GTPase Era

Overview
NameGTPase Era
Smed IDSMED30023168
Length (bp)1715
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GTPase Era (SMED30023168) t-SNE clustered cells

Violin plots show distribution of expression levels for GTPase Era (SMED30023168) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GTPase Era (SMED30023168) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GTPase Era (SMED30023168) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023168

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023168h1SMcG0009982 SmedASXL_009192SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GTPase Era vs. Ensembl Human
Match: ERAL1 (Era like 12S mitochondrial rRNA chaperone 1 [Source:HGNC Symbol;Acc:HGNC:3424])

HSP 1 Score: 101.293 bits (251), Expect = 3.056e-22
Identity = 58/163 (35.58%), Postives = 98/163 (60.12%), Query Frame = 3
Query:  147 LFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            L +  P+ P++S+VL++ +LG PN+GKS+L N L    +  VS KV+TTR +   V+T+   Q+  +D PG+I   K     LE SL+ DP   +  +DL++ L+D S K ++ +L  +LL+ L  +   P++LV+NK+D + +     ++   +T G+V GK
Sbjct:  100 LLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTEGVVNGK 262          

HSP 2 Score: 82.8037 bits (203), Expect = 3.181e-16
Identity = 40/143 (27.97%), Postives = 79/143 (55.24%), Query Frame = 3
Query: 1152 NLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLT 1580
            ++ + ++  W +F+++F +S+L    ++ L+ YL+ +A+PG W +HS++++ Q PE +    +  K L+ L +E+PY ++     +E+   G L I   +      ++  L+G KG  IS IA E+   L   F   V ++L+
Sbjct:  290 SVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLS 432          
BLAST of GTPase Era vs. Ensembl Human
Match: ERAL1 (Era like 12S mitochondrial rRNA chaperone 1 [Source:HGNC Symbol;Acc:HGNC:3424])

HSP 1 Score: 92.8189 bits (229), Expect = 2.100e-20
Identity = 55/159 (34.59%), Postives = 94/159 (59.12%), Query Frame = 3
Query:  147 LFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGI 623
            L +  P+ P++S+VL++ +LG PN+GKS+L N L    +  VS KV+TTR +   V+T+   Q+  +D PG+I   K     LE SL+ DP   +  +DL++ L+D S K ++ +L  +LL+ L  +   P++LV+NK+D + +     ++   +T  I
Sbjct:  100 LLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTEAI 258          
BLAST of GTPase Era vs. Ensembl Human
Match: ERAL1 (Era like 12S mitochondrial rRNA chaperone 1 [Source:HGNC Symbol;Acc:HGNC:3424])

HSP 1 Score: 89.3521 bits (220), Expect = 4.470e-19
Identity = 52/138 (37.68%), Postives = 85/138 (61.59%), Query Frame = 3
Query:  147 LFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNK 560
            L +  P+ P++S+VL++ +LG PN+GKS+L N L    +  VS KV+TTR +   V+T+   Q+  +D PG+I   K     LE SL+ DP   +  +DL++ L+D S K ++ +L  +LL+ L  +   P++LV+NK
Sbjct:   97 LLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNK 234          
BLAST of GTPase Era vs. Ensembl Human
Match: ERAL1 (Era like 12S mitochondrial rRNA chaperone 1 [Source:HGNC Symbol;Acc:HGNC:3424])

HSP 1 Score: 54.6842 bits (130), Expect = 4.466e-8
Identity = 30/78 (38.46%), Postives = 46/78 (58.97%), Query Frame = 3
Query:  147 LFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKG 380
            L +  P+ P++S+VL++ +LG PN+GKS+L N L    +  VS KV+TTR +   V+T+   Q        V+G  KG
Sbjct:  100 LLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQ--------VVGTYKG 169          
BLAST of GTPase Era vs. Ensembl Celegans
Match: eral-1 (Uncharacterized GTP-binding protein E02H1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09523])

HSP 1 Score: 77.7962 bits (190), Expect = 3.887e-15
Identity = 49/153 (32.03%), Postives = 81/153 (52.94%), Query Frame = 3
Query:  180 SKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKN------KGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNG 620
            +K L++AV+G PN GKS L N L R  + AVS K++TT    +A +  D+ QL FVD PG +  +      K  +      +++DP   +  +  ++ + D++   +   +   +L  LH +   P+ILV+NKID V +      +V  +TNG
Sbjct:   31 TKCLQLAVIGAPNVGKSLLTNSLIRCPLSAVSSKMDTTTRNISASICSDSTQLVFVDSPGAVSTSHVRQTMKKTSATSGDRVLQDPERALQRAQHVLVVQDSTAPGAY--IHHRVLHMLHRYSHVPSILVMNKIDLVMRRSDLLPLVEILTNG 181          

HSP 2 Score: 72.7886 bits (177), Expect = 1.442e-13
Identity = 41/133 (30.83%), Postives = 67/133 (50.38%), Query Frame = 3
Query: 1179 WTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKL 1577
            W+ FE VF VSSL+G GI+ELR++L++ +  G W     + + +  + L    + A  LD    ++ Y ++I +  +E+  +  L I   IRC+  R    ++G  G  IS I       L   FQ  +Y +L
Sbjct:  250 WSGFERVFFVSSLNGEGIDELRDHLMSISPQGEWKMQDGMPTGESAQQLCIDSIRAAVLDTTPSDVAYTVQIRISEWEEQGE-VLQIVGEIRCQKPRDGSLIIGKGGKRISEIGRRVNEHLHSLFQRQLYARL 381          
BLAST of GTPase Era vs. Ensembl Fly
Match: CG7488 (gene:FBgn0038106 transcript:FBtr0082695)

HSP 1 Score: 94.3597 bits (233), Expect = 1.547e-20
Identity = 50/151 (33.11%), Postives = 83/151 (54.97%), Query Frame = 3
Query:  165 NSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITN 617
            N  ++ + L IAV+G PN GKS+ +N      +C  S KV+TTR   TA+ T    QL F D PG++ +++     L+++        I  +D+I  + DAS+  +++EL   +L  L  + + P+ LVLNKID +       D+++ +TN
Sbjct:   52 NPGEEQRSLHIAVIGVPNVGKSTFINNTVNHRVCPTSAKVHTTRQSNTAIYTTGQTQLVFYDTPGLVTQHEIRRHHLDQNFKSAYRHAIQHADIIAVVHDASNAWTRKELHPTVLDTLKAYSNLPSFLVLNKIDALKSKRLLLDLIKTLTN 202          

HSP 2 Score: 92.4337 bits (228), Expect = 6.778e-20
Identity = 51/164 (31.10%), Postives = 87/164 (53.05%), Query Frame = 3
Query: 1104 KDEILERRAKWHEIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTGARIG 1595
            K E+  + A   EI  N    R++SW++F DVF VS+L G G++E++NYL+ +AKP  W + + + +D  PE L+   V A+ LD L +EIPY +K ++  Y   +   ++  V ++C ++R    + G     +  I +     L + F   V L ++    G
Sbjct:  209 KREVQAKSALAKEIRIN---KRESSWSHFSDVFLVSALTGNGLQEMQNYLVGQAKPRDWKYPADIHTDSSPEALIVESVRARLLDYLPQEIPYNLKCEI-EYYSVEKNVVYTSVQVQCPTTRIERLICGEGNGKLRQITERVTSDLVEMFGQAVSLTISTVSKG 368          
BLAST of GTPase Era vs. Ensembl Fly
Match: CG13390 (gene:FBgn0032031 transcript:FBtr0079723)

