60s ribosomal protein L14

Overview
Name60s ribosomal protein L14
Smed IDSMED30023172
Length (bp)639
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60s ribosomal protein L14 (SMED30023172) t-SNE clustered cells

Violin plots show distribution of expression levels for 60s ribosomal protein L14 (SMED30023172) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60s ribosomal protein L14 (SMED30023172) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60s ribosomal protein L14 (SMED30023172) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023172

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023172SMESG000022343.1 SmedASXL_018675SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023172SMESG000022343.1 dd_Smed_v4_167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023172SMESG000022343.1 Contig21062newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023172SMESG000022343.1 Contig21062uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30023172SMESG000022343.1 dd_Smed_v6_167_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60s ribosomal protein L14 vs. Ensembl Human
Match: RPL14 (ribosomal protein L14 [Source:HGNC Symbol;Acc:HGNC:10305])

HSP 1 Score: 109.768 bits (273), Expect = 3.504e-29
Identity = 48/121 (39.67%), Postives = 79/121 (65.29%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            V+ GRVA+++ G   GKL AIV++IDQNR L+DGP + V R+++    + LT F +  PH +  K VR+ W KA+I+ KW  + W +K++ +  +A + D++RF+V  A + + R+I  E+
Sbjct:    7 VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATRWAKKIEARERKAKMTDFDRFKVMKAKKMRNRIIKNEV 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Human
Match: RPL14 (ribosomal protein L14 [Source:HGNC Symbol;Acc:HGNC:10305])

HSP 1 Score: 109.768 bits (273), Expect = 3.504e-29
Identity = 48/121 (39.67%), Postives = 79/121 (65.29%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            V+ GRVA+++ G   GKL AIV++IDQNR L+DGP + V R+++    + LT F +  PH +  K VR+ W KA+I+ KW  + W +K++ +  +A + D++RF+V  A + + R+I  E+
Sbjct:    7 VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATRWAKKIEARERKAKMTDFDRFKVMKAKKMRNRIIKNEV 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Human
Match: RPL14 (ribosomal protein L14 [Source:HGNC Symbol;Acc:HGNC:10305])

HSP 1 Score: 104.375 bits (259), Expect = 2.851e-28
Identity = 44/106 (41.51%), Postives = 71/106 (66.98%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQV 425
            V+ GRVA+++ G   GKL AIV++IDQNR L+DGP + V R+++    + LT F +  PH +  K VR+ W KA+I+ KW  + W +K++ +  +A + D++RF+V
Sbjct:    7 VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTQVRRQAMPFKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATRWAKKIEARERKAKMTDFDRFKV 112          
BLAST of 60s ribosomal protein L14 vs. Ensembl Celegans
Match: rpl-14 (Ribosomal Protein, Large subunit [Source:UniProtKB/TrEMBL;Acc:Q9XVE9])

HSP 1 Score: 112.849 bits (281), Expect = 8.368e-32
Identity = 54/123 (43.90%), Postives = 84/123 (68.29%), Query Frame = 3
Query:  102 KTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            + VQ GRV FIA+G+DQGKL AIV +ID NRV IDGP S V R   N+ +L LT F + L  G RTK V+  +  A++++ ++++ W +K+ ++AIRA L D+ER+++  A + + R++  E+
Sbjct:    5 RVVQIGRVVFIASGKDQGKLAAIVNVIDGNRVQIDGPSSDVTRTVRNLKDLQLTKFVLKLRVGQRTKGVKAAFDAAKVTENFQKTQWAKKIAQRAIRAKLTDFERYKLMKAKQMRNRIVRVEL 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Celegans
Match: rpl-14 (Ribosomal Protein, Large subunit [Source:UniProtKB/TrEMBL;Acc:Q9XVE9])

