Frizzled-4

Overview
NameFrizzled-4
Smed IDSMED30023158
Length (bp)1947
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Frizzled-4 (SMED30023158) t-SNE clustered cells

Violin plots show distribution of expression levels for Frizzled-4 (SMED30023158) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Frizzled-4 (SMED30023158) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Frizzled-4 (SMED30023158) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023158

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30023158SMESG000037982.1 SMESG000037981.1 dd_Smed_v4_13356_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30023158SMESG000037982.1 SMESG000037981.1 SmedASXL_015764SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30023158SMESG000037982.1 SMESG000037981.1 dd_Smed_v4_13356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023158SMESG000037982.1 SMESG000037981.1 dd_Smed_v4_13356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30023158SMESG000037982.1 SMESG000037981.1 dd_Smed_v4_13356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30023158SMESG000037982.1 SMESG000037981.1 dd_Smed_v4_13356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023158SMESG000037982.1 SMESG000037981.1 dd_Smed_v4_13356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30023158SMESG000037982.1 SMESG000037981.1 dd_Smed_v6_13356_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD4 (frizzled class receptor 4 [Source:HGNC Symbol;Acc:HGNC:4042])

HSP 1 Score: 313.153 bits (801), Expect = 2.207e-98
Identity = 188/514 (36.58%), Postives = 286/514 (55.64%), Query Frame = 1
Query:  130 ENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH-PSQEE-NLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHM-RNGEKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNS 1644
            + E+ +  PI I  CQN  YN T +      + + + ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  CEP+LK    +WPE LNCS+FP ++ H   CM  P  EE  L  K  IQ             P +   +C  +  N ++Y+++ R+  C LKC  +   +S+ +K   +IWM V  SL F+ST FT +TF   + R  YPE+PIIFL+  YNIYSI+ ++RL +GRE++SCDF+  + + +LIQEGL+NT CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDADEL GLC VG Q  D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  Y+  N+     A  ++S   D+ +AV +LK FM+ +VGI S +WI S  ++  W+KC   L+      ++ + N 
Sbjct:   39 DEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQ-------------PGE---ECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYEISNW-----ALFRYSA-DDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNG 525          
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD10 (frizzled class receptor 10 [Source:HGNC Symbol;Acc:HGNC:4039])

HSP 1 Score: 258.84 bits (660), Expect = 3.321e-77
Identity = 164/522 (31.42%), Postives = 264/522 (50.57%), Query Frame = 1
Query:  109 ISIVDSIENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH--------PSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKF-------SKRKDAIVA-------VFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            IS +D       K +PI I  C++  YN T +      + + E  I +  +  L+  GC  HL F LCS+Y P C       +  CR +CE+ +  C PI++  N  WP+ L+C + P ++     CM         P++   L   +       +   + + +    RG C    N  K+  + ++  CA  C+   + ++S+E K  A +W+ +   L F S+ FT +TF  +  R RYPE+PIIFL+  Y +YS+  L+RLF G E ++CD D  SGQ  +IQEGLE+T C + FL+ ++F  A+ +WW++L L W L         ++  NS  FHL  W + +V T+ +L++R V  DEL G+C VG    + L  F +IP    L+IG  F+LSGF    +  ++       +  K+  L+    R+GLFS++Y +    +I C  Y+  N  YW     +        +K  D ++A       +F++K FM  VVGI S +WI +  ++ +W++
Sbjct:   21 ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCD---NPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRD--SGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL-FHIRRVMKTGGENTDKLEKLM---VRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQ 533          
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD9 (frizzled class receptor 9 [Source:HGNC Symbol;Acc:HGNC:4047])

HSP 1 Score: 254.218 bits (648), Expect = 2.353e-75
Identity = 165/553 (29.84%), Postives = 260/553 (47.02%), Query Frame = 1
Query:  103 LLISIVDSIENEKCKP-KPIAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSL-------NKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSEND--FFSKESKTIAEIWMKVITSLTFVSTLFTCVTFC-HNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWS--------RAPIKFSKRKD--------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQ 1668
            L I   D        P + + I  C+   YN T     L    + E    +  +  L+  GC  HL F LCS+Y P C       +  CR +CE+ +  C PI++  N  WP+ L+C+R P  +     CM   +          + L +        +   ++       G C    N EK+ ++ ++  CA +C      F+S+  K  A +WM V ++L F ST FT +TF     R +YPE+PIIFL+  YN+YS++ L+R   G + V+CD +  +G   +IQEGLENT C + FLL ++F  A+ +WW++L L W L         ++  +   FH+  W + ++ T+ +L LR V  DEL GLC V       L  F ++P    L++G  FLL+GF    +  +K       + +K+  L+    ++G+FSI+Y +    +I C +Y+  N  +W          A      R+D          VAVF+LK FM+ VVGI S +W+ S  +   W+    +   K+   +      R   SYG+
Sbjct:   23 LEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCE---NPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQE--AGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVAL-FHIRKIMKTGGTNTEKLEKLM---VKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQS---LCYRKIAAGRARAKACRAPGSYGR 563          
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD5 (frizzled class receptor 5 [Source:HGNC Symbol;Acc:HGNC:4043])

HSP 1 Score: 206.838 bits (525), Expect = 5.598e-58
Identity = 149/506 (29.45%), Postives = 243/506 (48.02%), Query Frame = 1
Query:  157 IAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFP-LESSHQMQCMHPSQEENL--------QRKIQIQNLSLNKDRNNIHEPKQYRGQCRH-----MRNGEKYVFINRTGR---CALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA-----PIKFSKRKDAIVA--VFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            I +  C+   YN T +    + D + E  + +  +  L+   CS  L F LCS+Y P C  D    L PCR VCE+ +  C P+++    +WPE+++C R P L    ++ CM  ++ E           +                     +  +CR      ++         RTG+   CA+ C +  F S + +T A  W+ + + L F+ST  T  TF  +  R RYPE+PIIFL+  Y   S+  L+RL +G   V+C  +       +  E      C I FLL +FF  A+ +WW++L L W L   +     ++A  +  FHL  WL+ SV +++ L L SVD D + G+C VG Q  + L  F + P ++ L++G +FLL+GF    +R +    +      K+  L+    R+G+F+++Y +  + ++ C LY+ +    W  A     P   + +  A     V +LK+FM  VVGI S +WI S  +V +W++
Sbjct:   36 ITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSF-SADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSRE----HNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSL-FRIRSVIKQGGTKTDKLEKLM---IRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRR 532          
BLAST of Frizzled-4 vs. Ensembl Human
Match: FZD2 (frizzled class receptor 2 [Source:HGNC Symbol;Acc:HGNC:4040])

HSP 1 Score: 189.504 bits (480), Expect = 9.808e-52
Identity = 143/523 (27.34%), Postives = 237/523 (45.32%), Query Frame = 1
Query:  151 KPIAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKI---------QIQNLSLNKDRNNIHEPKQYRG-----QCRHMRNGEKYVFINRTGR--CALKCSE-----NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA-------------PIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVML 1602
            +PI+I  C +  YN T     L    + +  + +  +  L+   CS  L F LCS+Y P C       + PCR +CE+ +  CE ++      WPE+L C  FP   + Q+ C+  +  E+    +         Q               P +Y        C  +     Y+     G   CA  C       + FFS+E    A +W+   + L   ST FT  T+  + +R RYPE+PIIFL+  Y + S++ +    L +E+V C+          + +G +   C I F++ +FFS A+ +WW++L L W L   +     ++  NS  FHL  W + +V T+++L +  +D D L G+C VG  + D L  F + P  + L IG  FLL+GF    +R +          +K+  L+    R+G+FS++Y +    +I C  Y+     +W R+             P  ++ R      V+++K+ M  +VGI S  WI S  ++ +W+K +  L
Sbjct:   40 QPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQ-AIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQI-CVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL-QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSL-FRIRTIMKHDGTKTEKLERLM---VRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRL 555          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 178.718 bits (452), Expect = 2.421e-48
Identity = 142/527 (26.94%), Postives = 236/527 (44.78%), Query Frame = 1
Query:  112 SIVDSIENEKCKPKPIAIGQCQNKFYNFT----SLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAI-------VAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK-CFVMLLEKVTFNKKIKSNSREI 1653
            SI D     KC P  I I  C++  YN+T    ++  + +  +Q   E ++ L+   C  H++F +CSV+ P C       +  C+ VCE+V+ DC  IL+   + WPE LNC++FP        CM P+++E +        L      ++  +P    G    + + + +   +    CA  C  N  FS ++K +   W     +      LF+ +TF  +R R R+PE+ + +L+    I S+  L  LF+     SC     +G+  L     +N+ C  +FLLN+FFSTA  +WW+M      L          +   S   H   W ++S+ T+ VLI   VDA EL  LCSVG      LL F I+P+ IC++IG  F++ GF         F  +     +    ++ +GF   LF    I+     + C+ Y++     W+R  I   ++  A          +++     +   G +  +W+LS  +V AWK   F  +         I+ ++R +
Sbjct:   18 SIFDQAVKGKCIP--IDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP---DPPELCMKPTEDE-ITGGFSAPRLPTKGSSSSSSKPT---GCPSDLVDVDPH---DPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCH-ALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALF----ILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKNPIEPSTRPL 527          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 178.718 bits (452), Expect = 2.421e-48
Identity = 142/527 (26.94%), Postives = 236/527 (44.78%), Query Frame = 1
Query:  112 SIVDSIENEKCKPKPIAIGQCQNKFYNFT----SLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAI-------VAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK-CFVMLLEKVTFNKKIKSNSREI 1653
            SI D     KC P  I I  C++  YN+T    ++  + +  +Q   E ++ L+   C  H++F +CSV+ P C       +  C+ VCE+V+ DC  IL+   + WPE LNC++FP        CM P+++E +        L      ++  +P    G    + + + +   +    CA  C  N  FS ++K +   W     +      LF+ +TF  +R R R+PE+ + +L+    I S+  L  LF+     SC     +G+  L     +N+ C  +FLLN+FFSTA  +WW+M      L          +   S   H   W ++S+ T+ VLI   VDA EL  LCSVG      LL F I+P+ IC++IG  F++ GF         F  +     +    ++ +GF   LF    I+     + C+ Y++     W+R  I   ++  A          +++     +   G +  +W+LS  +V AWK   F  +         I+ ++R +
Sbjct:   18 SIFDQAVKGKCIP--IDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP---DPPELCMKPTEDE-ITGGFSAPRLPTKGSSSSSSKPT---GCPSDLVDVDPH---DPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCH-ALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALF----ILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKNPIEPSTRPL 527          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 178.718 bits (452), Expect = 2.421e-48
Identity = 142/527 (26.94%), Postives = 236/527 (44.78%), Query Frame = 1
Query:  112 SIVDSIENEKCKPKPIAIGQCQNKFYNFT----SLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAI-------VAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK-CFVMLLEKVTFNKKIKSNSREI 1653
            SI D     KC P  I I  C++  YN+T    ++  + +  +Q   E ++ L+   C  H++F +CSV+ P C       +  C+ VCE+V+ DC  IL+   + WPE LNC++FP        CM P+++E +        L      ++  +P    G    + + + +   +    CA  C  N  FS ++K +   W     +      LF+ +TF  +R R R+PE+ + +L+    I S+  L  LF+     SC     +G+  L     +N+ C  +FLLN+FFSTA  +WW+M      L          +   S   H   W ++S+ T+ VLI   VDA EL  LCSVG      LL F I+P+ IC++IG  F++ GF         F  +     +    ++ +GF   LF    I+     + C+ Y++     W+R  I   ++  A          +++     +   G +  +W+LS  +V AWK   F  +         I+ ++R +
Sbjct:   18 SIFDQAVKGKCIP--IDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP---DPPELCMKPTEDE-ITGGFSAPRLPTKGSSSSSSKPT---GCPSDLVDVDPH---DPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCH-ALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALF----ILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKNFIFCGMCSSAPVKNPIEPSTRPL 527          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 177.948 bits (450), Expect = 3.515e-48
Identity = 139/503 (27.63%), Postives = 228/503 (45.33%), Query Frame = 1
Query:  112 SIVDSIENEKCKPKPIAIGQCQNKFYNFT----SLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAI-------VAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            SI D     KC P  I I  C++  YN+T    ++  + +  +Q   E ++ L+   C  H++F +CSV+ P C       +  C+ VCE+V+ DC  IL+   + WPE LNC++FP        CM P+++E +        L      ++  +P    G    + + + +   +    CA  C  N  FS ++K +   W     +      LF+ +TF  +R R R+PE+ + +L+    I S+  L  LF+     SC     +G+  L     +N+ C  +FLLN+FFSTA  +WW+M      L          +   S   H   W ++S+ T+ VLI   VDA EL  LCSVG      LL F I+P+ IC++IG  F++ GF         F  +     +    ++ +GF   LF    I+     + C+ Y++     W+R  I   ++  A          +++     +   G +  +W+LS  +V AWK
Sbjct:   18 SIFDQAVKGKCIP--IDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP---DPPELCMKPTEDE-ITGGFSAPRLPTKGSSSSSSKPT---GCPSDLVDVDPH---DPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCH-ALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALF----ILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWK 503          
BLAST of Frizzled-4 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 177.948 bits (450), Expect = 3.515e-48
Identity = 139/503 (27.63%), Postives = 228/503 (45.33%), Query Frame = 1
Query:  112 SIVDSIENEKCKPKPIAIGQCQNKFYNFT----SLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAI-------VAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            SI D     KC P  I I  C++  YN+T    ++  + +  +Q   E ++ L+   C  H++F +CSV+ P C       +  C+ VCE+V+ DC  IL+   + WPE LNC++FP        CM P+++E +        L      ++  +P    G    + + + +   +    CA  C  N  FS ++K +   W     +      LF+ +TF  +R R R+PE+ + +L+    I S+  L  LF+     SC     +G+  L     +N+ C  +FLLN+FFSTA  +WW+M      L          +   S   H   W ++S+ T+ VLI   VDA EL  LCSVG      LL F I+P+ IC++IG  F++ GF         F  +     +    ++ +GF   LF    I+     + C+ Y++     W+R  I   ++  A          +++     +   G +  +W+LS  +V AWK
Sbjct:   18 SIFDQAVKGKCIP--IDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP---DPPELCMKPTEDE-ITGGFSAPRLPTKGSSSSSSKPT---GCPSDLVDVDPH---DPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCH-ALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRGTDTSKLEKLMVKMGFFCALF----ILPNVIELVCQCYKFMILTQWTRMTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWK 503          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0075743)