HSP 1 Score: 58.9214 bits (141), Expect = 6.328e-9
Identity = 46/152 (30.26%), Postives = 74/152 (48.68%), Query Frame = 3
Query:  195 IAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIG---KNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHK---TSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQF-DIVRKITNGIVG 629
            + ++G PN+GKS+L+N LTR           T R     V   D+VQL   D+PG++    +NKG   +  K   R          L++ +LDAS     T  E+L  EL +       +P ++V NK+D V +    F ++ R++ N ++G
Sbjct:  208 VGLIGYPNAGKSTLLNALTRAKPKVAPYAFTTLRPHLGTVQYDDHVQLTIADLPGLVPDAHRNKGLGIQFLKHAER--------CTLLLFVLDASAPEPWTHYEQLMHELRQFGGRLASRPQLVVANKLD-VEEGQNNFEELQRRLQNPVLG 350          
BLAST of GTPase Era vs. Ensembl Zebrafish
Match: eral1 (Era-like 12S mitochondrial rRNA chaperone 1 [Source:NCBI gene;Acc:569087])

HSP 1 Score: 117.472 bits (293), Expect = 7.289e-28
Identity = 67/163 (41.10%), Postives = 104/163 (63.80%), Query Frame = 3
Query:  147 LFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            L M  P+ P+++K LK+A++G PN+GKS+L N L    + AVS KV+TTR++   VLT+++ Q+  +D PG+  + K    +LE SL+ DP   + E+DL++ L+D S K ++ +L  E+LK L    D PA+LVLNK+D +       DI  ++T G+V GK
Sbjct:   97 LLMKDPDQPENAKSLKVAIVGSPNAGKSTLTNQLLGRKLFAVSSKVHTTRSRAVGVLTENDTQIVLLDTPGLTTQIKAKRHQLENSLLVDPFKSLKEADLVVVLVDVSDKWTRSKLSYEVLKCLALNPDVPAVLVLNKVDLLKNKALLLDITAQLTEGMVNGK 259          

HSP 2 Score: 91.2781 bits (225), Expect = 3.356e-19
Identity = 46/135 (34.07%), Postives = 76/135 (56.30%), Query Frame = 3
Query: 1176 SWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLT 1580
             W +F+DVF +SS+D   +E L+ YL   AKP  W +HS +++DQ PE +    +  K L  L KE+PY +  ++  +++S+DG L I + +  +   H+  ++G  G  I+ I  E+   L K F   V LK++
Sbjct:  308 GWPHFKDVFMLSSIDHEDVETLKRYLFVAAKPCQWQYHSEVLTDQSPEDVCFNTIREKLLQNLPKEVPYTMTQEIEVWKESEDGVLDISIKLYVQKETHMKMVIGPGGQLITRINQEAGNDLMKIFLCNVRLKIS 442          
BLAST of GTPase Era vs. Ensembl Xenopus
Match: ERAL1 (Era-like 12S mitochondrial rRNA chaperone 1 [Source:NCBI gene;Acc:100495069])

HSP 1 Score: 123.25 bits (308), Expect = 6.993e-30
Identity = 63/166 (37.95%), Postives = 102/166 (61.45%), Query Frame = 3
Query:  138 YQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            +  L + +P+ P ++K+L+IA++G PN+GKS+L N L    +  VS KV+TTR +   V+T+   QL  +D PG++  +K     LEKSL+ DP   +  +DL++ LLD S   ++  L+ E+LK L  F++ P+ILVLNK+D + +     D+  ++T G V  K
Sbjct:   63 HDSLLIHRPDQPANAKILRIAIIGSPNAGKSTLSNQLLGRKVFPVSKKVHTTRCQAQGVITEGETQLVLLDTPGMVTTSKVKRHNLEKSLLHDPWQSMKSADLVLVLLDVSDHWTRSSLNFEVLKCLSQFQNIPSILVLNKVDLIKQKGILLDLTNQLTEGTVNSK 228          

HSP 2 Score: 83.5741 bits (205), Expect = 1.209e-16
Identity = 41/135 (30.37%), Postives = 73/135 (54.07%), Query Frame = 3
Query: 1176 SWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLT 1580
             W +F+DVF +S+++G  ++ L+ YL++ AKPG W +HS +++ Q P+ +    +  K L+ L +E+PY +      +E+   G L I   +  +   H   L+G  G  I  IA E+ + L   F   V ++L+
Sbjct:  265 GWPHFQDVFMLSAVNGDEVQTLKRYLLSLAKPGEWEYHSDVVTSQSPQEICNNIIREKLLEYLPQEVPYNVTQVTDLWEEGPGGELVILQTLLVQKENHAKLLIGAGGQMIKRIALEAGQDLMNVFLCEVRVRLS 399          
BLAST of GTPase Era vs. Ensembl Mouse
Match: Eral1 (Era (G-protein)-like 1 (E. coli) [Source:MGI Symbol;Acc:MGI:1889295])

HSP 1 Score: 102.449 bits (254), Expect = 6.965e-23
Identity = 65/191 (34.03%), Postives = 108/191 (56.54%), Query Frame = 3
Query:   69 RKLFLSNIKTELQPRFPHLKSELYQKLFML--QPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            R L  S   + L P  P +     ++  +L   P+ P++ +VL++ +LG PN+GKS+L N L    +  VS KV+TTR +   V+T+   Q+  +D PG+I   K     LE+SL+ DP   +  +DL++ L+D S K ++  L+ ++L+ L  F   P+ILVLNK+D + +     ++   +T G+V GK
Sbjct:   72 RILGFSQPDSSLVPSVPAVSVHRDEQNLLLVHTPDMPENPRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSKKVHTTRCQALGVITEKETQVILLDTPGIISPVKQKRHHLERSLLEDPWTSMESADLVVVLVDVSDKWTRSRLNPQVLQCLTKFSQVPSILVLNKVDCLKQKSVLLELTAALTEGVVNGK 262          

HSP 2 Score: 90.5077 bits (223), Expect = 6.547e-19
Identity = 45/145 (31.03%), Postives = 79/145 (54.48%), Query Frame = 3
Query: 1146 AANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLT 1580
            A ++ + ++  W YF+++F +S+L+   +  L+ YL+ +A+PG W FHS +++ Q PE +    +  K L+ L +E+PY ++     +E+   G L I   +      H+  L+G KG  IS IA E  R L   F   V ++L+
Sbjct:  288 AHSVRNPQRIGWPYFQEIFMLSALNNKDVNTLKQYLLTQAQPGPWEFHSGVLTSQTPEEICANKIREKLLEYLPEEVPYGVQQKTVIWEEGPSGELVIQQNLLVPKESHVRILIGQKGLLISQIAQEVGRDLMDIFHCDVLIRLS 432          
BLAST of GTPase Era vs. UniProt/SwissProt
Match: sp|B5X2B8|ERAL1_SALSA (GTPase Era, mitochondrial OS=Salmo salar OX=8030 GN=eral1 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.528e-30
Identity = 66/163 (40.49%), Postives = 102/163 (62.58%), Query Frame = 3
Query:  147 LFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            L +  P+ P++SKVL++A++G PN+GKS+L N L    + AVS KV+TTR +   VLT+D+ Q+  +D PG+    K    +LEKSL+ DP   + E+ L++ ++D S K +  +LD E+LK L    D PA+LVLNK+D +       +I   +T G+V G+
Sbjct:   95 LLVKDPDQPENSKVLRVAIIGAPNAGKSTLSNQLLGRKVFAVSKKVHTTRARALGVLTEDDTQIILLDTPGLTTPTKVKRHQLEKSLLEDPWNTVKEAGLVVVMVDVSDKWACNKLDFEVLKCLTQHPDVPAVLVLNKVDLLKSKSRLLEITADLTCGVVNGR 257          