HSP 1 Score: 112.849 bits (281), Expect = 8.368e-32
Identity = 54/123 (43.90%), Postives = 84/123 (68.29%), Query Frame = 3
Query:  102 KTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            + VQ GRV FIA+G+DQGKL AIV +ID NRV IDGP S V R   N+ +L LT F + L  G RTK V+  +  A++++ ++++ W +K+ ++AIRA L D+ER+++  A + + R++  E+
Sbjct:    5 RVVQIGRVVFIASGKDQGKLAAIVNVIDGNRVQIDGPSSDVTRTVRNLKDLQLTKFVLKLRVGQRTKGVKAAFDAAKVTENFQKTQWAKKIAQRAIRAKLTDFERYKLMKAKQMRNRIVRVEL 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Fly
Match: RpL14 (gene:FBgn0017579 transcript:FBtr0076633)

HSP 1 Score: 119.398 bits (298), Expect = 7.725e-34
Identity = 51/117 (43.59%), Postives = 82/117 (70.09%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLI 458
            VQ GR+A  + G  +G+L AIV++IDQNRVL+DGPL+GV R+   ++NLHLT + I  P+ + T++VRK W ++++  +W+ S W  K +    R+ LND++RF++R A R + +L+
Sbjct:    7 VQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFPYTAPTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLL 123          
BLAST of 60s ribosomal protein L14 vs. Ensembl Zebrafish
Match: rpl14 (ribosomal protein L14 [Source:ZFIN;Acc:ZDB-GENE-030131-2085])

HSP 1 Score: 133.265 bits (334), Expect = 1.547e-39
Identity = 60/121 (49.59%), Postives = 88/121 (72.73%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            V+ GRVAFIA G  +GKL AIV++IDQNR L+DGP +GV R+++    L LT + I +PH +R K VR+ W KAEISKKWEES+W +K++ +  RA ++D++R++V  A + + ++I  EM
Sbjct:    7 VEIGRVAFIAFGPHEGKLVAIVDVIDQNRALVDGPCTGVKRQALPFKCLQLTDYVIKVPHSARQKYVRRAWEKAEISKKWEESSWAKKIEARKKRAAMSDFDRYKVSKAKKMRNKIIRHEM 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Xenopus
Match: myl10 (myosin light chain 10 [Source:Xenbase;Acc:XB-GENE-986520])

HSP 1 Score: 116.701 bits (291), Expect = 7.217e-33
Identity = 51/123 (41.46%), Postives = 82/123 (66.67%), Query Frame = 3
Query:  102 KTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            + VQ GRVA+++ G   GKL AIV++IDQNR L+DGP +GV R+++    + LT F I +PH +R K VR+ W KA +++KW  S W +K+  +  +A + D++R++V  A + + ++I  EM
Sbjct:    5 RYVQIGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTGVRRQAMPFKCMQLTDFVIKVPHSARQKYVRRAWEKANVNEKWTASNWAKKIDARQRKAKMTDFDRYKVMKAKKMRNKIIRHEM 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Xenopus
Match: capn7 (calpain 7 [Source:Xenbase;Acc:XB-GENE-996630])

HSP 1 Score: 110.538 bits (275), Expect = 1.874e-30
Identity = 48/123 (39.02%), Postives = 81/123 (65.85%), Query Frame = 3
Query:  102 KTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            + +Q GRVA+++ G   GKL AIV++IDQNR L+DGP +GV R+++    + LT F I +PH +R K VR+ W KA +++KW  S W +K+  +  +A + D++ ++V  A + + ++I  E+
Sbjct:    5 RYIQIGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTGVRRQAMPFKCMQLTDFVIKVPHSARQKYVRRAWEKANVNEKWSASNWAKKIDARQRKAKMTDFDCYKVMKAKKMRNKIIRHEI 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Mouse
Match: Rpl14 (ribosomal protein L14 [Source:MGI Symbol;Acc:MGI:1914365])

