60S acidic ribosomal protein P2

Overview
Name60S acidic ribosomal protein P2
Smed IDSMED30023159
Length (bp)450
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S acidic ribosomal protein P2 (SMED30023159) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S acidic ribosomal protein P2 (SMED30023159) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S acidic ribosomal protein P2 (SMED30023159) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S acidic ribosomal protein P2 (SMED30023159) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023159

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023159SMESG000009232.1 SmedASXL_004089SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023159SMESG000009232.1 SmedASXL_004089SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023159SMESG000009232.1 Contig35324uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023159SMESG000009232.1 Contig35324newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30023159SMESG000009232.1 dd_Smed_v4_96_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023159SMESG000009232.1 dd_Smed_v6_96_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Human
Match: RPLP2 (ribosomal protein lateral stalk subunit P2 [Source:HGNC Symbol;Acc:HGNC:10377])

HSP 1 Score: 63.5438 bits (153), Expect = 3.137e-13
Identity = 26/62 (41.94%), Postives = 46/62 (74.19%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN+ P A+DI  IL +VGIE D ++  + +  ++ +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Human
Match: RPLP2 (ribosomal protein lateral stalk subunit P2 [Source:HGNC Symbol;Acc:HGNC:10377])

HSP 1 Score: 63.5438 bits (153), Expect = 3.137e-13
Identity = 26/62 (41.94%), Postives = 46/62 (74.19%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN+ P A+DI  IL +VGIE D ++  + +  ++ +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Celegans
Match: rla-2 (Ribosomal protein, Large subunit, Acidic (P1) [Source:UniProtKB/TrEMBL;Acc:Q9U1X9])

HSP 1 Score: 60.8474 bits (146), Expect = 1.066e-12
Identity = 27/58 (46.55%), Postives = 42/58 (72.41%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQG 243
            MRY+S+Y+L+VLGGNA P+ +D+  IL+AVG++ D   AK  V  +  + V +LI++G
Sbjct:    1 MRYVSAYLLAVLGGNANPKVDDLKNILSAVGVDADAETAKLVVSRLAGKTVEELIAEG 58          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Celegans
Match: rla-2 (Ribosomal protein, Large subunit, Acidic (P1) [Source:UniProtKB/TrEMBL;Acc:Q9U1X9])

HSP 1 Score: 60.8474 bits (146), Expect = 1.066e-12
Identity = 27/58 (46.55%), Postives = 42/58 (72.41%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQG 243
            MRY+S+Y+L+VLGGNA P+ +D+  IL+AVG++ D   AK  V  +  + V +LI++G
Sbjct:    1 MRYVSAYLLAVLGGNANPKVDDLKNILSAVGVDADAETAKLVVSRLAGKTVEELIAEG 58          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Celegans
Match: C37A2.7 (60S acidic ribosomal protein P2 [Source:UniProtKB/Swiss-Prot;Acc:O01504])

HSP 1 Score: 60.4622 bits (145), Expect = 1.325e-12
Identity = 25/62 (40.32%), Postives = 43/62 (69.35%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            M+YL +Y+L+ LGGNA P A+D+  +L A G++CD+  A   V A+  + ++++I+QG  K+
Sbjct:    1 MKYLGAYLLATLGGNASPSAQDVLKVLEAGGLDCDMENANSVVDALKGKTISEVIAQGKVKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Fly
Match: RpLP2 (gene:FBgn0003274 transcript:FBtr0087105)

HSP 1 Score: 55.0694 bits (131), Expect = 2.596e-10
Identity = 22/62 (35.48%), Postives = 42/62 (67.74%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+VLGG   P   D+  IL++VG+E D  +  + ++ +  + ++DLI +G +K+
Sbjct:    1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Zebrafish
Match: rplp2 (ribosomal protein, large P2 [Source:ZFIN;Acc:ZDB-GENE-031018-2])

HSP 1 Score: 64.6994 bits (156), Expect = 8.139e-14
Identity = 27/62 (43.55%), Postives = 45/62 (72.58%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+VLGGN  P A+DI  IL +VGIE D  +  + V  ++ +D+N++++ GL K+
Sbjct:    1 MRYVAAYLLAVLGGNTNPSAKDIKNILGSVGIEADDERLNKVVSELNGKDINEVMNAGLSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Zebrafish
Match: rplp2l (ribosomal protein, large P2, like [Source:ZFIN;Acc:ZDB-GENE-070327-2])