HSP 2 Score: 101.679 bits (252), Expect = 1.239e-21
Identity = 49/137 (35.77%), Postives = 77/137 (56.20%), Query Frame = 3
Query: 1170 QTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLT 1580
            Q  W +F+DVF VS++DG  +E L+ YL+  AKPG W +HS +++DQ PE +    V  K L+ L KE+PY +   +  +   ++G L I V +  K   H+  ++G  G  ++ IA E+   L   F   V L+L+
Sbjct:  316 QQGWAHFKDVFMVSAVDGEDVETLKRYLVVGAKPGSWQYHSDVLTDQTPEEICTNTVREKLLEYLPKEVPYTMTQAIDLWHDRENGELDIAVKLYVKKESHMKMVIGQAGQMVARIAREAGDDLSTVFLREVKLRLS 452          
BLAST of GTPase Era vs. UniProt/SwissProt
Match: sp|Q8JIF5|ERAL1_CHICK (GTPase Era, mitochondrial OS=Gallus gallus OX=9031 GN=ERAL1 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.671e-29
Identity = 63/168 (37.50%), Postives = 102/168 (60.71%), Query Frame = 3
Query:  132 ELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            E + ++   +P+ P + KVL+I+++G PNSGKS+L N L    +  VS KV+TTR K   V+T ++ QL  +D PG+    K    KLE +++ DP   +  +DL++ L+D S   ++  L +E+LK L  F   P++LVLNK+D + K +    ++ ++T GIV GK
Sbjct:   72 EKHARIVQGRPDQPAEPKVLRISIIGAPNSGKSTLSNQLLGRKVFPVSKKVHTTRCKARGVITHEDTQLIILDTPGLTSPMKAKRHKLEAAMLTDPWDSMKHADLVLVLVDVSDHWTRNSLSLEVLKCLSQFPHIPSVLVLNKVDLLKKKIILLGLINELTEGIVNGK 239          

HSP 2 Score: 86.6557 bits (213), Expect = 1.053e-16
Identity = 43/134 (32.09%), Postives = 73/134 (54.48%), Query Frame = 3
Query: 1176 SWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKL 1577
             W +F+D+F +++L+G  ++ L+ YL+ +AKPG W FHS +++ Q P  +    +  K L+ L  E+PY +      +E+   G L I   +      H + L+G +G+ IS IA E+ + L   F   + LKL
Sbjct:  322 GWPHFQDIFMLAALNGEEVDTLKQYLLMQAKPGPWEFHSRVLTSQSPHEICDNIIREKILEYLPLEVPYGVTQVTELWEEGPSGELIIVQNLVVPRKSHKLMLIGRRGALISRIAQEAGQDLMNIFLCDIRLKL 455          
BLAST of GTPase Era vs. UniProt/SwissProt
Match: sp|B0S6U7|ERAL1_DANRE (GTPase Era, mitochondrial OS=Danio rerio OX=7955 GN=eral1 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 5.502e-27
Identity = 67/163 (41.10%), Postives = 104/163 (63.80%), Query Frame = 3
Query:  147 LFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            L M  P+ P+++K LK+A++G PN+GKS+L N L    + AVS KV+TTR++   VLT+++ Q+  +D PG+  + K    +LE SL+ DP   + E+DL++ L+D S K ++ +L  E+LK L    D PA+LVLNK+D +       DI  ++T G+V GK
Sbjct:   97 LLMKDPDQPENAKSLKVAIVGSPNAGKSTLTNQLLGRKLFAVSSKVHTTRSRAVGVLTENDTQIVLLDTPGLTTQIKAKRHQLENSLLVDPFKSLKEADLVVVLVDVSDKWTRSKLSYEVLKCLALNPDVPAVLVLNKVDLLKNKALLLDITAQLTEGMVNGK 259          

HSP 2 Score: 91.2781 bits (225), Expect = 2.533e-18
Identity = 46/135 (34.07%), Postives = 76/135 (56.30%), Query Frame = 3
Query: 1176 SWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLT 1580
             W +F+DVF +SS+D   +E L+ YL   AKP  W +HS +++DQ PE +    +  K L  L KE+PY +  ++  +++S+DG L I + +  +   H+  ++G  G  I+ I  E+   L K F   V LK++
Sbjct:  308 GWPHFKDVFMLSSIDHEDVETLKRYLFVAAKPCQWQYHSEVLTDQSPEDVCFNTIREKLLQNLPKEVPYTMTQEIEVWKESEDGVLDISIKLYVQKETHMKMVIGPGGQLITRINQEAGNDLMKIFLCNVRLKIS 442          
BLAST of GTPase Era vs. UniProt/SwissProt
Match: sp|Q9CZU4|ERAL1_MOUSE (GTPase Era, mitochondrial OS=Mus musculus OX=10090 GN=Eral1 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.872e-22
Identity = 65/191 (34.03%), Postives = 108/191 (56.54%), Query Frame = 3
Query:   69 RKLFLSNIKTELQPRFPHLKSELYQKLFML--QPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            R L  S   + L P  P +     ++  +L   P+ P++ +VL++ +LG PN+GKS+L N L    +  VS KV+TTR +   V+T+   Q+  +D PG+I   K     LE+SL+ DP   +  +DL++ L+D S K ++  L+ ++L+ L  F   P+ILVLNK+D + +     ++   +T G+V GK
Sbjct:   72 RILGFSQPDSSLVPSVPAVSVHRDEQNLLLVHTPDMPENPRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSKKVHTTRCQALGVITEKETQVILLDTPGIISPVKQKRHHLERSLLEDPWTSMESADLVVVLVDVSDKWTRSRLNPQVLQCLTKFSQVPSILVLNKVDCLKQKSVLLELTAALTEGVVNGK 262          

HSP 2 Score: 90.5077 bits (223), Expect = 4.579e-18
Identity = 45/145 (31.03%), Postives = 79/145 (54.48%), Query Frame = 3
Query: 1146 AANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLT 1580
            A ++ + ++  W YF+++F +S+L+   +  L+ YL+ +A+PG W FHS +++ Q PE +    +  K L+ L +E+PY ++     +E+   G L I   +      H+  L+G KG  IS IA E  R L   F   V ++L+
Sbjct:  288 AHSVRNPQRIGWPYFQEIFMLSALNNKDVNTLKQYLLTQAQPGPWEFHSGVLTSQTPEEICANKIREKLLEYLPEEVPYGVQQKTVIWEEGPSGELVIQQNLLVPKESHVRILIGQKGLLISQIAQEVGRDLMDIFHCDVLIRLS 432          
BLAST of GTPase Era vs. UniProt/SwissProt
Match: sp|O75616|ERAL1_HUMAN (GTPase Era, mitochondrial OS=Homo sapiens OX=9606 GN=ERAL1 PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 1.468e-21
Identity = 58/163 (35.58%), Postives = 98/163 (60.12%), Query Frame = 3
Query:  147 LFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            L +  P+ P++S+VL++ +LG PN+GKS+L N L    +  VS KV+TTR +   V+T+   Q+  +D PG+I   K     LE SL+ DP   +  +DL++ L+D S K ++ +L  +LL+ L  +   P++LV+NK+D + +     ++   +T G+V GK
Sbjct:  100 LLVHHPDMPENSRVLRVVLLGAPNAGKSTLSNQLLGRKVFPVSRKVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKSMESADLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTEGVVNGK 262          