HSP 1 Score: 112.464 bits (280), Expect = 1.968e-30
Identity = 51/121 (42.15%), Postives = 79/121 (65.29%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            V+ GRVA+I+ G   GKL AIV++IDQNR L+DGP + V R+++    + LT F +  PH +R K VRK W KA+I+ KW  + W +K+  +  +A + D++RF+V  A + + R+I  E+
Sbjct:    7 VEVGRVAYISFGPHAGKLVAIVDVIDQNRALVDGPCTRVRRQAMPFKCMQLTDFILKFPHSARQKYVRKAWEKADINTKWAATRWAKKIDARERKAKMTDFDRFKVMKAKKMRNRIIKTEV 127          
BLAST of 60s ribosomal protein L14 vs. UniProt/SwissProt
Match: sp|O46160|RL14_LUMRU (60S ribosomal protein L14 OS=Lumbricus rubellus OX=35632 GN=RPL14 PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.343e-34
Identity = 61/121 (50.41%), Postives = 78/121 (64.46%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            V+ GRVA    G DQGKL AIV++IDQNR L+DGP + V RKS+N   L LT+     PH ++T VV+K W K EISKKWEES   +K+  K  R  L D+ERF++  A + + RLI  E 
Sbjct:    7 VEIGRVARAVYGPDQGKLVAIVDVIDQNRALVDGPCTHVARKSMNFKELELTNLKAKFPHSAKTGVVKKAWEKDEISKKWEESHLAKKIAAKEKRKTLTDFERFKLMKAKQARNRLIKIEF 127          
BLAST of 60s ribosomal protein L14 vs. UniProt/SwissProt
Match: sp|P55841|RL14_DROME (60S ribosomal protein L14 OS=Drosophila melanogaster OX=7227 GN=RpL14 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 7.744e-33
Identity = 51/117 (43.59%), Postives = 82/117 (70.09%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLI 458
            VQ GR+A  + G  +G+L AIV++IDQNRVL+DGPL+GV R+   ++NLHLT + I  P+ + T++VRK W ++++  +W+ S W  K +    R+ LND++RF++R A R + +L+
Sbjct:    7 VQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFPYTAPTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLL 123          
BLAST of 60s ribosomal protein L14 vs. UniProt/SwissProt
Match: sp|Q95ZE8|RL14_DROVI (60S ribosomal protein L14 OS=Drosophila virilis OX=7244 GN=RpL14 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.051e-32
Identity = 51/117 (43.59%), Postives = 82/117 (70.09%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLI 458
            VQ GR+A  + G  +G+L AIV++IDQNRVL+DGPL+GV R+   ++NLHLT + I  P+ + T++VRK W+ +++  +W+ S W  K +    R+ LND++RF++R A R + +L+
Sbjct:    7 VQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFPYTAPTRIVRKAWVDSDLKAQWKVSPWSVKAQNICKRSQLNDFDRFKLRYAKRQRNKLL 123          
BLAST of 60s ribosomal protein L14 vs. UniProt/SwissProt
Match: sp|P36105|RL14A_YEAST (60S ribosomal protein L14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL14A PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.493e-32
Identity = 53/108 (49.07%), Postives = 72/108 (66.67%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRV 431
            V+ GRV  I  G+  GKL AIVEIIDQ +VLIDGP +GV R+++N+  + LT     LP G+RT  V K+W  A + +KW  S+W +K+ ++  RA L D+ERFQV V
Sbjct:   15 VEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAKKIAQRERRAALTDFERFQVMV 122          
BLAST of 60s ribosomal protein L14 vs. UniProt/SwissProt
Match: sp|P38754|RL14B_YEAST (60S ribosomal protein L14-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL14B PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.677e-32
Identity = 53/108 (49.07%), Postives = 72/108 (66.67%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRV 431
            V+ GRV  I  G+  GKL AIVEIIDQ +VLIDGP +GV R+++N+  + LT     LP G+RT  V K+W  A + +KW  S+W +K+ ++  RA L D+ERFQV V
