIK+YL PQW+ +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I +  C +S Y  F IFSI+G MA+   + D++QV + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   I T  V ++  L+G+PLTTRAG Y   ++D Y+   +++II+      + + Y ++     +E+M   +  P   +   C   ++P+ +  + I  +I + +P+   +  YP+WS+  G+ +A+  ++ +PV A++ +   +G+
Sbjct:   28 NSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKR-TSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGV-DVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKT--IITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMM---LGFPPPIFFRICWRFISPLIISFILIFTVIQY-KPITYNDYVYPRWSLVIGFCMALSSVICIPVYALFKIATSEGS 569          
BLAST of slc6a-12 vs. Ensembl Cavefish
Match: ENSAMXT00000015774.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:26496274:26511103:1 gene:ENSAMXG00000015324.2 transcript:ENSAMXT00000015774.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 371.318 bits (952), Expect = 1.916e-119
Identity = 206/560 (36.79%), Postives = 325/560 (58.04%), Query Frame = 1
Query:  289 QERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWN-FAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKI--KGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWY-STPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANST 1956
            ++R  WSNK+EFVLS  G  +G+GN+WRFPYLC +NGGGAF IPY  FL  CG P+F  E ++GQ+T       W   +P+F G+G++   I  LL++YY +V+AW ++YL  SF+  LPWS C N WNTE C  +    +S       ID +++     N++    S   EF+    L I+  I+E+G  +  +++C ++AWIL Y C+   VKS GKVVYFTA  PY++L +++I+G  LPG+ +GI+FYL P    L   +VW  A TQIF+S     G L ++ S+NK+N N  +    +  +   +SF   FAIFSI+G M++  N+  I++V ESGPGLAF+AYP+A++++P   +W+  FF+ ++ LG+DS F   E+L+  + D       +   R +   +V +   L+GL + T+ G Y+FQ+ D+Y ++ + ++ +A+FE+  +A+ Y   +   +IE M      P   ++  C   LTP +    F   +I +    ++    YP W    GW LA+  +V +P+  +Y +   KG  ++V   N +
Sbjct:   22 KDRGQWSNKLEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYLIFLATCGIPVFFLETALGQYTSEGGITCWRKISPLFEGVGYATQVIVALLNVYYIIVLAWGIFYLAFSFSSNLPWSSCNNTWNTEACMEFQRRNES-------IDQRHME----NAT----SPVIEFWERRVLRISSGIDEIGELHWDMVLCLLLAWILCYFCIWKGVKSTGKVVYFTATFPYLMLLILLIRGITLPGASIGIQFYLYPDLGRLADPQVWMDAGTQIFFSYAICLGCLTALGSYNKYNNNCYKDCLALCFLNSGTSFVAGFAIFSILGFMSFEQNV-HISEVAESGPGLAFIAYPRAVSMMPFSPLWACFFFIMIVLLGLDSQFVCVESLVTAMVDMYPSTFRRKNRRELLILAVAICSFLLGLIMLTQGGMYVFQLFDYYAASGMCLLFVAIFETVCIAWIYGADRFYDNIEDMIGYRPGP---YIKFCWLFLTPATCFGTFAFSLIKYTPLKYNNEYVYPWWGYALGWLLALSSMVCIPLWIMYKMGTTKGTLKEVRPLNHS 562          
BLAST of slc6a-12 vs. Ensembl Cavefish
Match: slc6a7 (sodium-dependent proline transporter-like [Source:NCBI gene;Acc:103039122])

HSP 1 Score: 371.318 bits (952), Expect = 1.456e-118
Identity = 199/469 (42.43%), Postives = 282/469 (60.13%), Query Frame = 1
Query:  295 RAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKS--INELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRH--IYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIM 1689
            R  W  K EF+LS IGY VG+GN+WRFPYLC  NGGG FLIPYF  LF  G P+FL E+S+GQ+    P  +W   P+  G+G  M+C+S L+ LYYNV++AW  YYLG SF   LPWS C    N + C       ++N          N TL          S +E F+    L ++ S  ++  G     + +C + AW++ ++C++  ++S GKVVY TA  PY++L V+II+G+ L GS  G+ FYL P W  L + +VW  AA+QIFYSLG   GGL+SMAS+NKF+ N++R + +I I  C +SF+  FAIFSI+GHMA+   +  + +V  SGPGLAFVAYP+A+ALLPG   W++LFFL L  LG+D++F   E +   + DE  +++  +++  ++   +     L+GL L T  G Y F ++D  ST   +III LF    ++FFY   +    I  M
Sbjct:   79 REQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRNGGGVFLIPYFIMLFFTGMPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWS-CDAIANAKLC-------RNN---------TNGTL----------SPSEFFWNERVLGVSHSTGLSNPGPVRWQLALCLLAAWVIIFLCMLKGIRSSGKVVYVTATFPYLVLVVLIIRGATLEGSLQGVAFYLTPVWGRLANAQVWNDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTLVITIGNCATSFFAGFAIFSILGHMAWRKGV-PVEKVAISGPGLAFVAYPEALALLPGSVFWAILFFLMLFMLGVDTLFGNMEGITTAVLDEFPQLRSNMKYKTLFLGLLCFGFYLMGLLLVTNGGIYWFTLIDSSSTSFGLIIITLFMCLGISFFYGVNQFCQDIVDM 519          
BLAST of slc6a-12 vs. Ensembl Cavefish
Match: slc6a8 (solute carrier family 6 member 8 [Source:NCBI gene;Acc:103036862])

HSP 1 Score: 365.155 bits (936), Expect = 1.576e-116
Identity = 215/601 (35.77%), Postives = 341/601 (56.74%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYC---YSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKI-----RHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYS-TPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANST----FKKMELLRSNTTISATLDI----EKNSLV*LFE 2043
            ER  W+ +++F++S +G++VG+GN+WRFPYLC +NGGG FLIPY  F+F+ G P+F  E+++GQF       +WN AP+F GLG++ + I    + YY +V+AW  YYL  SFN  LPWS C N WNT+ C   + + D     +    F    N+T +   +    RS   EF+    LNI+  +++ G  N  +++C +  W++ Y C+   VKS GK+VYFTA  PYV+L +++++G  LPG++ GI +YL P W  L   +VW  A TQIF+S     G L ++ S+N+FN +  + + M+ +I   +SF+  F +FSI+G MA    + DI++V ESGPGLAF+AYP+A++L+P   +W+ LFF  LL LG+DS F   E  + GI D      GK      R I  A   LL  ++ L + T+ G Y+FQ+ D+YS + + ++  A +E   +A+ Y   K +  I  M      P   W+  C   +TP   + +F+  ++N++   ++    YP W    GW LA+  ++ +PV  +Y L   KG +R+ +   +        +E +  +T I +   +    E+N ++ +FE
Sbjct:   43 ERETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLFIFLGGIPIFFLEIALGQFMKAGSINVWNIAPLFKGLGYASMVIVFFCNTYYIMVLAWGFYYLIKSFNGTLPWSSCDNEWNTDTCIEIFRHEDCQNGTIGNATF---GNLTCEELANG---RSPIIEFWENKVLNISDGLDQPGALNWELMLCLLAVWVMVYFCVWKGVKSTGKIVYFTATFPYVVLIILLVRGVTLPGAYDGIMYYLKPNWSKLGEPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNDCYKDAFMLAMINSGTSFFAGFVVFSILGFMASEQGV-DISKVAESGPGLAFIAYPKAVSLMPVAPVWAALFFFMLLLLGLDSQFVGVEGFVTGILD---LFPGKYYMRYRREIAVAICCLLCFIIDLSMVTQGGMYVFQLFDYYSASGMTLLWQAFWECVVVAWVYGADKFMDDIARMIGYRPFP---WMKWCWSFITPCVCMGIFLFHLLNYKPLTYNNVYVYPWWGEVIGWCLALSSMLCIPVSLVYKLSGAKGTFRERWETLTKPVWGAHHLEYMAPDTDIKSLASLSPGTEENKVI-IFE 629          