HSP 2 Score: 82.8037 bits (203), Expect = 1.528e-15
Identity = 40/143 (27.97%), Postives = 79/143 (55.24%), Query Frame = 3
Query: 1152 NLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLT 1580
            ++ + ++  W +F+++F +S+L    ++ L+ YL+ +A+PG W +HS++++ Q PE +    +  K L+ L +E+PY ++     +E+   G L I   +      ++  L+G KG  IS IA E+   L   F   V ++L+
Sbjct:  290 SVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLS 432          
BLAST of GTPase Era vs. TrEMBL
Match: A0A4E0R0Z8 (GTP binding protein era OS=Fasciola hepatica OX=6192 GN=D915_007618 PE=4 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 2.988e-121
Identity = 223/573 (38.92%), Postives = 314/573 (54.80%), Query Frame = 3
Query:  117 PHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQ-FDIVRKITNGIVGGKCSHKDSYANRFKRD----------------IPSYQELLADSKAEKLLNKHLQRRVISGSESVAVEN----ISPE-LETDINVDLSTKTESGSTENLSNDYFTSYKNDTDNTSTNIDESENHLSPSEISNQINEMDDDKFKNFLKQSDQNN-NNTMLSEDIDEP---------------------------ILGVLKRQLMLYSATKDEILERRAKWHEIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGL-WYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKS--DDGS--LHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTGARIGIPSEHFKRMKSVTNVKKLFPKTATA 1670
            PH K+E  QKL + QP+SP +++ LK+AV GCPN+GKSSL+NMLT+W +CAVSGK +TTR+KQ A L +DNVQ+ FVD+PG++ K K   F L+K+ IRDPH   FE+D+I+ ++D SH  S+ ELD E++KALHFF DK +ILVLNKID      T+  DI R++T G V G+  H D+Y  RF R                 I +Y   +   +A K+L+K  + R        AV      + PE  +    VD     +   +E L+    T+ +  TD  +  IDE   H  P          + D   N +    Q+  N+ + S  +DEP                           +L  LK+QL+L+SA+ +E+ ERR +W E++  +     TSW  F  VF VSS +G GI+ LR+YL  RA PG  W+   SL++DQEP  LV+MCV A CLD L +EIPY ++I V + EK+  DDG   + +H  I+CKS RHL  +LG KGS I+ +A   K+ L   F+  V +KLT     I      R++   +   +FP+   A
Sbjct:   61 PHTKAEYLQKLLIQQPHSPPNARTLKVAVFGCPNTGKSSLINMLTKWRVCAVSGKAHTTRSKQMAALMKDNVQVVFVDLPGIVNKGKARQFNLDKAFIRDPHSASFEADIIMVVVDVSHPRSRSELDPEIVKALHFFDDKESILVLNKIDLARNNPTRLLDITRRLTQGTVDGRRWHLDAYQARFNRRARLSPTSPMLQPPSELIAAYLPPVCHEEANKMLSKLAEIRARLNPPIEAVPKVRLLVDPEHRDMPAEVDEDETIDVQPSEVLNTPTETADRPVTDVETEVIDEYFKHYKPESHLAASPRSESDFEDNSVNTDPQDEVNDALCSTPVDEPTSVINDSDPLRAHQLKLLARDDPYLDALLDTLKQQLLLHSASPEEVAERRKRWLEVSVAVQGV--TSWPGFSSVFMVSSANGDGIDRLRDYLFQRAIPGRPWFMSPSLVTDQEPSELVRMCVWAHCLDKLRQEIPYSLRIVVDDCEKARLDDGDDRVFVHARIQCKSERHLRQVLGIKGSTITELAASVKQELMNMFRANVVVKLTAEMASIRPNIRHRIRQAEDFADVFPEQGRA 631          
BLAST of GTPase Era vs. TrEMBL
Match: A0A504YUQ1 (GTP binding protein era OS=Fasciola gigantica OX=46835 GN=FGIG_08488 PE=4 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.855e-120
Identity = 220/573 (38.39%), Postives = 322/573 (56.20%), Query Frame = 3
Query:  117 PHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQ-FDIVRKITNGIVGGKCSHKDSYANRFKRD----------------IPSYQELLADSKAEKLLNKHLQRRVISGSESVAVENIS-----------PELETDINVD------LSTKTESGSTE------NLSNDYFTSYKNDTDNTSTNIDESE------NHLSPSEISNQINEMDDDKFKNFLKQSDQNNNNTMLSEDIDEP----ILGVLKRQLMLYSATKDEILERRAKWHEIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGL-WYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKS--DDGS--LHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTGARIGIPSEHFKRMKSVTNVKKLFPKTATA 1670
            PH K+E  QKL + QP+SP +++ LK+AV GCPN+GKSSL+NMLT+W +CAVSGK +TTR+KQ A L +DNVQ+ FVD+PG++ K K   F L+K+ IRDPH   FE+D+I+ ++D SH  S+ ELD E++KALHFF DK +ILVLNKID      T+  DI R++T G V G+  H D+Y  RF R                 I +Y   +   +A K+L+K  + R        AV  +             E++ D   D      L+T TE+           + ++YF  YK ++ + ++   ES+      N     E+++ +     D+  + +  +D    + +     D+P    +L  LK+QL+L+SA+ +E+ ERR +W E++  +     TSW  F  VF VSS +G GI+ LR+YL  RA PG  W+   SL++DQEP  LV+MCV A CLD L +EIPY ++I V + EK+  DDG   + +H  I+CKS RHL  +LG KGS I+ +A   K+ L   F+  V +KLT     I      R++   +   +FP+   A
Sbjct:   61 PHTKAEYLQKLLIQQPHSPPNARTLKVAVFGCPNTGKSSLINMLTKWRVCAVSGKAHTTRSKQMAALMKDNVQVVFVDLPGIVNKGKARQFNLDKAFIRDPHSASFEADIIMVVVDVSHPRSRSELDPEIVKALHFFDDKESILVLNKIDLARNNPTRLLDITRRLTQGTVDGRRWHLDAYQARFNRRARLSPTSPMLQPPSELIAAYLPPVCHEEANKMLSKLAEIRARLSPPIEAVPKVRLLVDPEHRDMLAEVDEDETRDLQPSEVLNTPTETADRPVTDVETEVIDEYFKHYKPESHSATSPRSESDFEDNSANADPQDEVNDALCSTPGDEPTSLINDNDPLRAHQLKLLTRDDPYLDALLDTLKQQLLLHSASPEEVAERRKRWLEVSVAVQGV--TSWPGFSSVFMVSSANGDGIDRLRDYLFQRAIPGRPWFMSPSLVTDQEPSELVRMCVWAHCLDKLRQEIPYSLRIVVDDCEKARLDDGDDRVFVHARIQCKSERHLRQVLGIKGSTITELAASVKQELMNMFRANVVIKLTAEMASIRPNVRHRIRQAKDFADVFPEQDRA 631          
BLAST of GTPase Era vs. TrEMBL
Match: A0A1S8X8D2 (G domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=X801_01171 PE=4 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 7.322e-117
Identity = 216/564 (38.30%), Postives = 328/564 (58.16%), Query Frame = 3
Query:  117 PHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQ-FDIVRKITNGIVGGKCSHKDSYANRF-KRD---------------IPSYQELLADSKAEKLLN--KHLQRRV-ISGSESVAVENIS-------PELETDINVDLSTKTESGST---------ENLSND-YFTSYKNDTDNTSTNID-ESENHLSPSEISNQINEMDDDKFKNFLKQSDQNNNNTMLSEDID-EPILGVLKRQLMLYSATKDEILERRAKWHEIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGL-WYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSD------DGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTGARIGIPSEHFKRMKSVTNVKKLFPKTATA 1670