Sbjct:   15 VEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAGVCEKWAASSWAKKIAQRERRAALTDFERFQVMV 122          
BLAST of 60s ribosomal protein L14 vs. TrEMBL
Match: A0A1I8H056 (Ribosomal_L14e domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.471e-38
Identity = 61/123 (49.59%), Postives = 90/123 (73.17%), Query Frame = 3
Query:  102 KTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            K VQ GRVAFIA G D GK+CAI EI+DQNRVLIDGP +GV R+  ++  LHLT F++ LPH SRT VVR++WL A++ ++W  ++W +KL+ + +RA + D++RF+   A + + R+++  M
Sbjct:    6 KFVQVGRVAFIANGADSGKVCAIAEIVDQNRVLIDGPCTGVRRQVCDMKRLHLTGFHLPLPHSSRTAVVRRKWLAAKLDERWTGTSWAKKLEARRLRASMTDFDRFRCARAKQIRNRIVSVAM 128          
BLAST of 60s ribosomal protein L14 vs. TrEMBL
Match: A0A267GKT1 (Ribosomal_L14e domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029673g3 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.743e-38
Identity = 61/123 (49.59%), Postives = 90/123 (73.17%), Query Frame = 3
Query:  102 KTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            K VQ GRVAFIA G D GK+CAI EI+DQNRVLIDGP +GV R+  ++  LHLT F++ LPH SRT VVR++WL A++ ++W  ++W +KL+ + +RA + D++RF+   A + + R+++  M
Sbjct:    4 KFVQVGRVAFIANGADSGKVCAIAEIVDQNRVLIDGPCTGVRRQVCDMKRLHLTGFHLPLPHSSRTAVVRRKWLAAKLDERWTGTSWAKKLEARRLRASMTDFDRFRCARAKQIRNRIVSVAM 126          
BLAST of 60s ribosomal protein L14 vs. TrEMBL
Match: A0A1I8HLV3 (Ribosomal_L14e domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029673g2 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.494e-38
Identity = 61/123 (49.59%), Postives = 90/123 (73.17%), Query Frame = 3
Query:  102 KTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            K VQ GRVAFIA G D GK+CAI EI+DQNRVLIDGP +GV R+  ++  LHLT F++ LPH SRT VVR++WL A++ ++W  ++W +KL+ + +RA + D++RF+   A + + R+++  M
Sbjct:    6 KFVQVGRVAFIANGADSGKVCAIAEIVDQNRVLIDGPCTGVRRQVCDMKRLHLTGFHLPLPHSSRTAVVRRKWLAAKLDERWTGTSWAKKLEARRLRASMTDFDRFKCARAKQIRNRIVSVAM 128          
BLAST of 60s ribosomal protein L14 vs. TrEMBL
Match: A0A1I8IB88 (Ribosomal_L14e domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 6.753e-38
Identity = 61/123 (49.59%), Postives = 89/123 (72.36%), Query Frame = 3
Query:  102 KTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            K VQ GRVAFIA G D GK+CAI EI+DQNRVLIDGP +GV R+  ++  LHLT F++ LPH SRT VVR++WL A + ++W  ++W +KL+ + +RA + D++RF+   A + + R+++  M
Sbjct:    6 KFVQVGRVAFIANGADSGKVCAIAEIVDQNRVLIDGPCTGVRRQVCDMKRLHLTGFHLPLPHSSRTAVVRRKWLAANLDERWTGTSWAKKLEARRLRASMTDFDRFRCARAKQIRNRIVSVAM 128          
BLAST of 60s ribosomal protein L14 vs. TrEMBL
Match: A0A267GTU7 (Ribosomal_L14e domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029673g1 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 6.843e-38
Identity = 61/123 (49.59%), Postives = 89/123 (72.36%), Query Frame = 3
Query:  102 KTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            K VQ GRVAFIA G D GK+CAI EI+DQNRVLIDGP +GV R+  ++  LHLT F++ LPH SRT VVR++WL A + ++W  ++W +KL+ + +RA + D++RF+   A + + R+++  M
Sbjct:    5 KFVQVGRVAFIANGADSGKVCAIAEIVDQNRVLIDGPCTGVRRQVCDMKRLHLTGFHLPLPHSSRTAVVRRKWLAANLDERWTGTSWAKKLEARRLRASMTDFDRFRCARAKQIRNRIVSVAM 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Cavefish
Match: rpl14 (ribosomal protein L14 [Source:NCBI gene;Acc:103033049])