BLAST of slc6a-12 vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 367.851 bits (943), Expect = 1.953e-119
Identity = 202/555 (36.40%), Postives = 324/555 (58.38%), Query Frame = 1
Query:  295 RAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCM---SSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYS-TPIAVIIIALFESFALAFFYNYKKLITHI-EIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            R  W  + +F++S +GY++G+GN+WRFPYLC +NGGGAFLIPYF  L   G P+FL E S+GQ+T +   G+W  AP+F G+G + V IS  L++YY V+++W +YYL  SF  +LPW  C N WNT+ C+S   I          +D  N+T           S+  EF+  N   ++  ++E G     + I   ++W++ Y C+   V   GKVVYF+A  PYV+L V+  +G  LPG+  GI FY+ P ++ L    VW  AATQIF+S G   G L+++ S+N F+ N+    ++  I+CC+   +S +  F IFSI+G M++IT    + ++  SGPGLAF+AYPQA+  LP   +WS+LFF  LL LG+DS F T E  +  ++DE  +     + I+ A + ++  ++GL   T+ G Y+F++ D+YS + ++++ +  FE+ A+++ Y   +   +I E++  +V K    W   C    TP+ ++ VF+  ++    P+   +  YP W    GW +A+  ++ +P   +Y+ ++ KG  R+V R
Sbjct:   10 RGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTDKCFSNYSI----------LDTTNLT-----------STVVEFWERNMHQLSSGLDEPGQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSI--IVCCINSVTSVFAGFVIFSIVGFMSHITK-KPVKELAASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQFCTVEGFVTALSDEYPQYLRGHKEIFIAVICVISYIIGLANITQGGLYVFKMFDYYSASGMSLLFLVFFETIAISWCYGVDRFNDNICEMIGHKVHK----WWNICWVFFTPLVVVGVFMFSVVEM-TPLTLGSYTYPMWGQGMGWFMALSSMLLIPGYMVYLFLVSKGTLRQVLR 535          
BLAST of slc6a-12 vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 308.145 bits (788), Expect = 9.866e-97
Identity = 177/518 (34.17%), Postives = 280/518 (54.05%), Query Frame = 1
Query:  403 GAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWN-FAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRW----RSSAEEFYLYNTLNI--TKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRK 1935
            GAFLIPY       G P+F  E+++GQF       IW    PIF G+G+++  I+  ++ YYN ++AW LYYL  SF   LPW+KC N WNT  C SY D                       + + W    RS AEEFY  N L I  +K +  +GG    +L+C  + + + Y  L   VK+ GKVV+ TA  PYV+L +++I+G+ LPG+W G+ FYL P WK LL+ +VW  AA QIF+SLGP +G L+++AS+NKFN N  R + +   + C +SF   F IF+++G+MA + N+       + GP L F+ YP+A+A + G   W++LFF+ ++TLG+DS F   E +I  + DE   +  K R  +   +  +  +  L   T  GAYI ++++ + +  ++I I L E+ A+++FY  K+    I  M      P  +W   C   ++P   L   +   +   +P+   +  +P WS+  G+ +A    + +P+   Y +++  G  ++
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCTSYFD----------------------TTGVAWGKHSRSPAEEFYTRNVLEIQYSKGLGGVGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMRNVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDSTFGGLEAIITAVMDEYPSLFSKRREYFVLGLVTICFMGALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVKRFCADIHSMLG--FSPGYFW-RLCWVAISP-LFLSFIVVSFLTGSKPLKLFDYDFPDWSMILGYFIAASSFMFVPLYMAYKILITPGTLKQ 492          
BLAST of slc6a-12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 253.447 bits (646), Expect = 2.878e-76
Identity = 180/518 (34.75%), Postives = 290/518 (55.98%), Query Frame = 1
Query:  403 GAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWV-LPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIAD--ECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWY-STPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFR 1944
            GAFL+PY   +   G P+F  EV++GQ T     G+W   P+FTG+G + + +  L  LYY VV+AW LYYL  S     LPW+ C  +W T  C   +D + ++       +  +   D+        S A EF+  N L ++  +++LG  N  +L+C +  W+L Y  +   +K  GKVVY T   PYVLL V+++QG +LPG+  GI +YL P W  L + +VW  A+TQ+FY  G  +G L ++ S+NKF+ N  R S ++ II   +SF+  F +FS +G MA    + DI+ V E+GPGL FV YP+A++LLP  A+W+ L F+ LL LG+DS FA  E  + G+ D    Q    + R  +T    L+  L+ + + T+ G Y+FQ+ D Y ++ I+++ +  +E  A+A+ Y   + +  +  M     +P   W+  C   ++P   L +F+  ++++E+ V++    YP W+   GW LA+  ++ +P +A+Y L   KG+  + +R
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWATAAC---SDTLGTSRAASNASEGASACQDT-------TSPAVEFWERNVLRVSSGMHDLGSVNWEMLLCLLAVWLLVYFSVWKGIKFSGKVVYVTGSVPYVLLLVLLVQGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGV-DISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSEFAGMEGFVTGLTDLFPSQLSGKRRREAFTGLCCLVSFLLSVTMVTQGGIYVFQLFDSYAASGISMLWLMGWECIAVAWVYGANRFMQDLTAMLG--FRP-HAWVWWCWSVVSPAVCLGIFVFHLVHYERLVYNGRYEYPGWAEALGWLLALSSMLCIPAVALYKLATAKGSLAQRWR 504          
BLAST of slc6a-12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 208.764 bits (530), Expect = 1.589e-62
Identity = 110/257 (42.80%), Postives = 160/257 (62.26%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNT-EYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQ 1053
            + ER  W++K E++LS IG +VG+GN+WRFPYL  +NGGGAFLIPY   L   G P+F  E SIGQF  L P  IW   P+  GLGW MV  S L++LYYN ++A+ L+YL  SF   LPWS C  +W   E C+    +  S+L              S NSS   ++ +E+++    L  ++S++E G    H+ +  +++WI+T   L+  +KS GKVVYFTA+ PYV+L +++I+G+ LPG+ LGI++Y+  Q
Sbjct:    3 NAERGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLFYLFASFTSELPWSSCKKWWGADENCFD-RSVCNSSLA--------EGNCSSVNSSK--QTPSEQYWNKYALRRSESMDETGDVVWHLALTLLLSWIVTCAALVKGIKSSGKVVYFTAIFPYVVLIILLIRGATLPGAILGIEYYIGRQ 248          
BLAST of slc6a-12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.445 bits (511), Expect = 2.461e-58
Identity = 120/343 (34.99%), Postives = 193/343 (56.27%), Query Frame = 1
Query:  940 KVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIAD--ECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYS-TPIAVIIIALFESFALAFFY-NYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANST 1956