HSP 1 Score: 53.9138 bits (128), Expect = 8.195e-10
Identity = 24/62 (38.71%), Postives = 40/62 (64.52%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+ LGG   P   DI  IL +VGIE D  +  + V  ++ ++V ++I+QG  K+
Sbjct:    1 MRYVAAYLLAALGGKDSPSTGDIKKILESVGIEADDVRMSKVVAELNGKNVEEVIAQGFSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Zebrafish
Match: rplp2l (ribosomal protein, large P2, like [Source:ZFIN;Acc:ZDB-GENE-070327-2])

HSP 1 Score: 53.9138 bits (128), Expect = 8.195e-10
Identity = 24/62 (38.71%), Postives = 40/62 (64.52%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+ LGG   P   DI  IL +VGIE D  +  + V  ++ ++V ++I+QG  K+
Sbjct:    1 MRYVAAYLLAALGGKDSPSTGDIKKILESVGIEADDVRMSKVVAELNGKNVEEVIAQGFSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Xenopus
Match: RPLP2 (uncharacterized loc100135138 [Source:NCBI gene;Acc:100135138])

HSP 1 Score: 61.2326 bits (147), Expect = 2.163e-12
Identity = 25/62 (40.32%), Postives = 43/62 (69.35%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+VLGG   P A DI +IL +VGI+ D  + K+ +  +  +D+ D+++ GL K+
Sbjct:    1 MRYVAAYLLAVLGGKTSPSANDIKSILKSVGIDADDERVKKVISELSGKDLEDVVNSGLAKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Xenopus
Match: rplp2 (ribosomal protein lateral stalk subunit P2 [Source:NCBI gene;Acc:549399])

HSP 1 Score: 58.151 bits (139), Expect = 3.639e-11
Identity = 24/62 (38.71%), Postives = 45/62 (72.58%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+VLGG   P   D++ IL++VGIE D  +A++ V+ +  + ++++I+QG  K+
Sbjct:    1 MRYVAAYLLAVLGGTESPSIADLTKILSSVGIETDQQRAEKVVKELKGKSIDEVIAQGNTKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Match: AC124742.1 (ribosomal protein, large P2 (Rplp2), retrogene)

HSP 1 Score: 63.5438 bits (153), Expect = 2.154e-13
Identity = 26/62 (41.94%), Postives = 46/62 (74.19%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN+ P A+DI  IL +VGIE D ++  + +  ++ +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILGSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Match: Rplp2 (ribosomal protein, large P2 [Source:MGI Symbol;Acc:MGI:1914436])

HSP 1 Score: 63.1586 bits (152), Expect = 2.555e-13
Identity = 26/62 (41.94%), Postives = 46/62 (74.19%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN+ P A+DI  IL +VGIE D ++  + +  ++ +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Match: Rplp2 (ribosomal protein, large P2 [Source:MGI Symbol;Acc:MGI:1914436])

HSP 1 Score: 63.1586 bits (152), Expect = 2.555e-13
Identity = 26/62 (41.94%), Postives = 46/62 (74.19%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN+ P A+DI  IL +VGIE D ++  + +  ++ +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Match: Rplp2 (ribosomal protein, large P2 [Source:MGI Symbol;Acc:MGI:1914436])

HSP 1 Score: 63.1586 bits (152), Expect = 2.555e-13
Identity = 26/62 (41.94%), Postives = 46/62 (74.19%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN+ P A+DI  IL +VGIE D ++  + +  ++ +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|P05387|RLA2_HUMAN (60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.506e-12
Identity = 26/62 (41.94%), Postives = 46/62 (74.19%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN+ P A+DI  IL +VGIE D ++  + +  ++ +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|P99027|RLA2_MOUSE (60S acidic ribosomal protein P2 OS=Mus musculus OX=10090 GN=Rplp2 PE=1 SV=3)