HSP 1 Score: 172.94 bits (437), Expect = 3.832e-46
Identity = 142/525 (27.05%), Postives = 233/525 (44.38%), Query Frame = 1
Query:  151 KPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKI----QIQNLSLNKDRNNIHEP------------KQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSC--DFDP------VSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYW------------------SRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            +PI I  C+N  YN T +       ++ E  + +  +  L+  GCS  L   LCS+YVP C       + PCR +CE  +  CE ++K  N +WPE L CS+FP+     + C+  +   +          +  ++  K +  +  P            K   G    ++ G K +       C   C    FF +  +T+   W+    ++   S LFT +TF   + R RYPE+ I+FL   Y +   + +  L  G + VSC   F P      +     + Q   + T+C + F+  +F   A   WW  L   W L   L     ++   S +FHL  W + ++ T+SVL L  V+ D L G+C VG+     L  F I+P  I L IG +FLL+GF    +R +           K+  L+    R+G FS ++I+    ++ C  Y+YYN+  W                  +RAP   S     I  +F++K+  + +VG+ S++W+ S  ++ +W+
Sbjct:   54 EPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER-PIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHGGEDL-CVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLH-----DCGAPCHAM-FFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAG-DSVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISL-FRIRTVMKTDGKRTDKLERLM---LRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAP--GSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMVSWR 562          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz (gene:FBgn0001085 transcript:FBtr0330102)

HSP 1 Score: 173.326 bits (438), Expect = 4.640e-46
Identity = 142/525 (27.05%), Postives = 233/525 (44.38%), Query Frame = 1
Query:  151 KPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKI----QIQNLSLNKDRNNIHEP------------KQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSC--DFDP------VSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYW------------------SRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            +PI I  C+N  YN T +       ++ E  + +  +  L+  GCS  L   LCS+YVP C       + PCR +CE  +  CE ++K  N +WPE L CS+FP+     + C+  +   +          +  ++  K +  +  P            K   G    ++ G K +       C   C    FF +  +T+   W+    ++   S LFT +TF   + R RYPE+ I+FL   Y +   + +  L  G + VSC   F P      +     + Q   + T+C + F+  +F   A   WW  L   W L   L     ++   S +FHL  W + ++ T+SVL L  V+ D L G+C VG+     L  F I+P  I L IG +FLL+GF    +R +           K+  L+    R+G FS ++I+    ++ C  Y+YYN+  W                  +RAP   S     I  +F++K+  + +VG+ S++W+ S  ++ +W+
Sbjct:   54 EPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI-LERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHGGEDL-CVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMGYELKVGGKDLH-----DCGAPCHAM-FFPERERTVLRYWVGSWAAVCVASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAG-DSVSCREPFPPPVKLGRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGALFLLAGFISL-FRIRTVMKTDGKRTDKLERLM---LRIGFFSGLFILPAVGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARAP--GSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTMVSWR 562          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz4 (gene:FBgn0027342 transcript:FBtr0071017)

HSP 1 Score: 170.629 bits (431), Expect = 1.107e-44
Identity = 111/392 (28.32%), Postives = 173/392 (44.13%), Query Frame = 1
Query:  157 IAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQ-LEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNL-SLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMK----VITSLTFVSTLFTCVTFCHNRRIRYPEQPIIF--LTFSYNIYSISILLRLFLGREKVSCDFDP-VSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCW-------------TLFCALNVSALSLAKNSGI----------FHLFV-WLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIP 1221
            I I  C+   YN TS+      + + +V+  ++T+  L+   CS  L   LC+ YVP C     +  + PCR +CE V+  C P+L+     WP  L+C +FP E++H+  CM    E  L +  Q Q+L  L           +    C  +     YV + R+GRCA  C  +  F+   K +AEIW+         L  V+T+  C+      R+   +   +   L + +N+ ++   +R  +GR   +C  DP    + +L  +GL N +CA  FL+ ++F  A   WW +LCL W              +    N       +NS            F  FV W + +  T +V++ R VDADEL G C VG Q+   L      P
Sbjct:   49 IRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGE--LHQPQQEQDLYGLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGRCAPLCEADILFTPAEKHLAEIWVSTWAYAALGLALVATV--CLLASDGSRLASAKWSRLLSPLIWCHNMVTLGWAVRFMVGRTGTACGTDPQAPNESLLTVDGLSNASCASVFLMRYYFGMAACAWWAVLCLGWHRDIRRHSPDSKGHVVIPSNFGGSPAKRNSAKTAQQDLTQNNFVCFVAWGLPAFQTSAVIVARFVDADELLGACFVGNQSDKALQILVATP 436          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz4 (gene:FBgn0027342 transcript:FBtr0071018)

HSP 1 Score: 170.629 bits (431), Expect = 1.107e-44
Identity = 111/392 (28.32%), Postives = 173/392 (44.13%), Query Frame = 1
Query:  157 IAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQ-LEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNL-SLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMK----VITSLTFVSTLFTCVTFCHNRRIRYPEQPIIF--LTFSYNIYSISILLRLFLGREKVSCDFDP-VSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCW-------------TLFCALNVSALSLAKNSGI----------FHLFV-WLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIP 1221
            I I  C+   YN TS+      + + +V+  ++T+  L+   CS  L   LC+ YVP C     +  + PCR +CE V+  C P+L+     WP  L+C +FP E++H+  CM    E  L +  Q Q+L  L           +    C  +     YV + R+GRCA  C  +  F+   K +AEIW+         L  V+T+  C+      R+   +   +   L + +N+ ++   +R  +GR   +C  DP    + +L  +GL N +CA  FL+ ++F  A   WW +LCL W              +    N       +NS            F  FV W + +  T +V++ R VDADEL G C VG Q+   L      P
Sbjct:   49 IRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGE--LHQPQQEQDLYGLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGRCAPLCEADILFTPAEKHLAEIWVSTWAYAALGLALVATV--CLLASDGSRLASAKWSRLLSPLIWCHNMVTLGWAVRFMVGRTGTACGTDPQAPNESLLTVDGLSNASCASVFLMRYYFGMAACAWWAVLCLGWHRDIRRHSPDSKGHVVIPSNFGGSPAKRNSAKTAQQDLTQNNFVCFVAWGLPAFQTSAVIVARFVDADELLGACFVGNQSDKALQILVATP 436          
BLAST of Frizzled-4 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0112890)

HSP 1 Score: 166.007 bits (419), Expect = 3.764e-43
Identity = 107/336 (31.85%), Postives = 173/336 (51.49%), Query Frame = 1
Query:  622 INRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFC-HNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTN-CAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQ-XXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA---PIKFSK--RKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLL 1605
            I     C + C +  FFS + K  A +W+ + + L F STL T  TF     R +YPE+PI+FL+  Y + ++  L R FL  E+++CD        +L++E     + C + FLL +FF  A+ +WW++L   W L   L     ++ K+S  FHL  WL+ +V +V+VL+L +VD D + G+C VG   PD L TF + P  +  +I     +      F+ R+       +    K   L  +  R+G+FS++Y +    +I C LY+   +  W +A   P    K   K  + +V +LK+FM   VGI S +WI S  ++ +W++ +  LL
Sbjct:  294 IAGVPNCGIPC-KGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACD-------GLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLL 621          

HSP 2 Score: 78.5666 bits (192), Expect = 9.706e-15
Identity = 43/135 (31.85%), Postives = 62/135 (45.93%), Query Frame = 1
Query:  109 ISIVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQDQEAEVQ----IPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCM-HPSQEE 498
            + ++    N +C+   I I  C+   YN TS   +   E Q    + +  +  L+   CS  L F LCS+Y P C  D    L  CR VCE+ +  C PI++  +  WPE++ C   PL       CM  PS  E
Sbjct:   53 VPVIPKDPNLRCEE--ITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTE 185          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: fzd4 (frizzled class receptor 4 [Source:ZFIN;Acc:ZDB-GENE-990415-217])