HSP 1 Score: 125.946 bits (315), Expect = 1.176e-36
Identity = 55/121 (45.45%), Postives = 86/121 (71.07%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            V+ GRVA++  G  +GKL AIV++IDQNR L+DGP +GV R+S+    + LT + I +PH +R K VR+ W KAE++KKW ES+W +K++ +  RA + D++RF+V  A + + ++I QE+
Sbjct:    7 VEIGRVAYVGFGPHEGKLVAIVDVIDQNRALVDGPCTGVKRQSMPFKCMQLTDYVIKIPHSARQKFVRRAWEKAEVNKKWSESSWAKKIEARQRRAKMTDFDRFKVMKAKKMRNKIIKQEV 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Cavefish
Match: rpl14 (ribosomal protein L14 [Source:NCBI gene;Acc:103033049])

HSP 1 Score: 125.946 bits (315), Expect = 1.176e-36
Identity = 55/121 (45.45%), Postives = 86/121 (71.07%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            V+ GRVA++  G  +GKL AIV++IDQNR L+DGP +GV R+S+    + LT + I +PH +R K VR+ W KAE++KKW ES+W +K++ +  RA + D++RF+V  A + + ++I QE+
Sbjct:    7 VEIGRVAYVGFGPHEGKLVAIVDVIDQNRALVDGPCTGVKRQSMPFKCMQLTDYVIKIPHSARQKFVRRAWEKAEVNKKWSESSWAKKIEARQRRAKMTDFDRFKVMKAKKMRNKIIKQEV 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Yeast
Match: RPL14A (Ribosomal 60S subunit protein L14A; N-terminally acetylated; homologous to mammalian ribosomal protein L14, no bacterial homolog; RPL14A has a paralog, RPL14B, that arose from the whole genome duplication [Source:SGD;Acc:S000001489])

HSP 1 Score: 117.857 bits (294), Expect = 2.150e-34
Identity = 53/108 (49.07%), Postives = 72/108 (66.67%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRV 431
            V+ GRV  I  G+  GKL AIVEIIDQ +VLIDGP +GV R+++N+  + LT     LP G+RT  V K+W  A + +KW  S+W +K+ ++  RA L D+ERFQV V
Sbjct:   15 VEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAKKIAQRERRAALTDFERFQVMV 122          
BLAST of 60s ribosomal protein L14 vs. Ensembl Yeast
Match: RPL14B (Ribosomal 60S subunit protein L14B; homologous to mammalian ribosomal protein L14, no bacterial homolog; RPL14B has a paralog, RPL14A, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000993])

HSP 1 Score: 117.087 bits (292), Expect = 3.855e-34
Identity = 53/108 (49.07%), Postives = 72/108 (66.67%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRV 431
            V+ GRV  I  G+  GKL AIVEIIDQ +VLIDGP +GV R+++N+  + LT     LP G+RT  V K+W  A + +KW  S+W +K+ ++  RA L D+ERFQV V
Sbjct:   15 VEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAGVCEKWAASSWAKKIAQRERRAALTDFERFQVMV 122          
BLAST of 60s ribosomal protein L14 vs. Ensembl Nematostella
Match: EDO39219 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAM6])