HSP 1 Score: 63.1586 bits (152), Expect = 1.787e-12
Identity = 26/62 (41.94%), Postives = 46/62 (74.19%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN+ P A+DI  IL +VGIE D ++  + +  ++ +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|P42899|RLA2_BOVIN (60S acidic ribosomal protein P2 OS=Bos taurus OX=9913 GN=RPLP2 PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.680e-12
Identity = 26/62 (41.94%), Postives = 45/62 (72.58%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN+ P A+DI  IL +VGIE D ++  + +  +  +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELHGKNIEDVIAQGIGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|Q6X9Z5|RLA2_HORSE (60S acidic ribosomal protein P2 OS=Equus caballus OX=9796 GN=RPLP2 PE=3 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.797e-12
Identity = 26/62 (41.94%), Postives = 45/62 (72.58%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY++SY+L+ LGGN  P A+DI  IL +VGIE D ++  + +  ++ +++ D+I+QG+ K+
Sbjct:    1 MRYVASYLLAALGGNTSPSAKDIKKILDSVGIEADDDRLDKVISELNGKNIEDVIAQGIGKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Match: sp|P50879|RLA2_TAESO (60S acidic ribosomal protein P2 OS=Taenia solium OX=6204 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.044e-12
Identity = 27/62 (43.55%), Postives = 43/62 (69.35%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRYL++Y+L+ LGG   P+  DI  IL++VG+EC+  +AK  V  +  ++V DLI+ G +K+
Sbjct:    1 MRYLAAYLLAQLGGTGRPQESDIKNILSSVGVECEQERAKLGVDQLHGKNVRDLINTGKEKM 62          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A0A183I9B7 (Uncharacterized protein OS=Soboliphyme baturini OX=241478 GN=SBAD_LOCUS211 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 9.669e-14
Identity = 31/58 (53.45%), Postives = 45/58 (77.59%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQG 243
            MRY+++Y+L+VLGG  EP+ +DI  IL AVG++CD +KAK+ +++    DVNDLI QG
Sbjct:   16 MRYVAAYLLAVLGGKKEPQLDDIQKILAAVGVDCDDSKAKKVIESCKGHDVNDLIEQG 73          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A0A328HPX8 (Uncharacterized protein (Fragment) OS=Enterobacter hormaechei OX=158836 GN=DOZ52_29225 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.275e-13
Identity = 30/65 (46.15%), Postives = 49/65 (75.38%), Query Frame = 1
Query:   61 DLKMRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            DLKMRY+++Y+L+VLGGNA P A+DI  IL +VGIE D  +  + +  ++ +D+N++++ GL K+
Sbjct:   11 DLKMRYVAAYLLAVLGGNANPSAKDIKNILGSVGIEADDERLNKVISELNGKDINEVMNAGLSKL 75          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A0A132AE91 (60S acidic ribosomal protein P2-like protein OS=Sarcoptes scabiei OX=52283 GN=QR98_0077800 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.151e-12
Identity = 31/62 (50.00%), Postives = 46/62 (74.19%), Query Frame = 1
Query:   61 DLKMRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGL 246
            DLKMRY+++Y+L+VLGGN  P  +DI+ IL++VGIE D +K  + +  +  + + DLISQGL
Sbjct:   44 DLKMRYVAAYLLAVLGGNKSPSKDDINKILSSVGIESDEDKMSKVINELKGKSIEDLISQGL 105          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A0A4W4DYU7 (Ribosomal protein, large P2 OS=Electrophorus electricus OX=8005 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.920e-12
Identity = 30/65 (46.15%), Postives = 48/65 (73.85%), Query Frame = 1
Query:   61 DLKMRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            DLKMRY+++Y+LSVLGGN  P A+DI  IL +VGIE D  +  + +  ++ +D+N++++ GL K+
Sbjct:   58 DLKMRYVAAYLLSVLGGNTSPSAKDIKNILGSVGIEADDQRLNKVISELNGKDINEVMNAGLSKL 122          
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Match: A0A2D4BM79 (Ribosomal protein putative OS=Pythium insidiosum OX=114742 GN=PINS_002368 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.393e-12
Identity = 26/64 (40.62%), Postives = 48/64 (75.00%), Query Frame = 1
Query:   64 LKMRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            + MRY+++Y+L++LGGNA P A D++ IL++VG+E D  +  + +  ++ +DVN++I+ G KK+
Sbjct:    1 MPMRYIAAYLLAILGGNAAPSAADVTAILSSVGVEVDAERLNQVISELEGKDVNEIIAAGSKKL 64          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Cavefish
Match: rplp2 (60S acidic ribosomal protein P2-like [Source:NCBI gene;Acc:103029731])

HSP 1 Score: 62.3882 bits (150), Expect = 5.360e-13
Identity = 26/62 (41.94%), Postives = 44/62 (70.97%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+VLGGN  P A+DI  IL +VGIE    +  + V  ++ +D+N++++ GL K+
Sbjct:    1 MRYVAAYLLAVLGGNTSPSAKDIKNILGSVGIEASDERLNKVVSELNGKDINEVMNAGLSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Cavefish
Match: rplp2l (ribosomal protein, large P2, like [Source:ZFIN;Acc:ZDB-GENE-070327-2])