HSP 1 Score: 283.878 bits (725), Expect = 1.510e-87
Identity = 167/524 (31.87%), Postives = 276/524 (52.67%), Query Frame = 1
Query:  130 ENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNG-EKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNST 1680
            + E+    PI I  CQ+  YN T +        +++ ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  C P+L+     WPE LNCS FP  +     CM    +E+                + +        +C  +  G E+Y ++ R+G C+L+C  +   + +++K   ++WM V   L F+ST FT +TF   + R  YPE+PIIFL+   NIYS++ ++RL +GRE++SCD +  +   +L+QEGL+NT CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDAD+L G+C VG Q  D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  Y+  N+  + +        +D+ +A  +L+ FM+ +VGI S +W+ S  ++  W++C   L+     N ++K  +      G+ N T
Sbjct:   23 DEEEMTCDPIRISMCQDLGYNVTKMPNLVGNVLQSDAELQLTTFTPLIQYGCSSQLKFFLCSVYVPMCTEKVPIPIGPCGSMCMSVKRKCLPVLQEFGFVWPELLNCSLFPPTNDQNHMCMEGPGDED-------------PPFHAVRPVAPQEEECIALGAGVEQYAWVKRSGSCSLQCGYDTGLYRRQAKVFTDVWMAVWAVLCFISTTFTVLTFLVDSSRFSYPERPIIFLSMCCNIYSVAFIVRLTVGRERISCDLEE-AAVPVLVQEGLKNTGCAIVFLLTYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADDLAGMCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYEISNWADFRQT------ARDSYMAAEMLRIFMSLLVGITSGMWVWSAKTLHTWQRCSHRLVHTGR-NNRVKRTANGWVKPGKGNET 521          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: fzd9b (frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GENE-000906-4])

HSP 1 Score: 271.937 bits (694), Expect = 1.684e-82
Identity = 166/515 (32.23%), Postives = 267/515 (51.84%), Query Frame = 1
Query:  118 VDSIENEKCKP---KPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYR--GQCRHMRNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIK-----FSKRKD---------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            + S + E+ +P   +PI I  CQ   YN T +      D + E  I +  +  L+  GC  HL F LCS+Y P C       +  CR +CE+ +  C PI++  N +WPE LNCS+ P  +     CM   + +      + + +     R         R  G      N EK+ ++ ++  CA +CS   + F+S++ K  A IWM V ++L FVST FT +TF  +  R +YPE+PIIFL+  YN+YS++ ++R   G E ++CD +  +G+  +IQEGLE+T C I FL+ ++F  A+ +WW++L L W L         ++  +S  FH+  W + ++ T+ +L +R V  DEL GLC VG      L  F ++P    L+IG  F+L+GF    +  +K       + +K+  L+    ++G++SI+Y +    +I C  Y+  N  YW    ++     F  R++           VAVF+LK FM+ VVGI S +W+ S  ++  W+
Sbjct:   25 IGSYDLERGRPAKCEPIVIPMCQGIGYNLTRMPNFMDHDNQREAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQKCSPIMEKFNYAWPESLNCSKLPTRNDPNALCMEAPENDTKTETKKGEGMLPVPPRPRQPGAGNARSGGTMGVCENPEKFQYVEKSETCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRE--NGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSCYLVIGTSFILTGFVAL-FHIRKVMKTEGTNTEKLEKLM---VKIGIYSILYTVPATCVIICYFYERLNMDYWKFRGLQSKCTTFPGRRNEDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQ 533          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: fzd9b (frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GENE-000906-4])

HSP 1 Score: 271.937 bits (694), Expect = 1.684e-82
Identity = 166/515 (32.23%), Postives = 267/515 (51.84%), Query Frame = 1
Query:  118 VDSIENEKCKP---KPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYR--GQCRHMRNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIK-----FSKRKD---------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            + S + E+ +P   +PI I  CQ   YN T +      D + E  I +  +  L+  GC  HL F LCS+Y P C       +  CR +CE+ +  C PI++  N +WPE LNCS+ P  +     CM   + +      + + +     R         R  G      N EK+ ++ ++  CA +CS   + F+S++ K  A IWM V ++L FVST FT +TF  +  R +YPE+PIIFL+  YN+YS++ ++R   G E ++CD +  +G+  +IQEGLE+T C I FL+ ++F  A+ +WW++L L W L         ++  +S  FH+  W + ++ T+ +L +R V  DEL GLC VG      L  F ++P    L+IG  F+L+GF    +  +K       + +K+  L+    ++G++SI+Y +    +I C  Y+  N  YW    ++     F  R++           VAVF+LK FM+ VVGI S +W+ S  ++  W+
Sbjct:   25 IGSYDLERGRPAKCEPIVIPMCQGIGYNLTRMPNFMDHDNQREAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQKCSPIMEKFNYAWPESLNCSKLPTRNDPNALCMEAPENDTKTETKKGEGMLPVPPRPRQPGAGNARSGGTMGVCENPEKFQYVEKSETCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRE--NGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSCYLVIGTSFILTGFVAL-FHIRKVMKTEGTNTEKLEKLM---VKIGIYSILYTVPATCVIICYFYERLNMDYWKFRGLQSKCTTFPGRRNEDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQ 533          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 270.781 bits (691), Expect = 6.440e-82
Identity = 173/539 (32.10%), Postives = 279/539 (51.76%), Query Frame = 1
Query:  103 LLISIVDSIENEKCKPKPIAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHM----RNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWS-RAP----IKFSKRKD---------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNS 1644
            L I   D       K +PI I  CQ   YN T     L+ + + E  I +  +  L+  GC  HL F LCS+YVP C       +  CR +CE+ +  C PI++  + SWP+ L+CS+ P  +     C+   + +      + + +     R+   +P    G+   +     N EK+ +++++  CA +C+   + ++S++ K  A IWM V ++L FVST FT +TF  + +R +YPE+PIIFL+  YNIYS++ ++R   G E ++CD +  +G+  +I+EGLE+T C I FL+ ++F  A+ +WW++L L W L         ++  +S  FH+  W + +V T+ +L +R V  DEL GLC VG      L  F +IP    LI+G  F+L+GF    +  +K       + +K+  L+    ++G+FSI+Y +    +I C  Y+  N  YW  RA     + F  R+            VAVF+LK FM+ VVGI S +W+ S  ++  W+  +   L   T +K   S S
Sbjct:   21 LEIGAYDLEHGRPGKCEPITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQVSASIPACRPMCEQARQRCSPIMEQFSFSWPDSLDCSKLPTNNDPNALCIEAPENDTQPETKKGEGMLPVPPRS--RQPTTVSGRISSISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACDRE--NGELYIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVAL-FHIRKIMKTGGTNTEKLEKLM---VKIGVFSILYTVPATIVIICYFYERLNMEYWKFRALENKCVSFPGRRSDDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLYNRRLGVQTSHKPCSSVS 551          
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 270.396 bits (690), Expect = 8.848e-82
Identity = 173/539 (32.10%), Postives = 279/539 (51.76%), Query Frame = 1
Query:  103 LLISIVDSIENEKCKPKPIAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHM----RNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWS-RAP----IKFSKRKD---------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNS 1644
            L I   D       K +PI I  CQ   YN T     L+ + + E  I +  +  L+  GC  HL F LCS+YVP C       +  CR +CE+ +  C PI++  + SWP+ L+CS+ P  +     C+   + +      + + +     R+   +P    G+   +     N EK+ +++++  CA +C+   + ++S++ K  A IWM V ++L FVST FT +TF  + +R +YPE+PIIFL+  YNIYS++ ++R   G E ++CD +  +G+  +I+EGLE+T C I FL+ ++F  A+ +WW++L L W L         ++  +S  FH+  W + +V T+ +L +R V  DEL GLC VG      L  F +IP    LI+G  F+L+GF    +  +K       + +K+  L+    ++G+FSI+Y +    +I C  Y+  N  YW  RA     + F  R+            VAVF+LK FM+ VVGI S +W+ S  ++  W+  +   L   T +K   S S
Sbjct:   22 LEIGAYDLEHGRPGKCEPITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQVSASIPACRPMCEQARQRCSPIMEQFSFSWPDSLDCSKLPTNNDPNALCIEAPENDTQPETKKGEGMLPVPPRS--RQPTTVSGRISSISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACDRE--NGELYIIREGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVAL-FHIRKIMKTGGTNTEKLEKLM---VKIGVFSILYTVPATIVIICYFYERLNMEYWKFRALENKCVSFPGRRSDDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLYNRRLGVQTSHKPCSSVS 552          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: FZD4 (frizzled class receptor 4 [Source:NCBI gene;Acc:100497693])

HSP 1 Score: 310.071 bits (793), Expect = 2.235e-97
Identity = 187/528 (35.42%), Postives = 289/528 (54.73%), Query Frame = 1
Query:   91 ICLFLLISIVDSI----ENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNS 1644
            +CL LL  +V  I    + E+ +  PI I  CQN  YN T +      + +A+ ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  CEP+LK    +WPE LNCS+FP ++ H   CM    ++ +   +  +   L  +  N   P           N ++Y ++ R+  C LKC  ++  +S+ SK   +IWM V  SL F+ST FT +TF   + R  YPE+PIIFL+  YNIYSI+ ++RL +GRE++SCDF+  + + +LIQEGL+NT CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDADEL GLC VG Q  D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  Y+  N++ +           D+ +AV +L  FM+ +VGI S +WI S  ++  W+KC   L+      +K + + 
Sbjct:    8 LCLPLLGCLVGHIAGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDDEV--PVHSKTPVLPGEDCNSFGP-----------NSDQYTWVKRSMNCVLKCGYDSGLYSRLSKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFCYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEE-AAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNIDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYEISNWNVFRYT------ADDSNMAVEMLNIFMSLLVGITSGMWIWSAKTLHTWQKCTNRLVNSGKVKRKKRVDG 511          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: FZD9 (frizzled class receptor 9 [Source:NCBI gene;Acc:100487936])

HSP 1 Score: 258.07 bits (658), Expect = 4.328e-77
Identity = 160/514 (31.13%), Postives = 253/514 (49.22%), Query Frame = 1
Query:  109 ISIVDSIENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH-PSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKC--SENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFC-HNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYW-SRA------PIKFSKRKD-------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            + + D     + K +PI I  CQ   YN T +      + + E    ++ +  L+  GC  HL F LCS+Y P C       +  C+ +CE  +  C PI++     WPE L+C R P ++     CM  P    N         +     R          G      N +K++++ R+G CA +C    + ++S   K  A +WM   + L F+ST FT  TF  H +R +YPE+PIIFL+  YN+YS + L+R   G   ++CD +   G   LI+EGLE++ C + FL+ ++F  A+ +WW++L L W L  +      ++  +   FHL  W + ++ T+ +L +R V  DEL GLC VG   P  L  F ++P    L+ G  FLL+GF    +  ++       + +K+  L+    ++G+FSI+Y +    +I C  Y+  N  +W SRA       +  S R D         VAVF+LK FM+  VGI S +W+ S  ++ AW+
Sbjct:   15 MGLYDVERGREAKCEPIQIPMCQGIGYNMTRMPNYVGHESQEEAAAKLQEFAPLVEYGCHIHLRFFLCSLYAPMCTEQVSTSIPACKPMCEAARQKCAPIMESFQYVWPESLDCDRLPSKNDPHALCMEAPENATNGDPPTNGHGMLPVAPRPP-RPSGSGIGISSRCANPDKFMYVERSGVCAPRCIPGVDVYWSSGDKDFALVWMAAWSGLCFISTAFTVFTFLLHPQRFQYPEKPIIFLSMCYNVYSTAFLIRAAAGAPSIACDRE--GGAPYLIREGLESSGCTLVFLILYYFGMASSLWWVVLTLTWFLAASKKWGHEAIESHGSYFHLAAWGIPAIKTIIILTMRKVGGDELTGLCYVGGSDPSALTGFVLVPLSCYLVTGTSFLLTGFVAL-FHIRRVMKTGGTNTEKLEKLM---VKIGVFSILYTVPATCIIVCCFYERLNLAHWDSRAREESCRTVPGSARPDCNLPHSIPSVAVFMLKIFMSLAVGITSGVWVWSSKTLQAWQ 521          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: fzd8 (frizzled class receptor 8 [Source:NCBI gene;Acc:100038274])