            +VVYFTA  PY++L ++ I G  LPGS+ GI +YL P W  L   +VW  A TQIF+S     G L ++ S+N+FN N  R + ++ ++   +SF+  F +FS +G MA    + DI+QV ESGPGLAF+AYP+A++L+P   +W+ LFF  L+ LG+DS F   E  + GI+D        G  R ++         L+ + + T  G Y+FQ+ D+YS + + ++  A +E   +A+ Y    + + +I +M      P   W+  C   +TP     +F+  ++N++   ++K   YP W    GW +A+  ++ +PV+AIY L   KGN  + +R  +T
Sbjct:    1 QVVYFTATFPYLVLIILFINGMTLPGSYDGIMYYLKPDWSKLGQPQVWIDAGTQIFFSYAIGLGALSALGSYNRFNNNCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGV-DISQVAESGPGLAFIAYPKAVSLMPMAPLWAALFFFMLILLGLDSQFVGVEGFVTGISDLFPAALTGGYRREVFVGVCCFTSFLIAISMVTEGGMYVFQLFDYYSASGMTLLWQAGWECIVVAWVYAGGDRFMDNIALMIGYRPFP---WMRWCWAFVTPCVCTGIFLFNLLNYKPLTYNKGYVYPWWGEALGWCMALSSMLCIPVVAIYRLARTKGNLLERWRILTT 339          
BLAST of slc6a-12 vs. Ensembl Nematostella
Match: EDO31545 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0])

HSP 1 Score: 398.667 bits (1023), Expect = 2.479e-130
Identity = 225/573 (39.27%), Postives = 332/573 (57.94%), Query Frame = 1
Query:  280 IMSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWN-FAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCY---------------SYNDIVKSNLTFVQFI--DLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADE---CQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRK 1935
            + + ER  W  K +F+LS IG++VG+GN+WRFPYLC  NGGGAFL+PY   L +CG PMF  E+S GQ+  L P G+W    P+F G+G++ + IS L+ +YYNV++AW LY+L +SF   + W  C N+WNT+ CY               S N +V S L     +  +  N T +      +  S + EF+    L ++  I E G     IL+C I+AW+  Y C+   VKS GKVVYFTA  PY++L ++ ++G  LPG+  GI FYL P+W  L   KVW  AATQIFYSLG  +G L++M S+NKF+ NI + +  I +I C +S +  F IFS +G M+++ N   I +V  SGPGLAFV YP+A+A +P   +W++LFF  +LTLG+DS F   E +I GI DE   C+K K     ++ A    L  L+G+   T+ GAY+  + D+ S  ++++ +  FE+  LA+ Y   +    IE M    S+P  +W  +   C  P  +  +F   II ++   +   K YP+W+  FGW +A+  ++ +P  AIY++    G  R+
Sbjct:    1 MTTNERETWGKKADFLLSCIGFAVGLGNVWRFPYLCYANGGGAFLLPYLIMLVLCGMPMFFMELSAGQYFSLGPIGVWGAICPLFRGIGFASIVISFLVCVYYNVIIAWCLYFLAVSFRSEVLWKHCDNWWNTDNCYAGRIPESMSCSLGSGSNNSLVNSTLANATVLAANATNATTECLFPENQ-VSPSLEFWENYILRLSDGIGEAGEIRWQILVCLILAWVGVYFCMWKGVKSSGKVVYFTATFPYLVLFILFVRGVTLPGADKGIAFYLKPEWHRLKDPKVWVAAATQIFYSLGIGFGSLVAMGSYNKFHNNIFKDAISISLINCGTSVFAGFVIFSTLGFMSHVLN-KPIEEVANSGPGLAFVVYPEAIAQMPISPLWAILFFFMILTLGLDSQFGMMEAVITGIIDEYPVCRKRK----ELFIAVACFLCFLLGITNVTQGGAYVLNLFDYQSGGVSLLFLGFFETVCLAWIYGADRFSKDIEDMVG--SRPAAWWRFTWKFC-APTVMAGIFFYSIIFWQGVSYGSYK-YPQWAEFFGWVIALSSMLFIPGNAIYMIWKTPGTLRE 563          
BLAST of slc6a-12 vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 397.897 bits (1021), Expect = 3.707e-130
Identity = 219/583 (37.56%), Postives = 335/583 (57.46%), Query Frame = 1
Query:  280 IMSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWN-FAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKG----NWRKVFRANSTFKKMELLRSNTTISATLDI 2013
            I+ +ER  W  K+EF L+ +GY+VG+GN+WRFPYLC +NGGGAFLIPY   L ICG P+F  E+S+GQF  L P   W    PI  G+G++M+ +S L  +YYNV++AW LYYL  SF   +PW  C N+WNT           +N T     +L +  L  ++S       ++EFY    L IT  I+  G     +++C I+AW+L Y CL   +KS GKVVYFTA  PY++L +++I+G  LPG+  G+ FYL P +  L    VW  AATQIFYSLG  +G LI+M S+NKF+ N  R +  + +I C +S +    IFS++G MA +    ++++V  SGPGLAFV YP+ +A +P    WS+ FF  LLTLG+D+ FA +E +  G+ DE  ++    + ++TA +     L+GLP+ +++GA+I  +  W +  ++++ +A FE   +A+ Y   +    IE M      P   W       +TP  +  +FI  ++ ++   +D +  YP W+   GW +A+  ++ +P +AIY +   KG     WR + R +   ++M ++     I    D+
Sbjct:   33 IIGEEREKWGRKVEFFLACVGYAVGLGNVWRFPYLCFKNGGGAFLIPYLCMLLICGMPLFFMELSLGQFVSLGPVTSWAAICPISKGVGFAMLVVSFLCCVYYNVIIAWCLYYLFESFAKDVPWKTCDNWWNT----------ATNCT----SNLTDTALKEYSSP------SKEFYENYVLRITPDIDTFGVMRWQLVVCLILAWVLVYFCLWKGIKSSGKVVYFTATFPYLVLVILLIRGLTLPGAMKGLSFYLKPNFSKLGDAIVWVDAATQIFYSLGIGFGSLIAMGSYNKFHNNCFRDAMTVSVINCSTSVFAGLVIFSVLGFMAEVLG-KEVSEVATSGPGLAFVVYPEGIAQMPISPFWSICFFFMLLTLGLDTQFAMFEAVTTGLGDEYVRLLRNRKELFTAFLCFCCFLLGLPIVSQSGAFIMNLYVWQAGGVSLVFLAFFEVIVVAWGYGADRFALDIETMTGNKVWP---WWPIAWKYITPAVITGIFIFSLVQWQGVSYD-DYQYPPWAEFVGWVMALSSMLWIPGVAIYKMSRAKGTFMERWRSLTRPDQ--EQMSIIELREGIPKRPDV 588          
BLAST of slc6a-12 vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 379.793 bits (974), Expect = 6.731e-123
Identity = 206/553 (37.25%), Postives = 332/553 (60.04%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIW-NFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGK--IRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRK 1935
             Q R  WS+K EF+LS++GY VG GN+WRFPYLC +NGG  FLIPYF  L + G P+F  E++IGQ+      G+W +  P+  G+G+++  IS L  +YY V++AW  YYL MSF  V+PW  C N WNT++C       ++  +    ++   + L   N + +  S + EF+  N L +T+ I++ G     +   FI++WI+ Y CL   +KS GKVVYFTA  P+++L +++I+G+ L GS  G+ +YL P W+ L   +VW  AATQI++SLG  +G LI+  S+NKFN N+ + + +I I  C +SF+  F +FS++G MA +T  T + +V  SGPGLAFVAYP+A++ +P   +W+VLFF  L+TLG+DS FAT E +I  I DE   ++G    + ++   + + + ++GLP   + G +IF ++D+    ++++I+AL E   + + Y   +    +E M  +  +P+R W   C   ++P+  L + +  +I ++   ++  K YP W+   GW L +  ++ +P  AI+ +    G  R+
Sbjct:   36 EQTRDKWSSKAEFMLSSLGYCVGFGNVWRFPYLCYKNGGATFLIPYFIMLIVNGIPLFFLELAIGQWFSSGVIGVWKSICPLLKGIGYAICMISYLCCIYYIVILAWTFYYLFMSFQAVVPWKTCDNPWNTKFC-------RAKRSGDLLLNCTELDLPQ-NCTAKPTSPSGEFWSNNVLEMTEDISDFGDMRWPLFGTFILSWIVVYFCLFKGIKSSGKVVYFTATFPFIVLFILMIRGATLEGSLDGVIYYLNPDWERLADPQVWIYAATQIYWSLGVGFGALITFGSYNKFNNNVHKDALVISIANCSTSFFAGFVVFSVLGFMA-LTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQFATIEAVITAIVDEYPWVRGTKWRKPVFVLILCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVDRFSDDVEYMTGR--RPMR-WFRICWKYVSPLCTLAIILANLIQWKGVKYN-GKPYPGWAELIGWMLMLSSVLMIPAFAIHEIYKRSGTLRE 575          