HSP 1 Score: 49.2914 bits (116), Expect = 4.554e-8
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQ 240
            MRY+++Y+L+ L G   P + DI  IL +VGIE D  +  + V  ++ + V D+I+Q
Sbjct:    1 MRYVAAYLLAALSGKDNPSSNDIKKILESVGIEVDETRMGKVVSELNGKKVEDVIAQ 57          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Sea Lamprey
Match: rplp2 (ribosomal protein, large P2 [Source:ZFIN;Acc:ZDB-GENE-031018-2])

HSP 1 Score: 60.4622 bits (145), Expect = 6.113e-13
Identity = 27/63 (42.86%), Postives = 43/63 (68.25%), Query Frame = 1
Query:   67 KMRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            +MRY+++Y+L+ LGGN +P A DI  IL +VGIE D +K  + +  +  ++V ++IS G  KI
Sbjct:    2 RMRYVAAYLLATLGGNEQPTAIDIKKILGSVGIEADDSKLSKVISELKGKNVEEVISAGFTKI 64          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Yeast
Match: RPP2B (Ribosomal protein P2 beta; a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; free (non-ribosomal) P2 stimulates the phosphorylation of the eIF2 alpha subunit (Sui2p) by Gcn2p; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm [Source:SGD;Acc:S000002790])

HSP 1 Score: 48.521 bits (114), Expect = 1.191e-8
Identity = 23/63 (36.51%), Postives = 41/63 (65.08%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCR-DVNDLISQGLKKI 255
            M+YL++Y+L V GGNA P A DI  ++ +VG E D  +  E + +++ +  + ++I++G KK 
Sbjct:    1 MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKGSLEEIIAEGQKKF 63          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Nematostella
Match: EDO47503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLY2])

HSP 1 Score: 53.9138 bits (128), Expect = 2.847e-10
Identity = 23/62 (37.10%), Postives = 40/62 (64.52%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+ LG N  P A+DI  IL +VGIE D+ +  + +  +  + V+++I  G  K+
Sbjct:    1 MRYVAAYLLATLGNNKNPSAKDIKGILDSVGIESDMERLNKVISELSGKSVDEIIQAGKSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: rplp2 (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101170669])

HSP 1 Score: 60.077 bits (144), Expect = 2.974e-12
Identity = 24/62 (38.71%), Postives = 44/62 (70.97%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+ LGGN  P A+DI  IL +VGIE D  +  + +  ++ +++N++++ GL K+
Sbjct:    1 MRYVAAYLLAALGGNTSPSAKDIKDILGSVGIEADDERLNKVIGELNGKNINEVVNSGLSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: rplp2 (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101170669])

HSP 1 Score: 60.077 bits (144), Expect = 2.974e-12
Identity = 24/62 (38.71%), Postives = 44/62 (70.97%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+ LGGN  P A+DI  IL +VGIE D  +  + +  ++ +++N++++ GL K+
Sbjct:    1 MRYVAAYLLAALGGNTSPSAKDIKDILGSVGIEADDERLNKVIGELNGKNINEVVNSGLSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: lin7c (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101168608])

HSP 1 Score: 57.3806 bits (137), Expect = 5.072e-11
Identity = 26/70 (37.14%), Postives = 43/70 (61.43%), Query Frame = 1
Query:   46 LSTNFDLKMRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            L     + MRY+++Y+L+ LGGN  PEA DI  IL +VGIE D  +  + +  +  ++V ++I+ G  K+
Sbjct:   10 LCPKIKITMRYVAAYLLAALGGNGNPEAGDIKKILDSVGIEADSERLGKVLSELKGKNVEEVIAAGYSKL 79          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: lin7c (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101168608])

HSP 1 Score: 56.9954 bits (136), Expect = 5.238e-11
Identity = 25/62 (40.32%), Postives = 41/62 (66.13%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            MRY+++Y+L+ LGGN  PEA DI  IL +VGIE D  +  + +  +  ++V ++I+ G  K+
Sbjct:    1 MRYVAAYLLAALGGNGNPEAGDIKKILDSVGIEADSERLGKVLSELKGKNVEEVIAAGYSKL 62          
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Match: lin7c (60S acidic ribosomal protein P2 [Source:NCBI gene;Acc:101168608])