HSP 1 Score: 234.187 bits (596), Expect = 5.002e-68
Identity = 168/543 (30.94%), Postives = 263/543 (48.43%), Query Frame = 1
Query:   94 CLFLLISIVDSIENEKCKP------KPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCM-HPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRG-----------------QCRHMR---NGEKYVFINR--TGR---CALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA--------PIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            CL+LL+  V  ++  +C        + I +  C++  YN+T +    + D + E  + +  +  L+   CS  L F LCS+Y P C  D    L PCR VCE+ +  C P+++    +WP+++ C R P + +    CM + ++ E                R+    PK                     QCR        E++   NR  TG+   CA+ C  N +FS E +T  E W+ + + L F ST  T  TF  +  R +YPE+PIIFL+  Y + S   L+RL  G EKV+C    +  + I+  E      C + FLL +FF  A+ +WW++L L W L   +     ++A  S  FHL  WL+ S+ +++VL L SVD D + G+C VG Q  D L  F + P +I L IG +FLL+GF    +R +    +      K+  L+    R+G+FS++Y +    ++ C  Y+ +N   W  A         +   +R D   AVF+LK+FM  VVGI S +WI S  ++ +W+ 
Sbjct:    3 CLYLLLLAVSWLQGSQCAAAKELSCQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYYNRTEQTTAAPSHPEPPKPPARS---APKGRTRVEPPRPRPRAPGCEPGCQCRAPMVPVTNERHPLYNRVRTGQIPNCAMPC-HNPYFSPEERTFTEFWIGLWSVLCFASTFATVSTFLIDMERFKYPERPIIFLSACYLLVSAGYLVRLIAGHEKVACSRGELDLEHIIHYETTGPALCTLVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSL-FRIRSVIKQGGTKTDKLEKLM---IRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEVAQPRRPD--YAVFMLKYFMCLVVGITSGVWIWSGKTLESWRA 535          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: zdhhc9 (zinc finger DHHC-type containing 9 [Source:Xenbase;Acc:XB-GENE-1016830])

HSP 1 Score: 228.409 bits (581), Expect = 3.272e-66
Identity = 155/492 (31.50%), Postives = 245/492 (49.80%), Query Frame = 1
Query:  157 IAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINR--TGR---CALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA-----PIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            I +  C+   YN T +    + D + E  + +  +  L+   CS  L F LCS+Y P C  D    L PCR VCE+ +  C P+++    +WPE++NC R P        CM  +  E            +    ++     + R     +   E +   NR  TG+   CA+ C +  +F+++ KT A  W+ + + L F+ST  T  TF  +  R RYPE+PIIFL+  Y   SI  ++RL +G E V+C+ D +        E      C + FLL +FF  A+ +WW++L   W L   +     ++A  S  FH+  WL+ SV +++VL L SVD D + G+C VG Q  D L  F + P ++ L  G +FLL+GF    +R +    +      K+  L+    R+G+FS++Y +    ++ C +Y+ +   +W +A     P    KR     AVF+LK+FM  VVGI S +WI S  ++ +WK+
Sbjct:   36 ITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYRKPLPPCRSVCERAKAGCSPLMRKYGFAWPERMNCDRLPEHGDPDTLCMDYNWTETTTTPPPTHPPKVKTPSSDCDGVCKCREPFLSITR-ESHPLYNRIKTGQVPNCAMPCFQ-PYFTQDEKTFATFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYIVRLIVGHENVACNKDHIH------YETTGPALCTVVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVVYLFTGTMFLLAGFVSL-FRIRSVIKQGGTKTDKLEKLM---IRIGIFSVLYTVPATIVVACYIYEQHYREHWEKAHNCSCPGD-KKRYRPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWKR 514          
BLAST of Frizzled-4 vs. Ensembl Xenopus
Match: ntrk1 (neurotrophic receptor tyrosine kinase 1 [Source:Xenbase;Acc:XB-GENE-923001])

HSP 1 Score: 207.223 bits (526), Expect = 2.429e-58
Identity = 146/510 (28.63%), Postives = 242/510 (47.45%), Query Frame = 1
Query:  151 KPIAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGR--CALKC--SEND---FFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFD-PVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA-------------PIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVML 1602
            +PI+I  C +  YN T     L    + +  + +  +  L+   CS  L F LCS+Y P C       + PCR +CE+ +  CE ++      WPE+L C  FP   + Q+       E+     +             I+    +   C  +     Y+     G   CA  C  S+ND   FFS++    A +W+ + + L   ST FT  T+  + +R RYPE+PIIFL+  Y + S++ +    LG +KV C+ +    G K ++Q G +   C I F++ +FFS A+ +WW++L L W L   +     ++  NS  FHL  W + +V T+++L +  +D D L G+C VG    D L  F + P  + L IG  FLL+GF    +R +          +K+  L+    R+G+FS++Y +    +I C  Y+     +W R+             P++++ R      V+++K+ M  +VGI S  WI S  ++ +W+K +  L
Sbjct:   41 QPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSSELRFFLCSMYAPVCTVLEQ-AIPPCRSICERARHGCEALMNKFGFQWPERLRCENFPRHGAEQICVGQNHSEDGGPTLLTTSPPHHGTPGPPIYATLDHPFHCPRVLKVPSYLNYRFLGEKDCAAPCEPSKNDGFMFFSQDEIRFARVWILIWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLG-DKVVCNENFSEDGYKTVVQ-GTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLAGFVSL-FRIRTIMKHDGTKTEKLERLM---VRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQNCKSLAIPCPLQYTPRMTPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRL 543          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd4 (frizzled class receptor 4 [Source:MGI Symbol;Acc:MGI:108520])

HSP 1 Score: 311.227 bits (796), Expect = 7.075e-98
Identity = 186/514 (36.19%), Postives = 286/514 (55.64%), Query Frame = 1
Query:  130 ENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH-PSQEE-NLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHM-RNGEKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNS 1644
            + E+ +  PI I  CQN  YN T +      + + + ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  CEP+L+    +WP+ LNCS+FP ++ H   CM  P  EE  L  K  IQ             P +   +C  +  N ++Y+++ R+  C LKC  +   +S+ +K   +IWM V  SL F+ST FT +TF   + R  YPE+PIIFL+  YNIYSI+ ++RL +GRE++SCDF+  + + +LIQEGL+NT CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDADEL GLC VG Q  D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  Y+  N+     A  ++S   D+ +AV +LK FM+ +VGI S +WI S  ++  W+KC   L+      ++ + N 
Sbjct:   39 DEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLREFGFAWPDTLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQ-------------PGE---ECHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYEISNW-----ALFRYSA-DDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNG 525          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd9 (frizzled class receptor 9 [Source:MGI Symbol;Acc:MGI:1313278])

HSP 1 Score: 256.914 bits (655), Expect = 1.202e-76
Identity = 162/537 (30.17%), Postives = 257/537 (47.86%), Query Frame = 1
Query:  148 PKP---IAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSL----NKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSEND--FFSKESKTIAEIWMKVITSLTFVSTLFTCVTFC-HNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYW---------SRAPIKFSKRKDAI-------VAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQ 1668
            P P   + I  C+   YN T     L    + E    +  +  L+  GC  HL F LCS+Y P C       +  CR +CE+ +  C PI++  N  WP+ L+C+R P  +     CM   +          + L +     +      +     G      N EK+ ++ ++  CA +C      F+S+  K  A +WM V ++L F ST FT  TF     R +YPE+PIIFL+  YN+YS++ L+R   G + V+CD +  +G   +IQEGLENT C + FLL ++F  A+ +WW++L L W L         ++  +   FH+  W + ++ T+ VL LR V  DEL GLC V    P  L  F ++P    L++G  FLL+GF    +  +K       + +K+  L+    ++G+FSI+Y +    +I C +Y+  N  +W         + A +   +R  ++       VAVF+LK FM+ VVGI S +W+ S  +   W+    +   K+   +      R    YG+
Sbjct:   37 PAPCQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQE--AGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVAL-FHIRKIMKTGGTNTEKLEKLM---VKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQS---LCYRKMAAGRARAKACRTPGGYGR 564          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd10 (frizzled class receptor 10 [Source:MGI Symbol;Acc:MGI:2136761])