            P   +E +QKL + QP +P D++VLK+AV+GCPN+GKSSLVNML +W +CAV+GK +TTR+KQ A L QDNVQ+ FVD+PG++  +K ++F LEKS IRDPH  IFESD+I+ ++D +HK S+EELD E++KALHFF+DK ++LVLNKIDK     T+  ++ R++T GIV  + SH D+Y +RF KR                I +Y   +   +A KLL     L+ ++  S  E   V  IS       PE++TD    + T   S  T         E  + D YF +Y+  T   +++ + ++   +   E+ + +NE +       L ++D+N        DI  + +L  L+ QLML SAT++E+  RR +W +I+ ++N    + W+ F +VF VSS  G GI  LR+YL+++A PG  W     L++DQEP  LV+MC+ A CL+ L +EIPY ++I V + EK++      D  + +H  I+C+S RHL  +LG  G+ I  IA   K  L   F+    +KLT     +     ++++   +  ++FP+   A
Sbjct:    5 PATNAEYFQKLLLQQPKTPPDARVLKVAVIGCPNAGKSSLVNMLVKWRVCAVAGKAHTTRSKQMASLMQDNVQVVFVDLPGLVNSSKAWSFNLEKSFIRDPHSAIFESDIILVVVDVTHKRSREELDEEVVKALHFFQDKESVLVLNKIDKARNNPTRLLEVTRRLTGGIVRNRRSHVDAYESRFLKRAKMSPSTPRLKPPSEVIAAYLPPVCHEEANKLLAYLSSLRSQLSFSVCEDTQVNLISAEPKHSLPEVKTDEADSVETSVTSNPTFEGRTVTDVELATIDAYFANYQPGTGGRASDSEMQNSRDMENPEMVSAMNETET------LTETDKN--------DIYLKSLLETLQEQLMLKSATREEVAARRKRWLDISRSVNGV--SDWSGFSEVFMVSSATGDGINRLRDYLVSKAVPGRPWMLSPLLVTDQEPAELVRMCIWAHCLNQLRQEIPYSVRIVVDDCEKANLTGDEGDDRVFVHARIQCRSERHLRHVLGPSGNTIRDIAAAVKLELMSMFRANTVVKLTAEMASVNPTIMRKLRRAEDFAEVFPEQGRA 552          
BLAST of GTPase Era vs. TrEMBL
Match: A0A419Q6J0 (GTPase Era OS=Clonorchis sinensis OX=79923 GN=eral1 PE=4 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 1.355e-116
Identity = 216/561 (38.50%), Postives = 328/561 (58.47%), Query Frame = 3
Query:  123 LKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQ-FDIVRKITNGIVGGKCSHKDSYANRF-KRD---------------IPSYQELLADSKAEKLLNKHL----QRRVISGSESVAVENIS-------PELETDI--NVDLSTKTESGSTENLS---------NDYFTSYKNDTDNTSTNID-ESENHLSPSEISNQINEMDDDKFKNFLKQSDQNNNNTMLSEDIDEPILGVLKRQLMLYSATKDEILERRAKWHEIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPG-LWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSD------DGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTGARIGIPSEHFKRMKSVTNVKKLFPKTA 1664
             ++E +QKL + QP +P D++VLK+AV+GCPN+GKSSLVNML +W +CAV+GK +TTR+KQ A L QDNVQ+ FVD+PG++   K ++F LEKS IRDPH  IFESD+I+ ++D +H+ S+EELD E++KALHFF+DK +ILVLNKIDK     T+  ++ R++T GIV  + SH D+Y +RF KR                I +Y   +   +A KLL  HL     +  +S  E   V  IS       PE+ TD   +VD S  T S S E            + YF +Y+ +T   +++ + +    L   E+ + I+E +       L ++D+++          + +L  L+ QLML SAT++E+  RR +W +I+ ++     ++W+ F +VF VSS  G GI+ LR+YL+++A PG LW     L++DQEP  LV+MC+ A CL+ L +EIPY ++I V + EK++      D  + +H  I+C+S RHL  +LG  G+ I  IA   K  L   F+    +KLT     +     ++++   +  ++FP  A
Sbjct:    8 FEAEYFQKLLLQQPKTPPDARVLKVAVIGCPNAGKSSLVNMLVKWRVCAVAGKAHTTRSKQMAALMQDNVQVVFVDLPGLVNSTKAWSFNLEKSFIRDPHSAIFESDVILVVVDVTHRRSREELDEEVVKALHFFQDKESILVLNKIDKARNNPTRLLEVTRRLTGGIVRNRRSHVDAYESRFLKRSKMSPSTPRLKPPSEVIAAYLPPVCHEEANKLL-AHLSFLRSQLSLSVCEDTQVNLISAEPNHSLPEVRTDEVDSVDTSV-TSSHSFEGRKVTDVELATIDAYFANYQPETGGRASDSEMQISRELENPEMVSAIDETET------LTETDKDDIYL-------KSLLETLQEQLMLKSATREEVAARRKRWLDISRSVKGV--SNWSGFSEVFMVSSATGDGIDRLRDYLVSKAVPGRLWMLSPLLVTDQEPAELVRMCIWAHCLNQLRQEIPYSVRIVVDDCEKANLTGDEGDDRVFVHARIQCRSERHLRHVLGPNGNTIRDIAAAVKLELMSMFRANTVVKLTAEMASVNPTIMRKLRRAEDFAEVFPGRA 551          
BLAST of GTPase Era vs. TrEMBL
Match: A0A5K4F5N4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 8.950e-115
Identity = 223/547 (40.77%), Postives = 323/547 (59.05%), Query Frame = 3
Query:  117 PHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQ-FDIVRKITNGIVGGKCSHKDSYANRFKRDIPSYQELLADSKAEKL-LNKHLQRRVISGSES------VAVENISPELE-TDINVDLS---------TKTESGSTENLSNDYFTSYKN------DTDNTSTN-----IDESENHLSPSEISNQINEMDDDKFKNFLKQSDQNNNNTMLSEDIDEPILGVLKRQLMLYSATKDEILERRAKWHEIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGL-WYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEK----SDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTGARIGIPSEHFKRMKSVTNVKKLFP 1655
            P+ K E  + L + QP S  D++VLK+AV+GCPNSGKSSLVNMLT+W +CAVSGK +TTR+KQTA   QDNVQL FVD+PG++G++K   FKLEK+ IRDPH  IF+SDLI+ ++D SHK S+E L  E++KALHFF DK ++LVLNKID++ K  T+  DI RK+T GIV G+ SH D YANRFKR     Q  LAD+    +  N+ +  R+ +          V + N+  ++E T ++VD++          + +S S   L + +    +       D  N   N      D    H S +EI NQ+         N   +S+Q  +    S+ ID  +L  LK+QL+L +A+ +E+  RR +W EI  +      T W  F +VF VSS  G GI++LR++L+++A P   W    ++I+DQEP  L++MCV + CL+ L++EIPY + I V + +K    S D  ++IHV IRCK+ R L+ +LG KG+ I  I+   K  L   F+    +KLT     I S   K+++   +  ++FP
Sbjct:   48 PNTKREYLENLLLQQPLSSPDARVLKVAVIGCPNSGKSSLVNMLTKWKVCAVSGKAHTTRSKQTATYFQDNVQLAFVDLPGLVGRSKASRFKLEKTFIRDPHSAIFDSDLILVVIDVSHKESREVLHEEIVKALHFFNDKESVLVLNKIDRLSKNPTRLLDIARKLTGGIVHGRRSHIDRYANRFKR-----QAKLADTTHHLIPPNELIAARLPAVCHQTTNKFLVYMNNLLAQIESTQVDVDITDSKLIPDNMVEKKSLSDAFLKDHFLNEMEEHRDAFFDCHNIPGNDKLMPSDSQSLHKSKAEI-NQL-------LLNTCGESNQILDANSDSDHIDS-MLETLKQQLLLQTASPEEVCNRRNRWLEITKSTKGV--TKWLGFSEVFMVSSFIGDGIDKLRDFLVSKAIPTRSWILPPTMITDQEPTELIRMCVWSHCLNKLQQEIPYSLHIIVDDCDKIKLDSGDDRVYIHVRIRCKNERQLLRVLGMKGNTIKEISSAVKLELMTMFRCNTVVKLTAELFKIDSNIKKKLRRTQDFSEVFP 578          
BLAST of GTPase Era vs. Ensembl Cavefish
Match: eral1 (Era like 12S mitochondrial rRNA chaperone 1 [Source:NCBI gene;Acc:103029521])