HSP 1 Score: 120.168 bits (300), Expect = 6.359e-35
Identity = 52/121 (42.98%), Postives = 84/121 (69.42%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            V+ GRVA I  G D+GKLC +V+++DQNR LIDGP + V R+++N+ +L LT F I +   +R+  V+K +  A++  KWE++ W +KL  +  RA LND++RF++++A + K RL+  E+
Sbjct:    7 VEVGRVALINAGPDEGKLCVVVDLVDQNRALIDGPCTSVCRQAINMKHLSLTDFKIKIGRSARSGPVKKAFEAAQVQDKWEQTAWARKLAMRKKRATLNDFDRFKLKLAKQKKNRLLRTEV 127          
BLAST of 60s ribosomal protein L14 vs. Ensembl Medaka
Match: rpl14 (ribosomal protein L14 [Source:NCBI gene;Acc:101161376])

HSP 1 Score: 119.398 bits (298), Expect = 3.968e-34
Identity = 52/121 (42.98%), Postives = 85/121 (70.25%), Query Frame = 3
Query:  108 VQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEM 470
            V+ GRVA+++ G   GKL AIV++IDQNR L+DGP +GV R+++    + LT + I +PH +R K VRK W KA++++KW +S W +K++ +  RA ++D++RF+V  A R + ++I  E+
Sbjct:    7 VEIGRVAYLSFGPHAGKLVAIVDVIDQNRALVDGPCTGVKRQAMPFKCMQLTDYVIKVPHSARQKFVRKAWEKAQVNEKWAQSNWAKKIEARQKRAKMSDFDRFKVMKAKRMRNKIIRHEV 127          
BLAST of 60s ribosomal protein L14 vs. Planmine SMEST
Match: SMESG000022343.1 (SMESG000022343.1)

HSP 1 Score: 265.774 bits (678), Expect = 7.109e-92
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 3
Query:   90 MKEVKTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEMY 473
            MKEVKTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEMY
Sbjct:    1 MKEVKTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSVNISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAIRAGLNDYERFQVRVAIRNKTRLIAQEMY 128          
The following BLAST results are available for this feature:
BLAST of 60s ribosomal protein L14 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RPL143.504e-2939.67ribosomal protein L14 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL143.504e-2939.67ribosomal protein L14 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL142.851e-2841.51ribosomal protein L14 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl-148.368e-3243.90Ribosomal Protein, Large subunit [Source:UniProtK... [more]
rpl-148.368e-3243.90Ribosomal Protein, Large subunit [Source:UniProtK... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RpL147.725e-3443.59gene:FBgn0017579 transcript:FBtr0076633[more]
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl141.547e-3949.59ribosomal protein L14 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
myl107.217e-3341.46myosin light chain 10 [Source:Xenbase;Acc:XB-GENE-... [more]
capn71.874e-3039.02calpain 7 [Source:Xenbase;Acc:XB-GENE-996630][more]
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rpl141.968e-3042.15ribosomal protein L14 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O46160|RL14_LUMRU3.343e-3450.4160S ribosomal protein L14 OS=Lumbricus rubellus OX... [more]
sp|P55841|RL14_DROME7.744e-3343.5960S ribosomal protein L14 OS=Drosophila melanogast... [more]
sp|Q95ZE8|RL14_DROVI1.051e-3243.5960S ribosomal protein L14 OS=Drosophila virilis OX... [more]
sp|P36105|RL14A_YEAST1.493e-3249.0760S ribosomal protein L14-A OS=Saccharomyces cerev... [more]
sp|P38754|RL14B_YEAST2.677e-3249.0760S ribosomal protein L14-B OS=Saccharomyces cerev... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H0564.471e-3849.59Ribosomal_L14e domain-containing protein OS=Macros... [more]
A0A267GKT14.743e-3849.59Ribosomal_L14e domain-containing protein (Fragment... [more]
A0A1I8HLV35.494e-3849.59Ribosomal_L14e domain-containing protein OS=Macros... [more]
A0A1I8IB886.753e-3849.59Ribosomal_L14e domain-containing protein OS=Macros... [more]
A0A267GTU76.843e-3849.59Ribosomal_L14e domain-containing protein (Fragment... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl141.176e-3645.45ribosomal protein L14 [Source:NCBI gene;Acc:103033... [more]
rpl141.176e-3645.45ribosomal protein L14 [Source:NCBI gene;Acc:103033... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL14A2.150e-3449.07Ribosomal 60S subunit protein L14A; N-terminally a... [more]
RPL14B3.855e-3449.07Ribosomal 60S subunit protein L14B; homologous to ... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO392196.359e-3542.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl143.968e-3442.98ribosomal protein L14 [Source:NCBI gene;Acc:101161... [more]
back to top
BLAST of 60s ribosomal protein L14 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022343.17.109e-92100.00SMESG000022343.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023172 ID=SMED30023172|Name=60s ribosomal protein L14|organism=Schmidtea mediterranea sexual|type=transcript|length=639bp
TAATTAAGAAATTATAAAATAAGTGTTTTATTAATTTGTTTTAAATGCAA
AATTACATTAAATAAAATATTTTCAAATTTATTTAGAAAATGAAAGAAGT
TAAAACTGTACAATGTGGACGTGTTGCATTTATTGCAACTGGTGAGGATC
AAGGTAAACTCTGTGCTATTGTGGAAATCATTGATCAGAACAGAGTATTG
ATTGATGGACCTTTATCTGGAGTTGTCCGTAAATCAGTTAACATCAGCAA
CTTGCATTTGACTTCTTTTAATATCCATTTACCCCATGGTTCACGAACAA
AAGTAGTAAGAAAAGAATGGTTAAAAGCCGAAATTTCTAAAAAATGGGAA
GAAAGTACTTGGTGTCAGAAATTGAAGAAGAAAGCTATCAGAGCTGGATT
AAATGATTACGAAAGATTCCAAGTTCGTGTTGCAATTAGAAACAAAACTC
GATTGATTGCCCAAGAAATGTACAAAATGAAACGTGCTGCCAAGGTTGCT
GCATAATTTTAAAAAATAAAATTTTTGGAATTTATTAAAATTTACTTATT
TTTTAATTATATCAGTGTCAAATATAGTTAAATATATAAATTTTTTATAA
TTGGATATAAATTTTGAAATAAAAGTATTAAATCTTGTG
back to top