HSP 1 Score: 247.669 bits (631), Expect = 3.338e-73
Identity = 156/521 (29.94%), Postives = 259/521 (49.71%), Query Frame = 1
Query:  109 ISIVDSIENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH--------PSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYW--------------SRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            IS +D       K +P+ I  C++  YN T +      + + E  I +  +  L+  GC  HL F LCS+Y P C       +  CR +CE+ +  C PI++     WP+ L+CS+ P ++     CM         PS+   +   +       +   + + +    R  C    N  K+  + ++  CA  C+   + ++S++ K  A +W+ + + L F S+ FT +TF  +  R RYPE+PIIFL+  Y +YS+  ++RLF G E ++CD D  SGQ  +IQEGLE+T C + FL+ ++F  A+ +WW++L L W L         ++  NS  FHL  W + +V T+ +L++R V  DEL G+C VG    + L  F ++P    L+IG  F+LSGF    +  ++       +  K+  L+    R+G+FS++Y +    +I C  Y+  N  YW              ++ P          V VF++K  M  VVGI S +W+ +  ++ +W+
Sbjct:   22 ISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQEHPLKDGGPGRAGCD---NPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRD--SGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVAL-FHIRRVMKTGGENTDKLEKLM---VRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQ 533          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 211.46 bits (537), Expect = 1.033e-59
Identity = 150/508 (29.53%), Postives = 243/508 (47.83%), Query Frame = 1
Query:  157 IAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFP-LESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNG-----EKYVFI----------NRTGR---CALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA-------PIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            I +  C+   YN T +    + D + E  + +  +  L+   CS  L F LCS+Y P C  D    L PCR VCE+ +  C P+++    +WPE+++C R P L    ++ CM  ++ E        ++                 G+C           E +V I           RTG+   CA+ C +  F S + +T A  W+ + + L F+ST  T  TF  +  R RYPE+PIIFL+  Y   S+  L+RL +G   V+C  +       +  E      C + FLL +FF  A+ +WW++L L W L   +     ++A  +  FHL  WL+ SV +++ L L SVD D + G+C VG Q  + L  F + P ++ L++G +FLL+GF    +R +    +      K+  L+    R+G+F+++Y +  + ++ C LY+ +    W  A       P     R      V +LK+FM  VVGI S +WI S  ++ +W++
Sbjct:   36 ITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSE--ATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSF-SPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSRE----HSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSL-FRIRSVIKQGGTKTDKLEKLM---IRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRR 532          
BLAST of Frizzled-4 vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 211.46 bits (537), Expect = 1.033e-59
Identity = 150/508 (29.53%), Postives = 243/508 (47.83%), Query Frame = 1
Query:  157 IAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFP-LESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNG-----EKYVFI----------NRTGR---CALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA-------PIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            I +  C+   YN T +    + D + E  + +  +  L+   CS  L F LCS+Y P C  D    L PCR VCE+ +  C P+++    +WPE+++C R P L    ++ CM  ++ E        ++                 G+C           E +V I           RTG+   CA+ C +  F S + +T A  W+ + + L F+ST  T  TF  +  R RYPE+PIIFL+  Y   S+  L+RL +G   V+C  +       +  E      C + FLL +FF  A+ +WW++L L W L   +     ++A  +  FHL  WL+ SV +++ L L SVD D + G+C VG Q  + L  F + P ++ L++G +FLL+GF    +R +    +      K+  L+    R+G+F+++Y +  + ++ C LY+ +    W  A       P     R      V +LK+FM  VVGI S +WI S  ++ +W++
Sbjct:   36 ITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSE--ATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSF-SPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSRE----HSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSL-FRIRSVIKQGGTKTDKLEKLM---IRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRR 532          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q9ULV1|FZD4_HUMAN (Frizzled-4 OS=Homo sapiens OX=9606 GN=FZD4 PE=1 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 1.060e-97
Identity = 188/514 (36.58%), Postives = 286/514 (55.64%), Query Frame = 1
Query:  130 ENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH-PSQEE-NLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHM-RNGEKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNS 1644
            + E+ +  PI I  CQN  YN T +      + + + ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  CEP+LK    +WPE LNCS+FP ++ H   CM  P  EE  L  K  IQ             P +   +C  +  N ++Y+++ R+  C LKC  +   +S+ +K   +IWM V  SL F+ST FT +TF   + R  YPE+PIIFL+  YNIYSI+ ++RL +GRE++SCDF+  + + +LIQEGL+NT CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDADEL GLC VG Q  D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  Y+  N+     A  ++S   D+ +AV +LK FM+ +VGI S +WI S  ++  W+KC   L+      ++ + N 
Sbjct:   39 DEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQ-------------PGE---ECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYEISNW-----ALFRYSA-DDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNG 525          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q9QZH0|FZD4_RAT (Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.815e-97
Identity = 187/514 (36.38%), Postives = 287/514 (55.84%), Query Frame = 1
Query:  130 ENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH-PSQEE-NLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHM-RNGEKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNS 1644
            + E+ +  PI I  CQN  YN T +      + + + ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  CEP+LK    +WP+ LNCS+FP ++ H   CM  P  EE  L  K  IQ             P +   +C  +  N ++Y+++ R+  C LKC  +   +S+ +K   +IWM V  SL F+ST FT +TF   + R  YPE+PIIFL+  YNIYSI+ ++RL +GRE++SCDF+  + + +LIQEGL+NT CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDADEL GLC VG Q+ D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  Y+  N+     A  ++S   D+ +AV +LK FM+ +VGI S +WI S  ++  W+KC   L+      ++ + N 
Sbjct:   40 DEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQ-------------PGE---ECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQSLDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYEISNW-----ALFRYSA-DDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNG 526          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q9IA05|FZD4_CHICK (Frizzled-4 OS=Gallus gallus OX=9031 GN=FZD4 PE=1 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 4.058e-97
Identity = 185/496 (37.30%), Postives = 279/496 (56.25%), Query Frame = 1
Query:  130 ENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH-PSQEE-NLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHM-RNGEKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKC 1590
            + E+ +   I I  CQN  YN T +      + +A+ ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  CEP+LK    +WP+ LNCS+FP ++ H   CM  P  EE  L  K  +Q             P +   +C  M  N ++Y+++ R   C LKC  +   +S+ +K   +IWM V  SL F+ST FT +TF   + R  YPE+PIIFL+  YNIYSI+ ++RL +GRE++SCDF+  + + +LIQEGL+NT CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDADEL GLC VG Q  D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  Y+  N+     A  ++S   D+ +AV +LK FM+ +VGI S +WI S  ++  W+KC
Sbjct:   27 DEEERRCDAIRIAMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLHSKTSLQ-------------PGE---ECHSMGSNSDQYIWVKRNLDCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYEISNW-----AVFRYSA-DDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKC 495          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q61088|FZD4_MOUSE (Frizzled-4 OS=Mus musculus OX=10090 GN=Fzd4 PE=1 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 4.949e-97
Identity = 186/514 (36.19%), Postives = 286/514 (55.64%), Query Frame = 1
Query:  130 ENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH-PSQEE-NLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHM-RNGEKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNS 1644
            + E+ +  PI I  CQN  YN T +      + + + ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  CEP+L+    +WP+ LNCS+FP ++ H   CM  P  EE  L  K  IQ             P +   +C  +  N ++Y+++ R+  C LKC  +   +S+ +K   +IWM V  SL F+ST FT +TF   + R  YPE+PIIFL+  YNIYSI+ ++RL +GRE++SCDF+  + + +LIQEGL+NT CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDADEL GLC VG Q  D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  Y+  N+     A  ++S   D+ +AV +LK FM+ +VGI S +WI S  ++  W+KC   L+      ++ + N 
Sbjct:   39 DEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLREFGFAWPDTLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQ-------------PGE---ECHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA-EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYEISNW-----ALFRYSA-DDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNG 525          
BLAST of Frizzled-4 vs. UniProt/SwissProt
Match: sp|Q9PT62|FZD4_XENLA (Frizzled-4 OS=Xenopus laevis OX=8355 GN=fzd4 PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 4.390e-95
Identity = 181/511 (35.42%), Postives = 280/511 (54.79%), Query Frame = 1
Query:  130 ENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTF-CHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNS 1644
            E E+    PI I  CQN  YN T +      + +A+ ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  CEP+LK    +WPE LNCS+FP ++ H   CM    ++ +    +   L   +D N+               N ++Y ++ R+  C LKC  ++  +++ SK   +IWM V  SL F+ST FT +TF   + R  YPE+PIIFL+  YNIYSI+ ++RL +GRE++SCDF+  + + +LIQEGL+NT CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDADEL GLC VG Q  D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  Y+  N++ +           D+ +AV +L  FM+ +VGI S +WI S  ++  W+KC   L+      +K + + 
Sbjct:   25 EEEERSCDPIRITMCQNLGYNVTKMPNLVGHELQADAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDDEVPAHSKTPVLP-GEDCNSFGP------------NSDQYTWVKRSMNCVLKCGYDSGLYNRLSKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFCYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEE-AAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNIDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYEVSNWNVFRYT------ADDSNMAVEMLNIFMSLLVGITSGMWIWSAKTLHTWQKCTNRLVNSGKVKRKKRVDG 511          
BLAST of Frizzled-4 vs. TrEMBL
Match: T1DBJ6 (Fzd-4-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1062.37 bits (2746), Expect = 0.000e+0
Identity = 551/551 (100.00%), Postives = 551/551 (100.00%), Query Frame = 1
Query:   67 MIKLPPVNICLFLLISIVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSNKYWLYCKSGN 1719
            MIKLPPVNICLFLLISIVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQLICLIIGFIFLLSGFFFFKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSIIYIIAIATMICCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSNKYWLYCKSGN
Sbjct:    1 MIKLPPVNICLFLLISIVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQLICLIIGFIFLLSGFFFFKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSIIYIIAIATMICCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSNKYWLYCKSGN 551          
BLAST of Frizzled-4 vs. TrEMBL
Match: T1E111 (Fzd-4-3b OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 295/501 (58.88%), Postives = 370/501 (73.85%), Query Frame = 1
Query:  115 IVDSIENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCM-HPSQEENLQRK-IQIQNLSLNKDRN--NIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCF 1593
            I+  +   KCKP+ I   QC++KFY +TSL     QDQE ++QI ++T+R LL++ CS  LNFLLCSVY P CD +  I L PC  +CEKVQ +CEPILK+ NL WP  LNCSRFP +S+ ++ CM +P  +    R  +Q+ N+ +NK+    NIH      G+CRH+R+ EKYVFINRTG+CALKCSEND FS+ESK  AE+WM V+  +TF+STLFTC+TFCH+ +I+YPEQPIIFLT SYN+YS+S+LLRLF  R  VSCD+DPVSGQ ILIQEGLENT CAITFLLNFFF+ ATH+WW+ L  CW L+    VS+ +L  N+G FHLFVWL TS+LTVS+LILR V+ADEL G+CSVG Q+P+LL+TFSIIP+ ICLI+G + L  GF F K R KK  NK+    + IT + S+ FR+G+FS IYI+AI+  I CELYQY NY+ W RAP  F   K+ IVA+FLL  FM QVVGINSAIWI SLD+  +WK  F
Sbjct:   23 ILSVVTTRKCKPQIIRAEQCRDKFYKYTSLPNLMGQDQEMDIQIQMDTFRPLLNHKCSNELNFLLCSVYTPICDPEAEILLGPCAGICEKVQTECEPILKIFNLPWPSGLNCSRFPSQSTPELMCMSNPVFDSRSTRNPLQLFNV-VNKEGFVFNIHH-----GRCRHLRHSEKYVFINRTGKCALKCSENDLFSQESKRFAEMWMSVLAVITFLSTLFTCMTFCHSNKIKYPEQPIIFLTLSYNLYSVSLLLRLFFTRSTVSCDYDPVSGQYILIQEGLENTYCAITFLLNFFFNIATHIWWVTLTSCWMLYSVFKVSSFNLKINAGYFHLFVWLSTSMLTVSILILRCVEADELLGICSVGGQSPELLMTFSIIPKSICLIVGTLLLCLGFLFLKTR-KKTINKNGKKIRSITHITSVAFRMGIFSGIYILAISIHIVCELYQYINYNIWRRAPQIFRDIKEPIVAIFLLNIFMGQVVGINSAIWIWSLDAATSWKSVF 516          
BLAST of Frizzled-4 vs. TrEMBL
Match: T1D142 (Fzd-4-3a (Fragment) OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 9.562e-155
Identity = 263/537 (48.98%), Postives = 347/537 (64.62%), Query Frame = 1
Query:  136 EKCKPKPIAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQ------YRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKF-SNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSNKYWLYCKS 1713
             KC P+ I + QC+++FY +T      S +Q   +   I+ Y SLL   CSK L FLLCS   PFCD ++ + +  C   C+ VQ +C   +KL+NLSWP++LNCS+FP+E+  + +C+   +    +R++ + +  + +   NI+E         Y  +C H+R+ EKY+FINRTGRCALKCSEND FS+  K +AEIWM  +  LTF+ST+FTC+T CHN +I+YPEQPIIFLTFSYN+YS+S+LLRLF  R  VSCDFD V+ Q ILIQEGLENT+CAITFLLN+FFSTATH+WW+ L  CW L+    VS  +L  NSG FHLFVWL TS+LTV+VL+LR V+ADEL G+CSVG Q+PD L+TFSIIP+L+CLI+G   L  GF F K   +K  SN         +    +  R+GLFS IY+ A    I CE YQY NY  W             +VA+FLL  FMNQ+VGINS++WI SLD+  +W+K F  L       K     +++ E   + NS  S+K   Y KS
Sbjct:   30 RKCIPQLIKVKQCRSQFYKYTHSQNLTSLNQVKNIDSEIDKYLSLLKGKCSKDLLFLLCSNLTPFCDPNSKLLVPLCGTTCKNVQKECGFEIKLLNLSWPKELNCSQFPIENEPKSRCISIPR---FERQVPLNSKEIVETFTNINEKLFVNRNLFYLKKCGHLRHSEKYIFINRTGRCALKCSENDLFSRRMKKVAEIWMSSLAVLTFLSTMFTCLTCCHNSKIKYPEQPIIFLTFSYNLYSVSLLLRLFFTRSIVSCDFDQVTNQYILIQEGLENTHCAITFLLNYFFSTATHIWWVALTFCWMLYNVFKVSVSNLTNNSGYFHLFVWLPTSMLTVTVLVLRCVEADELLGVCSVGGQSPDRLMTFSIIPKLVCLILGMFLLFVGFIFLKPEEEKMKSNSQNIFRWSTSSTSKVSCRIGLFSCIYVTATFISIVCEFYQYVNYVRWKIQLKIEESTAQPLVAIFLLNIFMNQIVGINSSVWIFSLDAAKSWRKFFATLKSLCAKKKHKNLMNKQKEINQKTNSNESSKLCTYTKS 563          
BLAST of Frizzled-4 vs. TrEMBL
Match: T1E1E8 (Fzd-4-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 7.168e-119
Identity = 224/554 (40.43%), Postives = 326/554 (58.84%), Query Frame = 1
Query:  121 DSIENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCM-HPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLL------------EKVTFNKKI---KSNSREIESYGQLNSTNSNKYWLYCKSGN 1719
            D I+ +KC+PK I + +CQ+ FYNFT++    + + + E Q  + T++SL+   CS  L F LC+VY+P CD ++   + PCR +CE+V+  CE I+K  +LSWP  LNCSRFP  ++    CM  P   E ++                     + +  C  M+N   +V+INRT +C  KC  N  F+ + K IA+IW+ V++SL F+S++FT +TF  N  R +YPE+P+IFL   Y++YS+S  +RL   R+  SC+ DPV+GQ IL QEGLENT CAI FLLN+FF+ A+ +WW++L L W L      S  ++ + SG FHLF WL++S+LTVSVL+LRSVDADEL GLCSVG+QT   LL F IIP +I L+IG +FLLSG      R ++          K+  L+    R+GLFS++++I  +T++ C +Y+Y N  +W       +      + +F+LK FM  VVGI S +W+ S+ ++ +WK  FV+ L            +K  FNK I    + SRE  +    N+ N       C SGN
Sbjct:   35 DPIQTKKCQPKRIIVQECQHLFYNFTAMPNLINHETQIEAQTQLLTFQSLIKYKCSAKLLFFLCAVYIPMCDPNSHYLIGPCRPLCEEVRDSCEKIMKPFSLSWPVNLNCSRFPKSNTEGSMCMVGPGPSEKVE---------------------EVKVNCEKMKNPSSFVYINRTQKCVPKCMANILFNSDDKYIAKIWLAVLSSLCFISSMFTILTFLINTDRFKYPERPVIFLAVCYSLYSVSHFIRLLHNRKGSSCNRDPVTGQYILTQEGLENTMCAIIFLLNYFFAIASQIWWVILTLTWLLAAGFKWSEEAIYQRSGYFHLFAWLISSLLTVSVLVLRSVDADELLGLCSVGQQTASSLLIFVIIPNIIFLVIGCMFLLSGLIAL-VRVRRHVKNDGIKTDKLEILM---VRIGLFSVLFLIPSSTVLACNIYEYVNKDFW------LTSGTTPNIEIFMLKIFMASVVGITSGVWVWSIKTLDSWKWFFVVKLCRRQPSRSVIENKKNNFNKTIGYMPATSRENIALEANNNRN-------CWSGN 550          
BLAST of Frizzled-4 vs. TrEMBL
Match: T1D110 (Fzd-4-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 2.406e-114
Identity = 199/495 (40.20%), Postives = 302/495 (61.01%), Query Frame = 1
Query:  115 IVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQ----DQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            +++ ++  KC PK I + +CQN FYNFT +      + + E Q  ++T++SL+   CS++L F LCSVY+P CD  +   + PC+ +CE+V+  CE I++  NL WP  LNCSRFP+ ++    CM                        ++   + ++  C  M+N   ++FINRT +C  KCS N  F+ + K IA+IW+ V+ SL F+S++FT +TF  N  R +YPE+P+IFL   Y+IYS+S  + L   R+  +C+ DPVSGQ IL QEGL+NT CAI FLLNFFFSTA+ +WW++L + W L      S  ++ + SG FHL  WL++S+LTV+VL+LRSVDADEL GLCSVG+Q    LL F IIP +I L+IG  FLL G      R ++         +K+  L+    R+GLFS+++++  +T++ C  Y+Y N  +W ++        +  + V++LK FM+ VVGI S +W+ S+ ++ +W+
Sbjct:   37 VLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPVRNAEGSMCMEGPGP-------------------SVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIFVIIPNIIFLVIGCFFLLGGLVAL-VRVRRHVKNDGIKTEKLEILM---VRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 502          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: fzd4 (frizzled class receptor 4 [Source:NCBI gene;Acc:103039803])