HSP 1 Score: 58.151 bits (139), Expect = 1.703e-10
Identity = 25/64 (39.06%), Postives = 43/64 (67.19%), Query Frame = 1
Query:   64 LKMRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKI 255
            ++MRY+++Y+L+ LGGN  PEA DI  IL +VGIE D  +  + +  +  ++V ++I+ G  K+
Sbjct:  171 VRMRYVAAYLLAALGGNGNPEAGDIKKILDSVGIEADSERLGKVLSELKGKNVEEVIAAGYSKL 234          
BLAST of 60S acidic ribosomal protein P2 vs. Planmine SMEST
Match: SMESG000009232.1 (SMESG000009232.1)

HSP 1 Score: 135.961 bits (341), Expect = 4.659e-42
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMGFGLFD 405
            MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKISSVPTGGAGAAPTAATSSAPAPAAKEEVKAAAKESSSESEEGDMGFGLFD
Sbjct:    1 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKISSVPTGGAGAAPTAATSSAPAPAAKEEVKAAAKESSSESEEGDMGFGLFD 112          
BLAST of 60S acidic ribosomal protein P2 vs. Planmine SMEST
Match: SMESG000057890.1 (SMESG000057890.1)

HSP 1 Score: 54.299 bits (129), Expect = 3.448e-10
Identity = 49/112 (43.75%), Postives = 71/112 (63.39%), Query Frame = 1
Query:   70 MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMGFGLFD 405
            MRY+++Y+L +L     P+  DI  IL++VG+ECD N   E   AI  + ++ LIS G+ K+++VP GGA  AP+AA  +A A    +  +A A++ SS   E DMGFGLFD
Sbjct:    1 MRYIAAYMLCLLN-EKTPKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLATVPAGGAAVAPSAAPLAAGAAQVTKVEEAKAEKESSSESEADMGFGLFD 111          
BLAST of 60S acidic ribosomal protein P2 vs. Planmine SMEST
Match: SMESG000057890.1 (SMESG000057890.1)