BLAST of slc6a-12 vs. Ensembl Nematostella
Match: EDO32356 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2])

HSP 1 Score: 378.637 bits (971), Expect = 1.035e-122
Identity = 215/558 (38.53%), Postives = 318/558 (56.99%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKI--KGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYS-TPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANST 1956
            ER  W  K++F+L+ IG+SVG+GNIWRFPYLC +NGGG FLIPY   L + G P+ + EV +GQF        W   P+F G+G++ V I   L++YY V++ W  YY+  SF  VLPWS C N WNTE C+    ++    TF        + + SF     W+ +A+       LNI+  ++++G  N  + +C + AWI+ Y+C+   VKS G+VVYFTA  PYVLLT+I ++   LPG+  GI+FYL P W  L    VW  AATQ+F+S     G LI++ S+NKF  N  R   +   +   +SFYG F IFS++G MA    +  I +V ESGPGLAF+AYP A+A +P   +WS+LFF  ++ LG+DS F   E  +  I D       +G  + I+ A+ +     +GL + T  G Y+FQ+ D YS + I ++ I+LFES  + + Y  ++   +   M   +   +  +L  C    TPI  L VFI  ++N+E   ++    YP W    GW LA+  IV +P++A+  L+  +G++    R+ +T
Sbjct:    8 ERETWVGKLDFILALIGFSVGLGNIWRFPYLCYKNGGGCFLIPYLICLLLAGVPLLILEVCLGQFMSQGGITAWKICPLFQGIGYASVVIVQYLNIYYIVILGWAFYYMFHSFQAVLPWSHCDNDWNTEKCHVGRKMIT---TFNSGSKCCQLFIKSFKC--LWKDAADY-----VLNISGGLDQIGTINWQMALCLLFAWIVCYLCVFKGVKSTGRVVYFTATFPYVLLTIICVRAVTLPGAREGIRFYLEPDWSRLQDGSVWLQAATQVFFSYSIGLGTLIALGSYNKFKNNCYRDCIIFACVNSGTSFYGGFVIFSVLGFMAEKQGVP-IQEVAESGPGLAFIAYPAAVAEMPISPLWSILFFFMVILLGLDSEFVGVEGFVTAIVDMFPGYLRRGYRKEIFIAACSTFWFFIGLVMVTEGGMYVFQLFDNYSASGICLLWISLFESIGIGWVYGAERFYQN---MTDMIGFRINPYLKVCWIFCTPIFCLAVFIFSLVNYEPLTYNLTYKYPVWGDAIGWLLALSSIVCIPLLAVINLMRAEGDFIDRLRSVTT 551          
BLAST of slc6a-12 vs. Ensembl Nematostella
Match: EDO40151 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6])

HSP 1 Score: 372.474 bits (955), Expect = 1.353e-120
Identity = 205/572 (35.84%), Postives = 323/572 (56.47%), Query Frame = 1
Query:  289 QERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWN-FAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELLRSNTTISA 2001
            + R  W  KIEF+ + IG++VG GN WRFPY+C +NGGGAFLIPY  FL + G P+F  E+S+GQ     P   W    P+F+G+G++ + IS ++S+YYNV++AW LY+L  SF   +PW  C + WNT  CY YN    +N + V                    SS+ EF + N L ITKSI E GG + H+ +C +VAWIL Y  +   +++ GKVVY TA  PY++L +  I+G  LPG+  G+ +++ PQW  L   KVW  AA+QI YSL   +G LI  AS+N    N+   + +I +I C +S +  F IF+I+G+MA++     + +V   GPGL F+ YP A++ LP   IW+V+FFL L+ LG+DS F   E +   + ++  +   K R +    +  +M L+GL   ++ G ++F + D +S  ++++ +  FE   + + Y  ++   +I  M   + +PV  W   C   ++PI +L +F+  +  +++  ++ N  YP W+   GW LA+  ++ +PV   Y          K+++A  TF     L+++ TIS 
Sbjct:   21 ESRERWDRKIEFLFACIGFAVGYGNFWRFPYMCFKNGGGAFLIPYVLFLCLGGIPLFFMELSLGQLLQEGPIKAWQKICPLFSGIGFASIVISFIVSIYYNVILAWSLYFLYNSFFADIPWVGCHHSWNTPDCYVYN--ASANASGV--------------------SSSREFLVKNVLEITKSIEEPGGLSVHLTLCLLVAWILVYFSIWRGIRTTGKVVYVTATLPYIILVIFFIKGVTLPGAIDGVLYFITPQWDRLQDPKVWIDAASQILYSLTIGFGVLIGFASYNPRKNNVFSDALLISVINCATSVFAGFVIFAIVGYMAHVQE-KSVPEVASQGPGLVFIVYPAAISQLPFPQIWAVIFFLMLIALGLDSQFGQVEVVAAALIEQWPRQLHKHRELVVLVICFVMFLLGLSCVSKGGMFVFNLFDSFSCGLSLLFVVCFELLVIGWIYGARRYADNISQM---IGRPVLQWWVICWKYISPIMVLGIFVFSLAKYKRITYE-NVPYPAWAEGVGWLLALSSMLCIPVTMCY----------KIYKAEGTF-----LQNSETISG 550          
BLAST of slc6a-12 vs. Ensembl Medaka
Match: slc6a5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:101158004])

HSP 1 Score: 405.601 bits (1041), Expect = 2.630e-130
Identity = 217/564 (38.48%), Postives = 333/564 (59.04%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYC-------------YSYNDIVKSNLTFV-------QFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMY 1917
            ++ R  WSNK++F+LS +GY+VG+GN+WRFPYL  +NGGGAFLIPY   L I G P+FL EVS+GQF    P  +W   P   G G +M+ IS L+++YYN+++ W LYYL  S    LPW+ C N WNT  C                N I   N TF            L N+++D+  + +   S +EE++ YN L+I+K I   G     +  C  +AW++ Y  L   +KS GKVVYFTA  PYV+L +++I+G  LPG+  GI +++ P+W+ L   KVW  AATQIF+SL  AWGGLI+++S+NKF+ N  R + ++      +S +  F IFS+IG MA+   +  I +V + GPG+AFV YP+A+  LP    W+++FFL LLTLG+D+MFAT ET++  ++DE  K   K + ++T        ++G P+ T  G Y+ Q+VD ++   +++IIA+FE   +++ Y  ++    IE+M     +P R+W   C   +TP  L  +    +  ++   ++ +  YP WS+  GW + I  ++ +P+M  +++ MY
Sbjct:  166 NKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWANCRNEWNTVECKDKDMLLLDSCILRDRNAISVKNSTFCLSANAVGNLTKLLNVSIDANKTYV---SPSEEYFKYNVLHISKGIEYPGDIRWPLAGCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLIILLIRGVTLPGAGDGILYFITPKWEKLSDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKVP-IEKVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPVFTLICCASFFILGFPMITENGMYMLQLVDTFAASYSLVIIAIFELLGISYLYGLQRFCADIEMMIG--FQPNRFWRL-CWAFVTPTILTGILGLSLYQWKVMTYE-DYTYPTWSMIMGWLMVICSVIWIPIM--FLIKMY 719          
BLAST of slc6a-12 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 394.815 bits (1013), Expect = 1.451e-127
Identity = 227/560 (40.54%), Postives = 339/560 (60.54%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWR----SSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKG-NWRKVFRA 1947
             R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF++PYF  L  CG P+F  E+S GQF      G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY  MS   +LPW+ C N WNT  C   + +V S       +     +L +  S +  R    S +EE++ +  LNI+  I   G     IL C  V+W + ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GIK+YL PQW+ +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA+  N+  +++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   + T SV ++  L+G+PLTT+AG Y   ++D Y+   ++++I+      + + Y ++     +E+M   +  P   +   C   ++P+ +  + I  +I + +P+   +  YP WS+  G+++A+  +V +PV A+Y +    G  +R+  +A