HSP 1 Score: 282.722 bits (722), Expect = 3.904e-87
Identity = 166/500 (33.20%), Postives = 267/500 (53.40%), Query Frame = 1
Query:  133 NEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNG--EKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFC-HNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLE 1608
            +E  + +PI +  C +  YN T +        +A+ ++ ++T+  L+  GCS  L F LC+VY P C     + + PC  +C  V+  C P+L+     WPE LNCS FP  +     CM    E++L           NK      E      +C  M  G  E+Y +  R+G C L+C  E+  + +++K   ++WM V   L F+ST FT +TF   + R  YPE+PI+FL+  YN+YS++ L+RL  GRE++SCD D  +   +L QEGL+NT CA+ FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +V T+ +LI+R VDAD+L GLC VG Q  D L  F + P    L+IG +F+ +G     ++ +    K      K+  L+    ++G+FS++Y +    +I C  YQ  N+  + +        +D+ +A  +L+ FM+ +VGI   +W+ S  ++  W++C + LL 
Sbjct:   27 DEDARCEPIRMAMCLDLGYNQTRMPNLVGNVLQADAELQLQTFTPLIQYGCSSQLKFFLCAVYAPMCTEKVPVTIGPCGSMCLAVKRKCLPVLQEFGFVWPELLNCSLFPPTNDQNHMCMEGPAEDDL--------FHPNKPVAPHEE------ECVTMGGGGPEQYAWAKRSGSCVLQCGYESGLYRRQAKMFTDVWMAVWAVLCFISTSFTVLTFLLDSARFSYPERPIMFLSMCYNVYSVAFLVRLTAGRERISCDLDEAA-VPVLAQEGLKNTGCAVVFLLAYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADDLTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSVLYTVPATCVIACYFYQISNWADFHQ------TARDSYMAAEMLRIFMSLLVGITCGMWVWSAKTLHTWQRCSLRLLH 501          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 271.937 bits (694), Expect = 2.427e-82
Identity = 170/520 (32.69%), Postives = 267/520 (51.35%), Query Frame = 1
Query:  103 LLISIVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQ----DQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDR-----NNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWS-RAP----IKFSKRKD---------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            L I   D       K +PI I  CQ   YN T +      + + E  I +  +  L+  GC  HL F LCS+YVP C       +  CR +C + +  C PI++  +  WP+ L+CS+ P  +     C+   + + +    + + +     R          P    G C    N EK+ ++ ++  CA +CS   + F+S++ K  A IWM V ++L FVST FT +TF  + +R +YPE+PIIFL+  YN+YS++ ++R   G E ++CD +  +GQ  +IQEGLE+T C I FL+ ++F  A+ +WW++L L W L         ++  +S  FH+  W + ++ T+ +L +R V  DEL GLC VG    + L  F IIP    LIIG  F+L+GF    +  +K       + +K+  L+    ++G+FSI+Y +    +I C  Y+  N  YW  RA     + F  R+            VAVF+LK FM+ VVGI S +W+ S  ++  W+
Sbjct:   36 LDIGAYDGERGRPAKCEPITIPMCQGIGYNMTRMPNFMKYESQEEASIKLNEFAPLVEYGCDVHLRFFLCSLYVPMCTDQVSTTIPACRAMCVQARQKCSPIMEQFSFGWPDSLDCSKLPTNNDPNALCIEAPENDTVPPTKKGEGMLPVPARPRPPGTGAGRPSGGSGSCE---NHEKFQYVEKSESCAPRCSPTVDVFWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRE--NGQLYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMVAWGIPAMKTIVILTMRKVAGDELTGLCYVGSMDTNALTGFIIIPLSCYLIIGTSFILTGFVAL-FHIRKIMKTGGTNTEKLEKLM---VKIGVFSILYTVPATCVIICYFYERLNMDYWKFRASESKCVSFPGRRTEDCTLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQ 546          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: fzd9b (frizzled-9 [Source:NCBI gene;Acc:103027133])

HSP 1 Score: 268.47 bits (685), Expect = 4.067e-81
Identity = 163/515 (31.65%), Postives = 267/515 (51.84%), Query Frame = 1
Query:  118 VDSIENEKCKP---KPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNL--SLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYW-----SRAPIKFSKRKD---------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            + S + E+ +P   +PI I  CQ   YN T +      D + E  I +  +  L+  GC  HL F LCS+Y P C       +  CR +CE+ +  C PI++  N +WPE L+CS+ P  +     CM   + +      + + +     + R       +  G      N EK+ ++ ++  CA +CS   + F+S++ K  A IWM V ++L FVST FT +TF  +  R +YPE+PIIFL+  YN+YS++ ++R   G E ++CD +  +G+  +IQEGLE+T C I FL+ ++F  A+ +WW++L L W L         ++  +S  FH+  W + ++ T+ +L +R V  DEL GLC VG      L  F ++P    L++G  F+L+GF    +  +K       + +K+  L+    ++G++SI+Y +    +I C  Y+  N  YW         + F  R++           VAVF+LK FM+ VVGI S +W+ S  ++  W+
Sbjct:   29 IGSYDFERGRPAKCEPIVIPMCQGIGYNLTRMPNFMDHDSQKEAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQRCSPIMEKFNYAWPESLDCSKLPTRNDPNALCMEAPENDTKPEPKKGEGMLPVPPRPRQPGSGGGRPGGSVGACENPEKFQYVEKSESCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRE--NGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSFYLVVGTSFVLTGFVAL-FHIRKVMKTEGTNTEKLEKLM---VKIGIYSILYTVPATCVIVCYFYERLNMDYWKFRGLESKCVTFPGRRNEDCSLDASMPAVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQ 537          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: fzd10 (frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GENE-990415-220])