protein sequence of SMED30023172-orf-1

>SMED30023172-orf-1 ID=SMED30023172-orf-1|Name=SMED30023172-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=139bp
MKEVKTVQCGRVAFIATGEDQGKLCAIVEIIDQNRVLIDGPLSGVVRKSV
NISNLHLTSFNIHLPHGSRTKVVRKEWLKAEISKKWEESTWCQKLKKKAI
RAGLNDYERFQVRVAIRNKTRLIAQEMYKMKRAAKVAA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003735structural constituent of ribosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR039660Ribosomal_protein_L14
IPR041985RPL14_KOW
IPR014722Rib_L2_dom2
IPR002784Ribosomal_L14e_dom
IPR008991Translation_prot_SH3-like_sf
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014722Ribosomal protein L2, domain 2GENE3DG3DSA:2.30.30.30coord: 1..86
e-value: 8.2E-32
score: 111.3
IPR002784Ribosomal protein L14e domainPFAMPF01929Ribosomal_L14ecoord: 47..115
e-value: 2.5E-24
score: 85.6
IPR039660Ribosomal protein L14PANTHERPTHR1112760S RIBOSOMAL PROTEIN L14coord: 2..135
NoneNo IPR availablePANTHERPTHR11127:SF260S RIBOSOMAL PROTEIN L14coord: 2..135
IPR041985Ribosomal protein L14, KOW motifCDDcd06088KOW_RPL14coord: 7..81
e-value: 5.74094E-23
score: 83.679
IPR008991Translation protein SH3-like domain superfamilySUPERFAMILYSSF50104Translation proteins SH3-like domaincoord: 5..96