HSP 1 Score: 118.627 bits (296), Expect = 1.624e-28
Identity = 71/181 (39.23%), Postives = 107/181 (59.12%), Query Frame = 3
Query:   93 KTELQPRFPHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            K   QP  P    +    L M  P+ P++ + L++AV+G PN+GKS+L N L    + AVS KV+TTR++   VLT+D+ Q+  +D PG+   +K     LEKSL+ DP   ++E+DL++ L+D S K ++  LD E+LK L      PA+LVLNK+D +       DI   +T G+V G+
Sbjct:   72 KASPQPILPDEAEQF--SLLMRTPDQPENPRCLRVAVIGAPNAGKSTLTNQLLGRKLFAVSKKVHTTRSRALGVLTEDDTQIILLDTPGLTTPSKVKRHHLEKSLLVDPLESLYEADLVVVLVDVSDKWTRTRLDFEVLKCLALNPQIPAVLVLNKVDLLKNKPLLLDITAGLTEGVVNGQ 250          

HSP 2 Score: 79.337 bits (194), Expect = 2.190e-15
Identity = 34/106 (32.08%), Postives = 61/106 (57.55%), Query Frame = 3
Query: 1158 NHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHL 1475
            N   +  W +F+DVF + + D   ++ L+ YL+  AKPG W++HS +++DQ P+ +    +  K L+ L  E+PY I   +  + +++DG L I V +  K + H+
Sbjct:  303 NLKNRKGWPHFKDVFMLCAADEEDVDTLKTYLMTCAKPGPWHYHSDVLTDQSPQDVCVNAIREKLLEYLPLEVPYNISQHIELWRETEDGKLDISVKLHVKKNSHM 408          
BLAST of GTPase Era vs. Ensembl Cavefish
Match: eral1 (Era like 12S mitochondrial rRNA chaperone 1 [Source:NCBI gene;Acc:103029521])

HSP 1 Score: 117.857 bits (294), Expect = 3.101e-28
Identity = 71/181 (39.23%), Postives = 107/181 (59.12%), Query Frame = 3
Query:   93 KTELQPRFPHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            K   QP  P    +    L M  P+ P++ + L++AV+G PN+GKS+L N L    + AVS KV+TTR++   VLT+D+ Q+  +D PG+   +K     LEKSL+ DP   ++E+DL++ L+D S K ++  LD E+LK L      PA+LVLNK+D +       DI   +T G+V G+
Sbjct:   72 KASPQPILPDEAEQF--SLLMRTPDQPENPRCLRVAVIGAPNAGKSTLTNQLLGRKLFAVSKKVHTTRSRALGVLTEDDTQIILLDTPGLTTPSKVKRHHLEKSLLVDPLESLYEADLVVVLVDVSDKWTRTRLDFEVLKCLALNPQIPAVLVLNKVDLLKNKPLLLDITAGLTEGVVNGQ 250          

HSP 2 Score: 66.6254 bits (161), Expect = 2.593e-11
Identity = 27/77 (35.06%), Postives = 46/77 (59.74%), Query Frame = 3
Query: 1158 NHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQI 1388
            N   +  W +F+DVF + + D   ++ L+ YL+  AKPG W++HS +++DQ P+ +    +  K L+ L  E+PY I
Sbjct:  303 NLKNRKGWPHFKDVFMLCAADEEDVDTLKTYLMTCAKPGPWHYHSDVLTDQSPQDVCVNAIREKLLEYLPLEVPYNI 379          
BLAST of GTPase Era vs. Ensembl Cavefish
Match: eral1 (Era like 12S mitochondrial rRNA chaperone 1 [Source:NCBI gene;Acc:103029521])

HSP 1 Score: 118.242 bits (295), Expect = 3.264e-28
Identity = 71/181 (39.23%), Postives = 107/181 (59.12%), Query Frame = 3
Query:   93 KTELQPRFPHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            K   QP  P    +    L M  P+ P++ + L++AV+G PN+GKS+L N L    + AVS KV+TTR++   VLT+D+ Q+  +D PG+   +K     LEKSL+ DP   ++E+DL++ L+D S K ++  LD E+LK L      PA+LVLNK+D +       DI   +T G+V G+
Sbjct:   72 KASPQPILPDEAEQF--SLLMRTPDQPENPRCLRVAVIGAPNAGKSTLTNQLLGRKLFAVSKKVHTTRSRALGVLTEDDTQIILLDTPGLTTPSKVKRHHLEKSLLVDPLESLYEADLVVVLVDVSDKWTRTRLDFEVLKCLALNPQIPAVLVLNKVDLLKNKPLLLDITAGLTEGVVNGQ 250          

HSP 2 Score: 93.2041 bits (230), Expect = 7.174e-20
Identity = 43/142 (30.28%), Postives = 78/142 (54.93%), Query Frame = 3
Query: 1158 NHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTG 1583
            N   +  W +F+DVF + + D   ++ L+ YL+  AKPG W++HS +++DQ P+ +    +  K L+ L  E+PY I   +  + +++DG L I V +  K + H+  ++G  G  ++ I  E+ + L   F   V LK++ 
Sbjct:  303 NLKNRKGWPHFKDVFMLCAADEEDVDTLKTYLMTCAKPGPWHYHSDVLTDQSPQDVCVNAIREKLLEYLPLEVPYNISQHIELWRETEDGKLDISVKLHVKKNSHMSMVIGPGGEMMAKIVQEAGQDLTSAFMQEVRLKISA 444          
BLAST of GTPase Era vs. Ensembl Sea Lamprey
Match: eral1 (Era-like 12S mitochondrial rRNA chaperone 1 [Source:NCBI gene;Acc:569087])

HSP 1 Score: 101.293 bits (251), Expect = 1.180e-23
Identity = 55/147 (37.41%), Postives = 84/147 (57.14%), Query Frame = 3
Query: 1140 EIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLT 1580
            E+     H R    ++F DVF VS+L+G  +E LR YL++RA+   W FHSS+++DQ P  L    V A+ L+VL +E+PY IK  V ++E+   G LHI   +    + H+  LLG  GS ++A++  ++  L   F   V L L+
Sbjct:  194 EVTRPRRHGRAPR-SFFHDVFMVSALNGDEVETLRGYLLSRARASPWRFHSSVLTDQTPMQLSLDAVRARLLEVLPQEVPYLIKQSVLHWEEGPSGELHIIQQLTVTKNSHMRMLLGRGGSCVAAVSRLAQWDLSSVFLRDVRLNLS 339          

HSP 2 Score: 95.1301 bits (235), Expect = 1.415e-21
Identity = 46/141 (32.62%), Postives = 81/141 (57.45%), Query Frame = 3
Query:  150 FMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHK--TSQEELDVELLKALHFFKDKPAILVLNKID 566
              L P+ P   ++L++A++G PN+GKS+L N +    +  VS KV+TTR     VLT+D+ Q+  +D PG+   ++     L  S  +DP   + ++D+++  +D S     ++ +LD + L  L    + P++LVLNK+D
Sbjct:    1 LALTPDQPSCPRLLRVAIIGAPNAGKSTLANQILGRKVFGVSRKVHTTRCTSAGVLTEDDAQIVLLDTPGLTSPSRSKRHGLAPSFTKDPQASLEQADVVLVCVDVSDPWLKTRCQLDAQTLNCLRKNPELPSLLVLNKVD 141          
BLAST of GTPase Era vs. Ensembl Yeast
Match: MSS1 (Mitochondrial protein; forms a heterodimer complex with Mto1p that performs the 5-carboxymethylaminomethyl modification of the wobble uridine base in mitochondrial tRNAs; similar to human GTPBP3 [Source:SGD;Acc:S000004625])

HSP 1 Score: 49.6766 bits (117), Expect = 9.982e-7
Identity = 41/128 (32.03%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  189 LKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKV 572
            +K+ +LG PN GKSSLVN LT  DI  VS    TTR    A++  +  ++   D  G+  K+     K+E   I        +SDL + ++D +  +     D+    +   F +K  I+V+NK D V
Sbjct:  275 IKLVLLGAPNVGKSSLVNSLTNDDISIVSDIPGTTRDSIDAMINVNGYKVIICDTAGIREKSSD---KIEMLGIDRAKKKSVQSDLCLFIVDPTDLSKLLPEDILAHLSSKTFGNKRIIIVVNKSDLV 399          
BLAST of GTPase Era vs. Ensembl Nematostella
Match: EDO40072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8A8])