Sbjct:   30 RRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDC---SGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNV-PVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKT--VVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMM---LGFPPPLFFKVCWRFISPLIISFILIFTVIQY-KPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKA 579          
BLAST of slc6a-12 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 394.045 bits (1011), Expect = 1.984e-127
Identity = 227/560 (40.54%), Postives = 339/560 (60.54%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWR----SSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKG-NWRKVFRA 1947
             R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF++PYF  L  CG P+F  E+S GQF      G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY  MS   +LPW+ C N WNT  C   + +V S       +     +L +  S +  R    S +EE++ +  LNI+  I   G     IL C  V+W + ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GIK+YL PQW+ +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA+  N+  +++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   + T SV ++  L+G+PLTT+AG Y   ++D Y+   ++++I+      + + Y ++     +E+M   +  P   +   C   ++P+ +  + I  +I + +P+   +  YP WS+  G+++A+  +V +PV A+Y +    G  +R+  +A
Sbjct:   26 RRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDC---SGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNV-PVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKT--VVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMM---LGFPPPLFFKVCWRFISPLIISFILIFTVIQY-KPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKA 575          
BLAST of slc6a-12 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 394.045 bits (1011), Expect = 1.984e-127
Identity = 227/560 (40.54%), Postives = 339/560 (60.54%), Query Frame = 1
Query:  292 ERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWR----SSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQK---IKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKG-NWRKVFRA 1947
             R  W N+IEFVL+++GY+VG+GN+WRFPYLC  NGGGAF++PYF  L  CG P+F  E+S GQF      G+W  +P+F G+G+ M+ +S  + +YYNVV+    YY  MS   +LPW+ C N WNT  C   + +V S       +     +L +  S +  R    S +EE++ +  LNI+  I   G     IL C  V+W + ++CLI  VKS GKVVYFTA  PYV+LT++ I+G  L G+  GIK+YL PQW+ +L  KVW  AA+QIFYSLG AWGGLI+MAS+NKF+ N  R S +I I  C +S Y  F IFSI+G MA+  N+  +++V + GPGLAFVAYP+A+ LLP   +WS+LFF  L+ LG+ + F   ETL+  I DE      I+ K   + T SV ++  L+G+PLTT+AG Y   ++D Y+   ++++I+      + + Y ++     +E+M   +  P   +   C   ++P+ +  + I  +I + +P+   +  YP WS+  G+++A+  +V +PV A+Y +    G  +R+  +A
Sbjct:   26 RRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDC---SGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNV-PVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKT--VVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMM---LGFPPPLFFKVCWRFISPLIISFILIFTVIQY-KPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKA 575          
BLAST of slc6a-12 vs. Ensembl Medaka
Match: slc6a7 (sodium-dependent proline transporter [Source:NCBI gene;Acc:101168229])

HSP 1 Score: 389.423 bits (999), Expect = 1.226e-125
Identity = 209/496 (42.14%), Postives = 292/496 (58.87%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKS--INELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRH--IYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQV---SKPVRYWLTSCMCCLTP 1752
            +  R  W  K EF+LS IGY VG+GN+WRFPYLC  NGGG FLIPYF  LF+ G P+FL E+S+GQ+    P  +W   P+  G+G  M+C+S L+ LYYNV++AW  YYLG SF   LPWS C    N   C S N    S                   SS R R+  E F+  N L +  S  +++ G     + +C + AWI+ ++C++  ++S GKVVY TA  PY +L V+II+G+ L GS  GI FYL P W  L S +VW+ AA+QIFYSLG   GGL+SMAS+NKF+ N++R + +I    C +SF+  FAIFSI+GHMA+   ++ + +V ++GPGLAFVAYP+A+ALLPG   WS++FFL L  LG+D++F   E +   + DE  +++    H  ++  ++     L+GL L T  G Y F ++D +ST   +III LF    ++FFY   +    I  M          V  +  +C C  TP
Sbjct:   57 TTPREQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRNGGGVFLIPYFIMLFVAGVPLFLMELSLGQYGAAGPITVWKCCPLLKGIGIGMLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWS-CDAIANAAVC-SNNTAGNS-------------------SSGRARTPTEIFWNENVLGLVNSEGLHDPGPVRWPLALCLLAAWIIIFLCMLKGIRSSGKVVYVTATFPYFVLIVLIIRGATLEGSLQGIAFYLTPDWARLASAQVWSDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTIIITTGNCCTSFFAGFAIFSILGHMAWRKGVS-VGEVADTGPGLAFVAYPEALALLPGSVFWSIMFFLMLFMLGVDTLFGNMEGITTAVLDEFPQLRQNNLHKSLFLGTLCFGFYLMGLLLVTEGGIYWFTLIDSFSTSFGLIIITLFMCIGISFFYGVNQFCQDILDMIRHCPPWCSKVLIYFKACWCFFTP 530          
BLAST of slc6a-12 vs. Planmine SMEST
Match: SMESG000055640.1 (SMESG000055640.1)

HSP 1 Score: 1152.12 bits (2979), Expect = 0.000e+0
Identity = 583/583 (100.00%), Postives = 583/583 (100.00%), Query Frame = 1
Query:  283 MSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELLRSNTTISATLDIEKNSLV 2031
            MSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPISLLIVFINIIINFEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELLRSNTTISATLDIEKNSLV
Sbjct:    1 MSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPISLLIVFINIIINFEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWRKVFRANSTFKKMELLRSNTTISATLDIEKNSLV 583          
BLAST of slc6a-12 vs. Planmine SMEST
Match: SMESG000042091.1 (SMESG000042091.1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.538e-130
Identity = 223/587 (37.99%), Postives = 343/587 (58.43%), Query Frame = 1
Query:  295 RAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINEL-------GGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGK--IRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMY------KGNWRKVFRANSTFKKMELLRSNTTISATLD 2010