HSP 1 Score: 252.677 bits (644), Expect = 8.266e-76
Identity = 159/483 (32.92%), Postives = 250/483 (51.76%), Query Frame = 1
Query:  202 LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHP----SQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKC-SEND-FFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIK------------FSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCF 1593
            +  + + E  I +  +  L+  GC  HL F LCS+Y P C       +  CR +CE+ +  C PI++  N  WP+ L+CSR P ++     CM      S + +     Q  +    +  N+   P + R       N  K+ F+ ++  CA KC S+ D ++S   K  + +W+ + + L F+S+ FT +TF  + +R +YPE+PIIFL+ SY +YS+  L+RLF+G E V+CD D  SG + +IQEGLE+T C I FL+ ++F  A+ +WW++L L W L         ++  NS  FHL  W + ++ T+ +L++R V  DEL G+C VG      L  F +IP    LIIG  FLLSGF    +  +K       +  K+  L+    R+G+FS++Y +    +I C  Y+  N  YW     +              K     V +F++K FM  VVGI S +WI +  ++ +W+  F
Sbjct:    5 MGHEDQGEAAIKLHEFAPLIEFGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARQKCSPIMEQFNFHWPDSLDCSRLPNKNDPNFLCMEAPNNGSDDTSKGSHTQPPDSRPPRSGNSQELPVKERMGKDTCGNPGKFHFVQKSESCAPKCYSKVDVYWSHADKRFSLVWIAIWSILCFISSAFTVLTFLIDPQRFKYPERPIIFLSMSYCVYSVGYLIRLFVGAENVACDRD--SGVQYVIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAIKTILILVMRRVAGDELTGVCYVGSMDVKALTGFVLIPLSCYLIIGTSFLLSGFVAL-FHIRKVMKTEGENTDKLEKLM---VRIGVFSVLYTVPATCVIACYFYERLNMDYWKVLAGEQRCLEGGGGEECMMKSSIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVF 481          
BLAST of Frizzled-4 vs. Ensembl Cavefish
Match: ENSAMXT00000026985.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:27065879:27070162:-1 gene:ENSAMXG00000026259.2 transcript:ENSAMXT00000026985.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.172 bits (570), Expect = 1.315e-64
Identity = 154/505 (30.50%), Postives = 252/505 (49.90%), Query Frame = 1
Query:  151 KPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQ-----RKIQIQNLSLNKDRNNIHEPKQYRGQCRHMR-----NGEKYVFINR--TG---RCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA---PIKFSKRKDAI---VAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            +PI +  C+   YN T +    + D + EV + +  +  L+   CS  L F LCS+Y P C  D    L PCR VCE+ +  C P++      WPE+++C + P+       CM  +  E         K   +  S ++  +    P++   +CR          E +   NR  TG    CAL C +  +FS++ +     W+ + + L FVSTL T  TF  +  R +YPE+PIIFL   Y   S+  ++RL  G EKV+C       Q+ ++ +      C + FLL +FF  A+ +WW++L   W L   +     ++A  S  FHL  WL+ SV +++VL L SVD D + G+C VG Q+ + L  F + P ++ L  G +FLL+GF    +R +    +      K+  L+    R+GLF+++Y +    ++ C +Y+ +    W +A        +++  +    AVF+LK+FM  VVGI S +WI S  ++ +W++
Sbjct:   38 EPITVPMCKGIGYNLTYMPNQFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPICLPDYKKPLPPCRSVCERAKRGCSPLMIQYGFEWPERMSCEQLPMLGDPDRLCMDQNSSETTTLSPSFPKPTPRGSSRHRATSKSAVPQKCDRECRCREPLVPIKKESHPLYNRVQTGSLPNCALPCHQ-PYFSQDERAFTTFWIGLWSVLCFVSTLTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIVRLLAGHEKVACGGS--GDQRHILYDTTGPALCTLVFLLIYFFGMASSIWWVVLSFTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLESLRGFVLAPLVVYLFSGSLFLLAGFVSL-FRIRSVIKQGGTKTDKLEKLM---IRIGLFTVLYTVPATIVVACLVYEQHYRPEWEQALGCSCASERQQQGLGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRR 535          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011009.1 (pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gene:ENSPMAG00000009982.1 transcript:ENSPMAT00000011009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.024 bits (580), Expect = 1.392e-66
Identity = 155/520 (29.81%), Postives = 254/520 (48.85%), Query Frame = 1
Query:  157 IAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNL----SLNKDRNNI--------------HEPKQYRGQCRHMR---NGEKYVFINR--TG---RCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKD------------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            I +  C+   YN T +    + D + E  + +  +  L+   CS  L F LCS+Y P C  D    L PCR VCE+ +  C P+++    +WP+++ C R P+       CM  ++ +   +  +++      S N  +N                 E  +    CR        +++   NR  TG    CA+ C  + +F+++ +T A  W+ + + L FVST  T VTF  +  R +YPE+PIIFL+  Y   S+  ++RL +G + V C+ +     + +  E      C + FLL +FF  A+ +WW++L L W +   +  S+ ++A  S  +HL  WL+ SV +V+VL   SVDAD L G+CSVG Q+ + L  F ++P  + L +G +FLL+GF            +      K+  L+    R+G+FS++Y +    ++ C  Y+  +   W+RA I  S + D                +F+LK+FM  VVGI S +WI S  +V  WK+
Sbjct:   12 ITVPMCRGIGYNHTYMPNDFNHDSQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKQPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPVLGDQNRLCMDYNKSDTTPQPPEVKPTAPVRSFNPSKNRATTRVGGGGGGGGGSGEACESGCACRAPMVAIGSDRHPLYNRVRTGSVLNCAMPC-HDPYFTQDERTFASFWIGLWSILCFVSTFTTVVTFLIDMERFKYPERPIIFLSACYAFVSMGYIVRLVVGHDGVICNQE----HRHVHYETTGPALCTVVFLLTYFFGMASSIWWVILSLTWFMAAGMKWSSEAIAGYSQYYHLAAWLLPSVQSVAVLATSSVDADPLAGICSVGAQSLENLRGFVLVPLTVYLCVGAVFLLAGFTSLVRIRNAIKQQGGTKTDKLEKLM---VRIGIFSMLYTVPAIAVVACYFYEERSRDGWARALICPSCQGDEEPGSQQQQQQRPDYGIFMLKYFMCLVVGITSGVWIWSGKTVDTWKR 523          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 183.726 bits (465), Expect = 1.607e-50
Identity = 142/539 (26.35%), Postives = 240/539 (44.53%), Query Frame = 1
Query:  151 KPIAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRG---------------------------QCRHMRNGEKYVFINRTGR--CALKCSEND-----FFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAI-------------VAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEK 1611
            +PI+I  C +  YN T     L    + +  + +  +  L+   CS  L F LCS+Y P C       + PCR +CE+ +  CE ++      WPE+L C  FP++ S  + C+  +  +         +       ++   P  YR                             C H+     Y+     G+  C   C  +      +F  +    A +W+ V + L   STLFT +T+  +  R RYPE+PIIFL+  Y + SI+ ++  F   EK+ C+         ++Q G +   C I F++ +FFS A+ +WW++L L W L   +     ++  NS  FHL  W + ++ T+++L +  VD D L G+C VG  + D L  F + P  + L IG  FLL+GF    +R +          +K+  L+    R+G+FS++Y +    +I C  Y+      W ++ +  + +  A+               VF++K+ M  +VGI S  WI S  ++ +W+  +  L  K
Sbjct:   58 QPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVLEE-AIPPCRSLCERARQGCETLMNKFGFQWPERLRCENFPVQGSENI-CVGQNHTDEKGGHPTPPDPHPIPHGDSFTLPPHYRPGGPSSGGGIGGGGGGGASGGDSSSYQLTCPHVLRVPSYLNYQFLGKKECGSPCEPSKSNGLMYFDADELWFARMWVGVWSILCCASTLFTVLTYLVDMERFRYPERPIIFLSGCYAVVSIAYIVGFFF-EEKIVCNKFFEDSYSTVVQ-GTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGLNSIDALRGFVLAPLFVYLFIGTSFLLAGFVSL-FRIRTIMKHDGTKTEKLEKLM---VRIGIFSVLYTVPATIVIACYFYEQAFRAQWEKSWVAHTCKSFAVQCPQGHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGKTLQSWRNFYSRLSNK 588          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 180.644 bits (457), Expect = 9.992e-50
Identity = 141/524 (26.91%), Postives = 235/524 (44.85%), Query Frame = 1
Query:  151 KPIAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQM-----------QCMHPSQEENLQRKIQIQNLSLNKDRNNIH----EPKQYRGQCRHMRNGEKYVFIN--RTGRCALKCSEND-----FFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAI-------------VAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVML 1602
            +PI+I  C +  YN T     L    + +  + +  +  L+   CS  L F LCS+Y P C       + PCR +C++ +  CE ++      WPE+L C  FP++ S ++               P         +         D   IH      + +   C  +     Y+     R   CA  C         +FS+E    + +W+ + + L   STLFT  T+  + +R RYPE+PIIFL+  Y + +++ +   FL  +KV C+          + +G +   C I F+L +FFS A+ +WW++L L W L   +     ++  NS  FHL  W + +V T+++L +  VD D L G+C VG  +   L  F + P  + L +G  FLL+GF    +R +          +K+  L+    R+G+FS++Y +    +I C  Y+      W +  +  S +  AI               VF++K+ M  +VGI S  WI S  ++ +W+K +  L
Sbjct:   14 QPISIPLCTDIPYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCTVLEK-AIPPCRSLCDRARQGCEALMNKFGFQWPERLRCENFPVQGSDEICVGQNHTDKAGPTALPPTPPGGGGGVIGGIGGGAGDFVTIHTRRPPGRTHPFMCPRVLKVPPYLNAQLFRERNCAAPCEPKKPNGLMYFSEEELRFSRLWVGIWSVLCCASTLFTVTTYLVDMQRFRYPERPIIFLSGCYFMVAVAYVAG-FLLDDKVVCNEQFSEDIYRTVTQGTKKEGCTILFMLIYFFSMASSIWWVVLALTWFLAAGMKWGHEAIEANSQYFHLAAWAIPAVKTITILAMGLVDGDMLSGVCFVGISSVAALRGFVLAPLFVYLFLGTSFLLAGFVSL-FRIRTIMKHDGTKTEKLEKLM---VRIGIFSVLYTVPATIVIACYFYEQAFREQWEKTWVSQSCKGFAIPCPLNHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTKL 531          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 149.828 bits (377), Expect = 4.818e-40
Identity = 103/337 (30.56%), Postives = 167/337 (49.55%), Query Frame = 1
Query:  628 RTGR---CALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXX-XXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPI------------KFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            RTG+   CA  C  + F  +E +T A  W+ + +SL F +T  T  TF  +  R +YPE+PIIFL+    + S+  ++R+  G E V+C  D       ++        C   FLL +FF  A  +WW++L L W +   L   + ++A  S  +HL  WL+ S+  ++ L + +VD D + G+CSVG Q+ D L  F + P +  L++G    L      F+ R    +N      +K+  L+    R+G+F+++Y +  A  + C LY+  +   W R  +            +   R D   AVF+LK+F+  V GI S  WI S  +  +WK+
Sbjct:   26 RTGQVRNCATPC-HSPFLGREQRTFASFWIGLWSSLCFAATFATVSTFLIDMERFKYPERPIIFLSLCCMLASLGYIVRMVAGHEAVACSAD----WHHVLYASSGPALCTAVFLLTYFFGMAGCVWWVILSLTWFMAAGLKWGSEAIAGYSQYYHLAAWLLPSIKAIAALAMNAVDGDPVAGICSVGNQSLDNLRGFVLAPLVAYLLVGTAFLLAGLVALFRIRNAISANPGGAKTEKLERLM---VRIGVFAVLYTVPAAVAVVCHLYEQQHRDSWERTLVCGACGPGPGHLPEPGARPD--FAVFMLKYFVCLVGGITSGAWIWSGKTAGSWKR 352          
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Match: smo (smoothened, frizzled class receptor [Source:ZFIN;Acc:ZDB-GENE-980526-89])