HSP 1 Score: 96.6709 bits (239), Expect = 9.736e-22
Identity = 49/132 (37.12%), Postives = 85/132 (64.39%), Query Frame = 3
Query:  177 DSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKV 572
            D+K+LK+A++G PNSGKS+L+N L    I AV+ K +TTR     V T    Q+  +D PG++ +++G   K+ +  I+ P   + ++D+I  + DAS+K +++ +  ++L+AL    + P+ L+LNKIDK+
Sbjct:   77 DTKLLKVAIIGEPNSGKSTLINQLVGEKIVAVTEKPHTTRQVSRGVFTSGGTQIILLDTPGLVTQSEGKRLKMTREHIKAPGDALDDADIIGVICDASNKRTRDRIHQQVLQALEQHVNIPSFLILNKIDKL 208          

HSP 2 Score: 65.855 bits (159), Expect = 1.516e-11
Identity = 33/101 (32.67%), Postives = 53/101 (52.48%), Query Frame = 3
Query: 1158 NHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCK 1460
             +T    W+ F++VF VS+  G G+++LR YL+ RA P  W +    ++D   E+ V      K L++ E EIP+Q+K      E  +   L IH  + C+
Sbjct:  231 GYTETGGWSEFDNVFMVSARLGNGVQDLREYLVLRATPSDWLYPPDCVTDMGLESRVTEVFREKMLELYEHEIPWQVKQVPVLCELREGNKLRIHQKLYCR 331          
BLAST of GTPase Era vs. Ensembl Medaka
Match: eral1 (Era like 12S mitochondrial rRNA chaperone 1 [Source:NCBI gene;Acc:101167892])

HSP 1 Score: 132.109 bits (331), Expect = 5.731e-33
Identity = 70/163 (42.94%), Postives = 100/163 (61.35%), Query Frame = 3
Query:  147 LFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGK 635
            L M  P+ P D KVLK+AV+G PN+GKS+L N L    + AVS KV+TTR +   VLT+D+ Q+  +D PG+   +K    +LEK+L+ DP   + E+DL++ ++DA  +     LD+E+LK L      PAILVLNK+D V       DI   +T G+V G+
Sbjct:   92 LLMRHPDQPHDPKVLKVAVIGAPNAGKSTLSNQLLGRKVFAVSKKVHTTRARALGVLTEDDTQIILLDTPGLTTPSKAKRHQLEKTLLVDPWDTVKEADLMVVMVDAGDRWMCSRLDLEVLKCLAQHPQIPAILVLNKVDLVKAKDRLLDITAHLTCGVVNGR 254          

HSP 2 Score: 103.605 bits (257), Expect = 2.701e-23
Identity = 48/138 (34.78%), Postives = 77/138 (55.80%), Query Frame = 3
Query: 1170 QTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTG 1583
            Q  W  F+DVF +SS+DG  +E L+ Y +  AKPG W +HS +++DQ PE +    +  K L+ L +E+PY +   +  +++  DG + I V +  K   H+  ++G  G  ++ IA E+   L + F   V LKLT 
Sbjct:  300 QQGWPRFKDVFMLSSVDGEDVETLKKYFMAAAKPGAWQYHSEVLTDQSPEEVCTNLIREKLLEYLPQEVPYSLTQTIELWQEGTDGEVDISVKLYTKKETHMKMVIGAAGQMVAQIAREAGEDLSRVFLREVRLKLTA 437          
BLAST of GTPase Era vs. Ensembl Medaka
Match: gtpbp10 (GTP binding protein 10 [Source:NCBI gene;Acc:101172104])

HSP 1 Score: 52.7582 bits (125), Expect = 5.787e-7
Identity = 44/134 (32.84%), Postives = 66/134 (49.25%), Query Frame = 3
Query:  195 IAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGK---NKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKT---SQEELDVELLKALHFFKD----KPAILVLNKID 566
            + ++G PN+GKSSL+  L+       S    T R +   V+  D  Q+   D+PG+I     NKG   K  K + R   + +F  D  +C    + KT   S  E    L+K L  +K+    KPA+LV+NK+D
Sbjct:  219 LGLVGFPNAGKSSLLAALSNATPQIASYAFTTLRPEIGKVMYPDYKQISIADLPGLIEGAYMNKGMGHKFLKHVERTKQL-LFVVD--VCGFQLASKTPFRSAFEAVQLLIKELELYKEEVASKPALLVVNKMD 349          
BLAST of GTPase Era vs. Planmine SMEST
Match: SMESG000064253.1 (SMESG000064253.1)