            R  WS + +F LS +GY+VG+GN+WRFP+LC  +GGGAFL+PYF  L I G P+F  E+++GQF+   P  IW   P+F G+G+SM+ ++ ++S+YYNV++AW LYYL  SF   LPWS C N WN E C          LT  +   + N +  +  + I +  +AE+++    L +      L       G    H+ +C ++AWI+   CLI  VKS GKVVYFTA+ PYV++ ++++ G +L GS +GI++YL+P+WK LLS++VW  AATQIFYSLG A+GGL++M+S+NKFN N  R + ++ +I C++SF   FAIFS++G+MA+ T    I Q   SG GLAFVAY Q+++ +    +WS+LFFL LLTLG+DS F   E +  G+ DE   +K    I   +  SV +++  +G+   ++ G Y+F I+D YS    + IIA+FE   + + Y  K  +  I++M     KP  YW+ +C   +TP   +I  + +   +  P    N   P W+   G+ + +  ++ + V  IY  I        K +W    +A+        ++S+   +  +D
Sbjct:   28 RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC----------LTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTG-RAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLG--FKPGYYWV-ACWMVVTP-LTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLAGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMD 599          
BLAST of slc6a-12 vs. Planmine SMEST
Match: SMESG000042091.1 (SMESG000042091.1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.541e-130
Identity = 223/587 (37.99%), Postives = 343/587 (58.43%), Query Frame = 1
Query:  295 RAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINEL-------GGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGK--IRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMY------KGNWRKVFRANSTFKKMELLRSNTTISATLD 2010
            R  WS + +F LS +GY+VG+GN+WRFP+LC  +GGGAFL+PYF  L I G P+F  E+++GQF+   P  IW   P+F G+G+SM+ ++ ++S+YYNV++AW LYYL  SF   LPWS C N WN E C          LT  +   + N +  +  + I +  +AE+++    L +      L       G    H+ +C ++AWI+   CLI  VKS GKVVYFTA+ PYV++ ++++ G +L GS +GI++YL+P+WK LLS++VW  AATQIFYSLG A+GGL++M+S+NKFN N  R + ++ +I C++SF   FAIFS++G+MA+ T    I Q   SG GLAFVAY Q+++ +    +WS+LFFL LLTLG+DS F   E +  G+ DE   +K    I   +  SV +++  +G+   ++ G Y+F I+D YS    + IIA+FE   + + Y  K  +  I++M     KP  YW+ +C   +TP   +I  + +   +  P    N   P W+   G+ + +  ++ + V  IY  I        K +W    +A+        ++S+   +  +D
Sbjct:   27 RGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERC----------LTDFRNKTISNCSTLNTQNCIEYEVAAEQYWKKVVLGVEDYAGNLRPMEPFLGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTG-RAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVKNFMKDIKMMLG--FKPGYYWV-ACWMVVTP-LTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMTLAGVINIVVYFIYYAIFKGVTKTPKDSWGPGNKADWEIDDRYAVKSSPCDNDKMD 598          
BLAST of slc6a-12 vs. Planmine SMEST
Match: SMESG000042051.1 (SMESG000042051.1)

HSP 1 Score: 398.282 bits (1022), Expect = 8.425e-130
Identity = 235/589 (39.90%), Postives = 336/589 (57.05%), Query Frame = 1
Query:  295 RAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQFIDLKNITLDSFNSS--IRWRSSAEEFYLYNTLNITKSINE-------LGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMIL--VGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPV----MAIYILIMYKGN----------WRKVFRANSTFKKMELLRSN 1986
            R  WS+K++F LS +GY+VG+GN+WRFP+LC +NGGGAFLIPYF  L I G P+F  E+S+GQF+      +W   P+F G+G++M+ IS + S+YYNV++AW LYYL  SF   LPWS C N WN E C   ND          F ++ N+   SF ++   ++  +AE+++    L +     +       LG    H+ +C ++AWI+    LI  VKS GKVVYFTA+ PY ++ +++I G +L GS  GIK+YL+P+W  LL  +VW  AATQIFYSLG A+GGL++MAS+NKFN N  R + M+ II C +SF   FAIF+++G+M+  T    + +   SG GLAFVAY Q +A +P   IWS+LFF  LLTLG+DS F   E +  G  D+   +K    H ++  +   +IL  +GLP  ++ G Y+F ++D Y    ++IIIA  E   ++F Y  K     IE+M     KP  YW+  C   LTP  ++I  + + I    P        PKW+   G  +A   I  +P+     AI+    +K N          WR   R +S  K  E+   N
Sbjct:   25 RGNWSSKMDFFLSCVGYAVGLGNLWRFPHLCYKNGGGAFLIPYFTMLIIAGIPLFYFELSLGQFSSSGFLTVWKIQPMFKGIGFAMLVISIICSIYYNVIIAWSLYYLFASFTSKLPWSDCNNEWNDELC--LND----------FKNVTNVVCSSFRTTNCTKYEVAAEQYWQRVVLGVVNYAGDQRPMEPYLGTVQWHLSLCLLLAWIICGASLIKGVKSSGKVVYFTAIFPYFVIVIMVINGCLLEGSLEGIKYYLIPKWSKLLEARVWGDAATQIFYSLGVAFGGLMTMASYNKFNNNCYRDALMVSIINCATSFVAGFAIFAVLGYMSVKTG-RSVAETTTSGTGLAFVAYAQGVATMPYSPIWSILFFGMLLTLGIDSQFGGMEAIFTGFQDQFPILKKTHFHDFSFKIIFQIILFFLGLPCVSKGGIYMFTLMDEYCGSFSLIIIAFLELTIISFIYGVKNFSQDIEMMLK--FKPGYYWII-CWTFLTP-IIIIFILIVSIIQHAPSSYNGVLLPKWANQLGGVIAASSISAVPIYFFYHAIFKGFTFKPNEEWGPGVEKFWRDDIRYSSKLKLKEIELPN 596          
BLAST of slc6a-12 vs. Planmine SMEST
Match: SMESG000019713.1 (SMESG000019713.1)

HSP 1 Score: 398.667 bits (1023), Expect = 7.916e-129
Identity = 208/557 (37.34%), Postives = 334/557 (59.96%), Query Frame = 1
Query:  286 SQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFFLFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLYYNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFV-----------QFIDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICFIVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGIKFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVRTSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVAYPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKGKIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFESFALAFFY-----NYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPXXXXXXXXXXXXXXEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYIL 1908
            + ER  W  K +F+LS++GY+VG+GNIWRFPY+C  NGGGAF+IPY  FLF+ G P+FL +V +GQFT   P   W +APIFTG+G++MV IS L+++YYNV++++ +YY+  S +  LPW  C N WNT+YC     IV  +L              + + L N TL +  +    +  AEE++    LN++K +  +G     + +C   +WI+ ++CLI  +KS GK+VYFTA+ PY +L ++  +G  L G+  GI FY++P  K L    VW  AA QIF+SL  +WGGLI+++S+N+F+ NI+R + ++ I    +S +  F IFS +GH+A     T ++ V + G GLAF+ YP+A+A +PG  IWS+LFF+ L+TLG+DS F T ET+I G  D         +  +     +++  +GLPLTT++G Y  Q++D Y    A+++I +FE  ++ + Y     N+KK +     +++ + +P+  W   C   +TP  +  + +    ++ +  +  +K YP W+   GW + +L +  +P   +Y++