HSP 1 Score: 43.5134 bits (101), Expect = 3.935e-6
Identity = 43/95 (45.26%), Postives = 60/95 (63.16%), Query Frame = 1
Query:  121 PEAEDISTILTAVGIECDINKAKEAVQAIDCRDVNDLISQGLKKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMGFGLFD 405
            P+  DI  IL++VG+ECD N   E   AI  + ++ LIS G+ K+++VP GGA  AP+AA  +A A    +  +A A++ SS   E DMGFGLFD
Sbjct:   10 PKPSDIENILSSVGVECDKNAVTELFNAIKEKSIDSLISAGISKLATVPAGGAAVAPSAAPLAAGAAQVTKVEEAKAEKESSSESEADMGFGLFD 104          
The following BLAST results are available for this feature:
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RPLP23.137e-1341.94ribosomal protein lateral stalk subunit P2 [Source... [more]
RPLP23.137e-1341.94ribosomal protein lateral stalk subunit P2 [Source... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rla-21.066e-1246.55Ribosomal protein, Large subunit, Acidic (P1) [So... [more]
rla-21.066e-1246.55Ribosomal protein, Large subunit, Acidic (P1) [So... [more]
C37A2.71.325e-1240.3260S acidic ribosomal protein P2 [Source:UniProtKB... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RpLP22.596e-1035.48gene:FBgn0003274 transcript:FBtr0087105[more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rplp28.139e-1443.55ribosomal protein, large P2 [Source:ZFIN;Acc:ZDB-G... [more]
rplp2l8.195e-1038.71ribosomal protein, large P2, like [Source:ZFIN;Acc... [more]
rplp2l8.195e-1038.71ribosomal protein, large P2, like [Source:ZFIN;Acc... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RPLP22.163e-1240.32uncharacterized loc100135138 [Source:NCBI gene;Acc... [more]
rplp23.639e-1138.71ribosomal protein lateral stalk subunit P2 [Source... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AC124742.12.154e-1341.94ribosomal protein, large P2 (Rplp2), retrogene[more]
Rplp22.555e-1341.94ribosomal protein, large P2 [Source:MGI Symbol;Acc... [more]
Rplp22.555e-1341.94ribosomal protein, large P2 [Source:MGI Symbol;Acc... [more]
Rplp22.555e-1341.94ribosomal protein, large P2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P05387|RLA2_HUMAN1.506e-1241.9460S acidic ribosomal protein P2 OS=Homo sapiens OX... [more]
sp|P99027|RLA2_MOUSE1.787e-1241.9460S acidic ribosomal protein P2 OS=Mus musculus OX... [more]
sp|P42899|RLA2_BOVIN2.680e-1241.9460S acidic ribosomal protein P2 OS=Bos taurus OX=9... [more]
sp|Q6X9Z5|RLA2_HORSE2.797e-1241.9460S acidic ribosomal protein P2 OS=Equus caballus ... [more]
sp|P50879|RLA2_TAESO3.044e-1243.5560S acidic ribosomal protein P2 OS=Taenia solium O... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183I9B79.669e-1453.45Uncharacterized protein OS=Soboliphyme baturini OX... [more]
A0A328HPX86.275e-1346.15Uncharacterized protein (Fragment) OS=Enterobacter... [more]
A0A132AE911.151e-1250.0060S acidic ribosomal protein P2-like protein OS=Sa... [more]
A0A4W4DYU71.920e-1246.15Ribosomal protein, large P2 OS=Electrophorus elect... [more]
A0A2D4BM794.393e-1240.63Ribosomal protein putative OS=Pythium insidiosum O... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rplp25.360e-1341.9460S acidic ribosomal protein P2-like [Source:NCBI ... [more]
rplp2l4.554e-838.60ribosomal protein, large P2, like [Source:ZFIN;Acc... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rplp26.113e-1342.86ribosomal protein, large P2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPP2B1.191e-836.51Ribosomal protein P2 beta; a component of the ribo... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO475032.847e-1037.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rplp22.974e-1238.7160S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
rplp22.974e-1238.7160S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
lin7c5.072e-1137.1460S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
lin7c5.238e-1140.3260S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
lin7c1.703e-1039.0660S acidic ribosomal protein P2 [Source:NCBI gene;... [more]
back to top
BLAST of 60S acidic ribosomal protein P2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000009232.14.659e-42100.00SMESG000009232.1[more]
SMESG000057890.13.448e-1043.75SMESG000057890.1[more]
SMESG000057890.13.935e-645.26SMESG000057890.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023159 ID=SMED30023159|Name=60S acidic ribosomal protein P2|organism=Schmidtea mediterranea sexual|type=transcript|length=450bp
TATTTGTAAATTTATATTAAAAATTCTTGTTTAAATAATTAAATACTATC
TACAAATTTTGATTTAAAAATGCGTTACCTTTCATCTTATATTCTATCTG
TTCTTGGTGGAAACGCTGAACCAGAAGCAGAAGACATCAGCACGATTTTG
ACTGCTGTTGGTATTGAATGTGACATCAATAAAGCCAAAGAAGCTGTTCA
AGCAATTGATTGCAGAGATGTCAATGACCTTATTTCTCAAGGTTTGAAAA
AGATCTCCTCAGTACCAACTGGTGGAGCTGGAGCAGCACCAACTGCAGCT
ACAAGCTCAGCTCCAGCACCAGCTGCTAAAGAGGAAGTCAAAGCAGCTGC
TAAAGAATCTAGCTCTGAATCTGAAGAAGGAGACATGGGATTTGGATTAT
TTGATTAATCATATTTTAAATAAAATTGGATATGATATTTTAAAAAAAAA
back to top

protein sequence of SMED30023159-orf-1

>SMED30023159-orf-1 ID=SMED30023159-orf-1|Name=SMED30023159-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
MRYLSSYILSVLGGNAEPEAEDISTILTAVGIECDINKAKEAVQAIDCRD
VNDLISQGLKKISSVPTGGAGAAPTAATSSAPAPAAKEEVKAAAKESSSE
SEEGDMGFGLFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: biological process
TermDefinition
GO:0006414translational elongation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000240body wall musculature
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038716P1/P2_N_sf
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF00428Ribosomal_60scoord: 17..111
e-value: 2.8E-18
score: 66.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 65..112
NoneNo IPR availablePANTHERPTHR21141:SF560S ACIDIC RIBOSOMAL PROTEIN P2coord: 1..112
NoneNo IPR availablePANTHERPTHR2114160S ACIDIC RIBOSOMAL PROTEIN FAMILY MEMBERcoord: 1..112
NoneNo IPR availableCDDcd05833Ribosomal_P2coord: 1..65
e-value: 6.13671E-21
score: 78.4592
IPR038716Ribosomal protein P1/P2, N-terminal domainGENE3DG3DSA:1.10.10.1410coord: 1..60
e-value: 6.4E-18
score: 66.6