HSP 1 Score: 1128.62 bits (2918), Expect = 0.000e+0
Identity = 546/550 (99.27%), Postives = 547/550 (99.45%), Query Frame = 3
Query:   21 MYKCKILQNFILPQYHRKLFLSNIKTELQPRFPHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGKCSHKDSYANRFKRDIPSYQELLADSKAEKLLNKHLQRRVISGSESVAVENISPELETDINVDLSTKTESGSTENLSNDYFTSYKNDTDNTSTNIDESENHLSPSEISNQINEMDDDKFKNFLKQSDQNNNNTMLSEDIDEPILGVLKRQLMLYSATKDEILERRAKWHEIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTGARIGIPSEHFKRMKSVTNVKKLFPKTATA 1670
            MYKCKILQNFILPQYHRKLFLSNIKTELQPRFPHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGKCSHKDSYANRFK+DIPSYQELLADSKAEKLLNKHLQRRVISGSESVAVENISPELETDINVDLSTKTESGSTENLSNDYFTSYKNDTDN STNIDESENHLSPSEISNQINEMDDDK KNFLKQSDQNNNNTMLSEDIDEPILGVLKRQLMLYSATKDEILERRAKW EIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTGARIGIPSEHFKRMKSVTNVKKLFPKTATA
Sbjct:    1 MYKCKILQNFILPQYHRKLFLSNIKTELQPRFPHLKSELYQKLFMLQPNSPKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLTQDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDASHKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNGIVGGKCSHKDSYANRFKKDIPSYQELLADSKAEKLLNKHLQRRVISGSESVAVENISPELETDINVDLSTKTESGSTENLSNDYFTSYKNDTDNNSTNIDESENHLSPSEISNQINEMDDDKLKNFLKQSDQNNNNTMLSEDIDEPILGVLKRQLMLYSATKDEILERRAKWREIAANLNHTRQTSWTYFEDVFSVSSLDGTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEKEIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIADESKRILEKCFQTVVYLKLTGARIGIPSEHFKRMKSVTNVKKLFPKTATA 550          
The following BLAST results are available for this feature:
BLAST of GTPase Era vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ERAL13.056e-2235.58Era like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
ERAL12.100e-2034.59Era like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
ERAL14.470e-1937.68Era like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
ERAL14.466e-838.46Era like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
back to top
BLAST of GTPase Era vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eral-13.887e-1532.03Uncharacterized GTP-binding protein E02H1.2 [Sour... [more]
back to top
BLAST of GTPase Era vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG74881.547e-2033.11gene:FBgn0038106 transcript:FBtr0082695[more]
CG133906.328e-930.26gene:FBgn0032031 transcript:FBtr0079723[more]
back to top
BLAST of GTPase Era vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eral17.289e-2841.10Era-like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
back to top
BLAST of GTPase Era vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ERAL16.993e-3037.95Era-like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
back to top
BLAST of GTPase Era vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Eral16.965e-2334.03Era (G-protein)-like 1 (E. coli) [Source:MGI Symbo... [more]
back to top
BLAST of GTPase Era vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B5X2B8|ERAL1_SALSA2.528e-3040.49GTPase Era, mitochondrial OS=Salmo salar OX=8030 G... [more]
sp|Q8JIF5|ERAL1_CHICK3.671e-2937.50GTPase Era, mitochondrial OS=Gallus gallus OX=9031... [more]
sp|B0S6U7|ERAL1_DANRE5.502e-2741.10GTPase Era, mitochondrial OS=Danio rerio OX=7955 G... [more]
sp|Q9CZU4|ERAL1_MOUSE4.872e-2234.03GTPase Era, mitochondrial OS=Mus musculus OX=10090... [more]
sp|O75616|ERAL1_HUMAN1.468e-2135.58GTPase Era, mitochondrial OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of GTPase Era vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R0Z82.988e-12138.92GTP binding protein era OS=Fasciola hepatica OX=61... [more]
A0A504YUQ11.855e-12038.39GTP binding protein era OS=Fasciola gigantica OX=4... [more]
A0A1S8X8D27.322e-11738.30G domain-containing protein OS=Opisthorchis viverr... [more]
A0A419Q6J01.355e-11638.50GTPase Era OS=Clonorchis sinensis OX=79923 GN=eral... [more]
A0A5K4F5N48.950e-11540.77Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of GTPase Era vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
eral11.624e-2839.23Era like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
eral13.101e-2839.23Era like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
eral13.264e-2839.23Era like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
back to top
BLAST of GTPase Era vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eral11.180e-2337.41Era-like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
back to top
BLAST of GTPase Era vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MSS19.982e-732.03Mitochondrial protein; forms a heterodimer complex... [more]
back to top
BLAST of GTPase Era vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO400729.736e-2237.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GTPase Era vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eral15.731e-3342.94Era like 12S mitochondrial rRNA chaperone 1 [Sourc... [more]
gtpbp105.787e-732.84GTP binding protein 10 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of GTPase Era vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064253.10.000e+099.27SMESG000064253.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023168 ID=SMED30023168|Name=GTPase Era|organism=Schmidtea mediterranea sexual|type=transcript|length=1715bp
TTTAACTGAGCAATTTAAAAATGTATAAATGCAAAATTTTACAAAATTTT
ATTTTACCACAATACCATCGAAAATTATTTTTATCTAACATAAAAACTGA
ATTGCAGCCAAGATTTCCGCATTTAAAATCTGAATTGTATCAAAAGCTAT
TTATGCTACAGCCAAACTCACCTAAAGATTCTAAAGTTCTTAAAATAGCG
GTTTTAGGCTGTCCAAATTCAGGAAAATCAAGTCTTGTTAATATGCTAAC
TAGATGGGATATATGTGCAGTATCTGGCAAAGTGAACACGACGCGCACTA
AGCAAACTGCGGTTTTAACACAAGATAACGTTCAATTGTGTTTTGTTGAC
ATGCCAGGAGTTATAGGGAAAAATAAAGGATTTAATTTTAAATTGGAAAA
GAGCTTGATACGAGACCCACATGTCGGTATATTTGAATCGGATCTAATAA
TTTGTCTATTGGATGCAAGTCATAAAACATCTCAAGAAGAATTAGATGTA
GAATTGCTAAAGGCGCTACACTTTTTCAAAGATAAACCAGCTATTCTAGT
TTTAAACAAGATTGACAAAGTTGGAAAACTAATGACACAGTTTGATATAG
TTAGGAAAATCACAAACGGAATTGTAGGTGGGAAGTGTTCTCATAAAGAT
AGTTATGCCAACAGATTCAAAAGGGATATACCCAGTTATCAAGAACTCCT
TGCCGATTCAAAGGCAGAAAAATTATTAAATAAACATCTACAAAGGAGAG
TAATTTCAGGAAGTGAAAGTGTAGCTGTTGAAAATATTTCACCGGAACTA
GAAACGGATATCAACGTTGATTTATCAACAAAAACCGAGTCTGGCAGTAC
TGAAAATTTAAGCAATGATTATTTTACATCTTACAAGAATGATACAGATA
ACACTAGTACCAATATCGATGAATCTGAAAATCATCTTTCGCCCTCAGAA
ATCTCCAATCAAATCAACGAAATGGATGATGACAAATTTAAAAATTTTTT
AAAGCAATCCGATCAAAATAATAATAATACAATGCTCAGTGAGGATATAG
ATGAGCCTATACTTGGAGTTTTAAAACGGCAACTGATGCTGTATTCAGCC
ACCAAAGATGAAATTCTCGAACGTAGAGCTAAGTGGCATGAAATTGCTGC
CAATCTAAATCATACGCGTCAAACTAGTTGGACTTATTTCGAGGACGTAT
TTTCAGTCTCTAGTCTAGACGGAACCGGCATTGAAGAACTAAGAAATTAT
CTCATCAATCGAGCTAAACCCGGGCTTTGGTACTTTCATAGCAGTCTCAT
TTCCGATCAAGAACCAGAAACATTAGTAAAGATGTGTGTAATGGCAAAAT
GCCTTGATGTACTGGAAAAGGAAATTCCTTATCAGATAAAAATCGATGTG
CACAATTATGAAAAAAGCGACGACGGTTCCCTTCATATCCATGTGTTGAT
TAGGTGCAAAAGTAGTCGACATCTGATGTCTCTGTTAGGGACAAAGGGCT
CGAATATTTCAGCTATAGCTGATGAAAGTAAAAGAATTCTGGAGAAATGT
TTTCAAACGGTTGTGTATCTCAAATTGACAGGTGCCCGTATTGGCATTCC
CAGTGAACATTTTAAGCGAATGAAATCTGTAACCAATGTCAAAAAATTAT
TTCCCAAAACGGCTACGGCGTGATCAATATTGTTTTTGTGAATTTGATAA
TAAATTTCTTTTGTA
back to top

protein sequence of SMED30023168-orf-1

>SMED30023168-orf-1 ID=SMED30023168-orf-1|Name=SMED30023168-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=551bp
MYKCKILQNFILPQYHRKLFLSNIKTELQPRFPHLKSELYQKLFMLQPNS
PKDSKVLKIAVLGCPNSGKSSLVNMLTRWDICAVSGKVNTTRTKQTAVLT
QDNVQLCFVDMPGVIGKNKGFNFKLEKSLIRDPHVGIFESDLIICLLDAS
HKTSQEELDVELLKALHFFKDKPAILVLNKIDKVGKLMTQFDIVRKITNG
IVGGKCSHKDSYANRFKRDIPSYQELLADSKAEKLLNKHLQRRVISGSES
VAVENISPELETDINVDLSTKTESGSTENLSNDYFTSYKNDTDNTSTNID
ESENHLSPSEISNQINEMDDDKFKNFLKQSDQNNNNTMLSEDIDEPILGV
LKRQLMLYSATKDEILERRAKWHEIAANLNHTRQTSWTYFEDVFSVSSLD
GTGIEELRNYLINRAKPGLWYFHSSLISDQEPETLVKMCVMAKCLDVLEK
EIPYQIKIDVHNYEKSDDGSLHIHVLIRCKSSRHLMSLLGTKGSNISAIA
DESKRILEKCFQTVVYLKLTGARIGIPSEHFKRMKSVTNVKKLFPKTATA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR015946KH_dom-like_a/b
IPR006073GTP_binding_domain
IPR027417P-loop_NTPase
IPR009019KH_sf_prok-type
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015946K homology domain-like, alpha/betaGENE3DG3DSA:3.30.300.20coord: 428..522
e-value: 2.8E-13
score: 51.3
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 56..190
e-value: 9.6E-15
score: 52.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 52..218
e-value: 1.4E-28
score: 101.7
NoneNo IPR availablePANTHERPTHR42698:SF1GTPASE ERA, MITOCHONDRIALcoord: 35..520
NoneNo IPR availablePANTHERPTHR42698FAMILY NOT NAMEDcoord: 35..520
IPR006073GTP binding domainPFAMPF01926MMR_HSR1coord: 58..180
e-value: 4.9E-18
score: 65.3
IPR009019K homology domain superfamily, prokaryotic typeSUPERFAMILYSSF54814Prokaryotic type KH domain (KH-domain type II)coord: 426..519
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 50..416