Sbjct:   64 NNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLG-TSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWFILLFVIILFFLGLPLTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKY-GDKIYPIWADFLGWMMTVLSLAFIPGTVVYLV 618          
The following BLAST results are available for this feature:
BLAST of slc6a-12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A51.043e-12537.21solute carrier family 6 member 5 [Source:HGNC Symb... [more]
SLC6A94.917e-12539.96solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A94.917e-12539.96solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A91.131e-12439.96solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A95.269e-12439.96solute carrier family 6 member 9 [Source:HGNC Symb... [more]
back to top
BLAST of slc6a-12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mod-53.979e-10533.51Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-116.992e-10534.60Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
snf-36.659e-9832.45Sodium- and chloride-dependent betaine transporter... [more]
dat-12.829e-9733.04Sodium-dependent dopamine transporter [Source:Uni... [more]
snf-62.730e-7527.60Sodium-dependent acetylcholine transporter [Sourc... [more]
back to top
BLAST of slc6a-12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ntl1.127e-11536.61gene:FBgn0267326 transcript:FBtr0079478[more]
Gat3.109e-11536.13gene:FBgn0039915 transcript:FBtr0089972[more]
SerT5.083e-11535.37gene:FBgn0010414 transcript:FBtr0072362[more]
SerT5.083e-11535.37gene:FBgn0010414 transcript:FBtr0343316[more]
DAT1.580e-11435.19gene:FBgn0034136 transcript:FBtr0087125[more]
back to top
BLAST of slc6a-12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a51.964e-12938.13solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a52.307e-12938.13solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a52.673e-12938.13solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a94.255e-12940.91solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
slc6a95.641e-12940.91solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc6a-12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxd41.739e-13440.69MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd41.786e-13440.69MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd41.838e-13440.69MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd41.864e-13440.69MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd42.000e-13440.69MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of slc6a-12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a51.020e-12638.38solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a51.020e-12638.38solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a51.020e-12638.38solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a92.949e-12439.85solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a92.949e-12439.85solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of slc6a-12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7Y2W8|SC6A9_XENLA2.421e-13140.65Sodium- and chloride-dependent glycine transporter... [more]
sp|A7Y2X0|SC6A5_XENLA1.774e-12837.50Sodium- and chloride-dependent glycine transporter... [more]
sp|Q761V0|SC6A5_MOUSE7.887e-12638.38Sodium- and chloride-dependent glycine transporter... [more]
sp|Q9Y345|SC6A5_HUMAN5.007e-12537.21Sodium- and chloride-dependent glycine transporter... [more]
sp|P58295|SC6A5_RAT7.169e-12538.03Sodium- and chloride-dependent glycine transporter... [more]
back to top
BLAST of slc6a-12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF520.000e+0100.00Transporter OS=Schmidtea mediterranea OX=79327 GN=... [more]
A0A4S2M0110.000e+048.30Transporter OS=Opisthorchis felineus OX=147828 GN=... [more]
A0A183A6B20.000e+048.92Transporter OS=Echinostoma caproni OX=27848 GN=ECP... [more]
H2KQC20.000e+048.30Transporter OS=Clonorchis sinensis OX=79923 GN=SLC... [more]
A0A074ZG210.000e+047.20Transporter OS=Opisthorchis viverrini OX=6198 GN=T... [more]
back to top
BLAST of slc6a-12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a91.374e-12840.73solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.951e-12840.73solute carrier family 6 member 9 [Source:NCBI gene... [more]
ENSAMXT00000015774.21.916e-11936.79pep primary_assembly:Astyanax_mexicanus-2.0:8:2649... [more]
slc6a71.456e-11842.43sodium-dependent proline transporter-like [Source:... [more]
slc6a81.576e-11635.77solute carrier family 6 member 8 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a1.953e-11936.40solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
slc6a4b9.866e-9734.17solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.12.878e-7634.75pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000001684.11.589e-6242.80pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
ENSPMAT00000004857.12.461e-5834.99pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
back to top
BLAST of slc6a-12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc6a-12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO315452.479e-13039.27Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0][more]
EDO492183.707e-13037.56Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO397076.731e-12337.25Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO323561.035e-12238.53Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2][more]
EDO401511.353e-12035.84Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6][more]
back to top
BLAST of slc6a-12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a52.630e-13038.48solute carrier family 6 member 5 [Source:NCBI gene... [more]
slc6a91.451e-12740.54solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.984e-12740.54solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.984e-12740.54solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a71.226e-12542.14sodium-dependent proline transporter [Source:NCBI ... [more]
back to top
BLAST of slc6a-12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055640.10.000e+0100.00SMESG000055640.1[more]
SMESG000042091.11.538e-13037.99SMESG000042091.1[more]
SMESG000042091.11.541e-13037.99SMESG000042091.1[more]
SMESG000042051.18.425e-13039.90SMESG000042051.1[more]
SMESG000019713.17.916e-12937.34SMESG000019713.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30023180
GenBankAKN21432.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023180 ID=SMED30023180|Name=slc6a-12|organism=Schmidtea mediterranea sexual|type=transcript|length=2194bp
TTTTAAAATAAGATAATTTTTAATAAAATTATTAAAAATGTTTGTAGTAA
ATCGTATTTATTAAATCATTTAGCACGCGTTGCTTATATTGATATGGTTC
TTTTTGTGATTTTTTTCATTAACTATAAAGTATCATTAAATTTTTAATGT
CACGTGATAATTTCTATTTTTGACAAACATTAACTTTACATGCGTGTATT
TCAATTTTTACTGGTCAATATAAGTATGTAATAAAGAATTTTAAACTTCG
AAACCAAAGTTAGAATAAAGTTATTTTAAATAATGAGTCAAGAACGTGCA
ATGTGGAGCAACAAAATTGAATTCGTTTTAAGTACTATTGGGTATTCAGT
CGGTGTGGGTAATATTTGGAGGTTTCCTTATCTGTGCATGGAAAATGGTG
GTGGCGCCTTTTTGATTCCTTACTTTTTCTTTCTTTTCATCTGCGGAGCT
CCAATGTTTCTAGCCGAAGTATCAATTGGACAATTTACTGGATTAAGCCC
AACTGGAATTTGGAATTTTGCTCCAATTTTTACGGGTTTGGGCTGGAGTA
TGGTTTGTATTTCTGGCTTATTGAGTCTCTACTATAACGTTGTCGTTGCC
TGGGTGCTTTATTATCTTGGAATGTCGTTCAACTGGGTTCTACCATGGAG
TAAATGTGGTAATTATTGGAACACTGAATATTGCTATAGTTATAATGATA
TTGTAAAAAGTAATTTGACATTTGTTCAATTTATTGACCTGAAAAATATC
ACTTTGGATTCGTTTAATTCTTCAATTCGTTGGCGCTCATCAGCAGAAGA
ATTTTATTTATATAATACATTGAATATAACCAAAAGTATTAATGAATTAG
GTGGATTTAACAATCATATTCTTATCTGTTTTATTGTTGCTTGGATTTTG
ACGTATGTTTGTTTGATAAACAGTGTTAAATCAGTTGGAAAGGTTGTATA
TTTCACAGCTCTCGCTCCATACGTTCTCTTGACTGTAATAATTATCCAAG
GCTCAATCCTTCCCGGATCATGGCTAGGAATAAAGTTTTATCTCGTTCCT
CAGTGGAAAACTCTTCTCTCGATGAAAGTTTGGACGACAGCAGCGACACA
AATATTTTATTCACTTGGGCCTGCATGGGGTGGTCTGATATCGATGGCTT
CATTTAATAAATTCAATGAGAATATTGTGAGAACATCTACAATGATACCA
ATTATTTGCTGTATGAGCAGTTTCTATGGAAGTTTTGCTATATTTTCAAT
TATTGGTCATATGGCATATATTACTAACATAACTGATATAACGCAAGTAA
TTGAGTCAGGGCCAGGTCTAGCATTTGTTGCTTATCCTCAGGCAATGGCT
CTTCTACCTGGAGGGGCGATATGGTCTGTATTATTCTTCCTTACTCTTCT
AACATTGGGAATGGATAGCATGTTTGCAACATATGAAACTCTTATTCAAG
GAATAGCTGATGAATGCCAAAAAATCAAAGGTAAGATACGCCATATATAT
ACGGCTAGCGTTACCTTGCTCATGATTCTGGTTGGATTGCCATTGACTAC
AAGGGCTGGAGCTTATATATTCCAAATTGTTGATTGGTATTCCACACCGA
TTGCAGTCATTATCATCGCTCTTTTTGAAAGTTTTGCATTAGCTTTTTTC
TATAATTATAAGAAATTGATAACTCACATCGAGATCATGCAAAGCCAGGT
TTCAAAGCCCGTTCGCTATTGGCTGACGTCGTGCATGTGCTGCCTAACAC
CGATTTCTCTATTGATCGTTTTTATTAATATCATAATAAACTTTGAACAA
CCGGTTTTCGACAAAAATAAACACTATCCCAAATGGAGCATCAATTTCGG
CTGGAGTCTTGCTATATTGATGATCGTACCGATGCCAGTAATGGCAATAT
ACATTCTAATTATGTATAAGGGAAATTGGAGAAAGGTATTCAGAGCTAAT
TCTACATTTAAGAAAATGGAACTTTTACGATCTAATACTACAATATCGGC
AACTTTAGATATTGAAAAGAATTCACTCGTCTAGCTATTCGAATTGTGAA
CTAAATCGGGTTAGCCAAACAAATAGTTTCTATTAGACATTATATAACTC
CATTGCGTTGTTTTTTTCTTCTTATTCGGTTCGCATCAGGTCTACTGATT
ATTATTGGCATTGTATTTTTATAAAAATGAAGCTGACTCAGAGC
back to top

protein sequence of SMED30023180-orf-1

>SMED30023180-orf-1 ID=SMED30023180-orf-1|Name=SMED30023180-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=584bp
MSQERAMWSNKIEFVLSTIGYSVGVGNIWRFPYLCMENGGGAFLIPYFFF
LFICGAPMFLAEVSIGQFTGLSPTGIWNFAPIFTGLGWSMVCISGLLSLY
YNVVVAWVLYYLGMSFNWVLPWSKCGNYWNTEYCYSYNDIVKSNLTFVQF
IDLKNITLDSFNSSIRWRSSAEEFYLYNTLNITKSINELGGFNNHILICF
IVAWILTYVCLINSVKSVGKVVYFTALAPYVLLTVIIIQGSILPGSWLGI
KFYLVPQWKTLLSMKVWTTAATQIFYSLGPAWGGLISMASFNKFNENIVR
TSTMIPIICCMSSFYGSFAIFSIIGHMAYITNITDITQVIESGPGLAFVA
YPQAMALLPGGAIWSVLFFLTLLTLGMDSMFATYETLIQGIADECQKIKG
KIRHIYTASVTLLMILVGLPLTTRAGAYIFQIVDWYSTPIAVIIIALFES
FALAFFYNYKKLITHIEIMQSQVSKPVRYWLTSCMCCLTPISLLIVFINI
IINFEQPVFDKNKHYPKWSINFGWSLAILMIVPMPVMAIYILIMYKGNWR
KVFRANSTFKKMELLRSNTTISATLDIEKNSLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000053distal tubule
PLANA:0000065flame cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: biological process
TermDefinition
GO:0006836neurotransmitter transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005328neurotransmitter:sodium symporter activity
GO:0015293symporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 303..323
score: 33.96
coord: 13..34
score: 64.23
coord: 221..238
score: 51.37
coord: 439..459
score: 21.55
coord: 482..502
score: 24.59
coord: 42..61
score: 52.05
coord: 85..111
score: 39.95
coord: 358..377
score: 49.02
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 5..542
e-value: 7.9E-161
score: 536.3
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 3..551
IPR000175Sodium:neurotransmitter symporterPROSITEPS00610NA_NEUROTRAN_SYMP_1coord: 29..43
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 4..547
score: 85.881
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 5..542
NoneNo IPR availableTMHMMTMhelixcoord: 480..502
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
NoneNo IPR availableTMHMMTMhelixcoord: 354..376
NoneNo IPR availableTMHMMTMhelixcoord: 437..459
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 405..427
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
NoneNo IPR availableTMHMMTMhelixcoord: 522..544
NoneNo IPR availableTMHMMTMhelixcoord: 103..122
NoneNo IPR availableTMHMMTMhelixcoord: 269..291
NoneNo IPR availableTMHMMTMhelixcoord: 221..243
NoneNo IPR availableTMHMMTMhelixcoord: 312..334