HSP 1 Score: 100.908 bits (250), Expect = 1.202e-22
Identity = 104/457 (22.76%), Postives = 187/457 (40.92%), Query Frame = 1
Query:  136 EKC-KP---KPIAIGQCQNKFYNFTS----LSQDQEA--EVQIPIETYRSLLS-NGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNC--SRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN--RRIRYPEQPIIFLTFSYNIYSISILLR-LFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTL-FCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA 1455
            E+C +P   +P+A   C      +      L+ D  +  + Q  ++ +  L S   C + +  LLC+VY+P C    G    P R +C   +  C  + +  +  WP+ L+C   RFP    + +Q +H +   +    +                          +R      ++     C L CS +  ++ E           + +L  +S +FT  TF  +  R  RYP   I ++   + + S   L + L   R+ ++C  D     ++      E  +C I F+L ++   A   W++ L   W   F AL      LA+ +  FHL  W +  VLTV++L L+ VD D + G+C VG + P     F + P +    +   + L+   F  +R ++ S+  L   +  T +     RLG+F ++    +     C +Y + +   W R+
Sbjct:    1 ERCVRPAACEPLAYSSCLGAALPYAQTALVLASDSHSQHDAQANLQLWAGLRSVPRCWEVVQPLLCAVYMPRCS--AGAVELPSRALCHATRAPCAVVARTPH-GWPDFLSCQPERFPDGCPNTVQGVHFNTTSSCAAPL--------------------------VRTDNPASWVRDVEGCGLPCS-SPLYTAEEHAAMRTATAAMGALALLSEIFTLATFVGDWQRSRRYPAVVICYINACFLVASAGWLAQFLSDARQDITCRHD--GTPRVGEPTSSETLSCVIIFVLIYYPLMAAVCWFVCLAYAWNASFRALGTPQRPLARKTSYFHLACWSLPFVLTVAILALQQVDGDSMSGVCFVGYRDPHFRAGFVLAP-VGVATVAGGYYLACGMFTLFRIRR-SHPGLLSQKASTKIQETIVRLGVFGVLAWGFVLLTFGCHIYDFLHREQWQRS 423          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO30865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZJ6])

HSP 1 Score: 253.447 bits (646), Expect = 9.986e-77
Identity = 157/522 (30.08%), Postives = 256/522 (49.04%), Query Frame = 1
Query:  157 IAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSK-HLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSL-TFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVA-----VFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSN 1689
            I+I  C++  YN T +      + + E +  ++ +  L+  GC++  L F LCS Y P C     + +  CR +CE V+  C P+L    + WP  LNC+RF + ++ +  CM          K +     +N        P     QCR  +N + Y ++  T  CA++C+E+  F    K   +IW+ + +      +T+          R +YPE+ II+L   YN YS+S ++RL  GR+ +SCD DP +  K  IQ+GL NT CAI FL+ +FF  A  +WW++L L W L   +     ++   + +FH+  W++  + T+ +LI R VD DEL GLC VG Q    L  F + PQ   LIIG +FL++GF    +R +    +      K   L  +  R+G+FS++  +    +I C  Y+Y N  YW      +  ++D  VA     +F+LK FM+   G+ + +WI S  ++  W+  +        +    K   R++E  G  N+  + 
Sbjct:    7 ISIDLCRSVGYNVTRMPNLIGHETQKEAESQLKQFLPLIQYGCAREQLVFFLCSAYAPMCTDKVDVVITSCRPLCEYVRKSCLPVLTEFGIPWPNPLNCTRFLVRNNERNMCMPGPNFTESPEKPRPDFKPINDTTEK--PPSTGSEQCRRFKNSKNYFYVQSTESCAVRCNEDGIFKTSDKETMDIWITIWSIFCFISTTITLTTFLIETGRFKYPERSIIWLALCYNFYSLSYIIRLGAGRQAISCDTDPTTHVKFHIQDGLRNTGCAIVFLIQYFFCMAATIWWVVLALTWFLAAGMKWGCEAIGSYAKLFHIIAWILPCIKTIFILITRKVDGDELTGLCFVGNQDLIALAAFVLGPQFTYLIIGTLFLIAGFVAL-FRIRTTVQRG--GQAKTDKLERLIVRIGIFSVLSTVPATAVIACYFYEYANKEYW------YYGQRDGAVAEPNFSIFMLKVFMSLFTGVITGMWIWSHKTMNTWRAFY--------YKVSGKRPPRKLERNGNGNTNETT 509          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO38567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF4])

HSP 1 Score: 233.802 bits (595), Expect = 2.352e-68
Identity = 165/595 (27.73%), Postives = 285/595 (47.90%), Query Frame = 1
Query:   97 LFLLISIV-----DSIENEKCKPKPI----AIGQCQNKFYNFTSLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQ------CMH--------PSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFC-HNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGL---ENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWS-RAPIK-FSKRKDAI--------VAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSNKYWLYCKSGN*K*TEPHCNIFHPVLKS 1770
            LF+ +S +       + N KC P  I     IG    +F NF  L+Q+ + E    I  ++ L++  C+  L F LCSV+VP C  +  + +  CR +CE  +  C P+++    +WP+ L+C R P +   Q +      CM         P  E ++    +       K  N         G  R+     KY ++ +  +C  +C  +  FS  +K  A +W+ V + L F+ST  T +TF     R +YPE+PIIFL+  YN+YS+  ++R+  GR +V CD      +  +I+ G+   ++  C++ FLL ++F  A+ +WW++L   W L         ++ + +  FH   W + ++ T+  LI+R VDADEL GLC VG    + L  + + P  + L++G  FLL+GF    +R +        +  K+  L+    R+G+FS++Y I ++ +I C  Y+Y N   W  RAP   +  R D          + VF++K+FM  ++GI S +WI S  +  +W+K          ++K+    +++   Y   ++   N   ++    + +    H + F P+  S
Sbjct:   12 LFITVSAMVYGQRSEVPNSKCTPITIPLCMGIGYNATRFPNF--LAQESQEEAAKRIHEFKPLIAVNCAPLLRFFLCSVFVPMCTKEVNVPIYACRSMCESARDGCSPMMQRFGFNWPDTLDCDRLPKKGDPQAKSDPTKLCMAAPNIKQTAPLNESDIWSNFESLGPEFKKINNT--------GPLRY-----KYTYVEKYDQCVPQCKSDLMFSSNNKRFANVWISVWSVLCFISTAVTVLTFVIDTSRFKYPERPIIFLSLCYNLYSLGYIVRVTAGRNEVICD----ETESFVIRAGMNIADHACCSVVFLLLYYFGMASAVWWVVLTFAWFLAAGRKWGQEAIERKATYFHAVAWTVPAIQTIMALIMRKVDADELTGLCYVGNMDYENLANYVLTPLCLYLLVGTFFLLAGFVSL-FRIRTVLKNKETNTDKLEKLI---VRIGVFSVLYTIPVSAVIACSFYEYNNMDVWKVRAPFNTYICRGDQACLENYGPSIEVFIVKYFMLLIIGITSNMWIWSTKTFKSWRK---------FYSKRKGGEAKKKVDYSAGSAPPKNSLQVHMPPPSVQPVYHHTSAFAPIAPS 574          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 212.231 bits (539), Expect = 5.613e-61
Identity = 144/509 (28.29%), Postives = 250/509 (49.12%), Query Frame = 1
Query:  106 LISIVDSIENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCM-HPSQEENLQRKIQIQNLSLNKDRNNIH------EPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSK----RKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
             IS ++ +  ++ K + I I  C+   YN T +    + D +AE  + +  +  L+   CS  L F LCS+Y P C+      L PCR VCE+ +  C P+++    SWPE++ C  FP        CM   S  E+  +  Q    + + D   I        P       ++++   + + +    +CA+ C+   +F+ +  + A  W+ +   L F+STL T +TF  +  R +YPE+PIIFL+  Y + S+  ++RL  G ++++CD        ++  +     +C I FLL +FF  A+ +WW++L   W L   +  S+ ++   S  FH   WL+ ++  ++VL + ++D D + G+C VG      L+ F I+P ++ L+ G  FL++GF+      K           K+  L+    R+G+FS++Y +    ++ C  Y+  N   W R  I  S     R     +VF++K+FM  VVGI S  WI S  ++ +W+
Sbjct:   15 FISCLNYVLTKEMKCEEITIPMCRGIGYNLTYMPNMFNHDTQAEAALEVHQFWPLVEIQCSPDLRFFLCSMYAPLCEKHYDKDLPPCRSVCERARTGCAPLMRKYGFSWPERMKCENFPELGDENTLCMGRNSSGESTPKPSQSPQPAPSPDTAAISANCCSCRPPFVSIAGKNIKP-TRAISVGGVPQCAMACNRT-YFTHDQDSFASFWIGLWAILCFISTLVTTLTFLVDMHRFKYPERPIIFLSGCYLMVSVGYIIRLIAGHKQIACD-----SNGLMRYDTSGPASCTIVFLLVYFFGMASSVWWVILAFTWFLSAGMKWSSEAITNYSQYFHAVAWLVPAIQAIAVLAMSTIDGDPVSGICYVGNHNLQSLVVFVIVPLVVYLVFGTSFLMAGFYSLVRIRKLLRQHGSTKTDKLEKLM---IRIGVFSVLYTVPATIVVACYYYELVNRETWERT-INCSGCGVTRVKPDHSVFIIKYFMALVVGITSGFWIWSGKTIESWR 512          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 211.46 bits (537), Expect = 1.114e-60
Identity = 155/510 (30.39%), Postives = 244/510 (47.84%), Query Frame = 1
Query:  151 KPIAIGQCQNKFYNFT----SLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRN--GEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIV------------------------AVFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            +P+ I  C    YN T    +L    + E  + +  +  L+   CSK L F LCSVY P C       L PCR +C  V+  CE ++K    +WP+ L+C RFP        C+     EN       Q+  +N +     +    R +C   +    ++Y F +   RCA  C  N FF+K  + IA +W  +   L  VSTLFT +TF  + RR RYPE+PIIFL+  Y + SI+ +     G +K++C+     G    + +G ++  C + F++ +FFS A+ +WW++L + W L   L     ++  NS  FHL  W + +V T+++L++  VD DEL G+C VG      L  + + P  +  IIG  FLL+GF    +R +          +KI  L+    R+G+FSI+Y +    +I C  Y+  N   W  + I+  KR+                             VF++K+ M  +VGI S  WI S  ++ +W++
Sbjct:   30 EPVTIPLCTGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVCTV-LETPLPPCRSLCLTVRSGCEGLMKRFGFTWPDSLSCERFPKLGDEI--CVG----ENTTTPTSDQDGGINNNTYPDVDMSTMRYRCPESQKIPNDQYTF-HGEKRCAATC-RNVFFTKREREIARMWTGIWAILCAVSTLFTILTFLIDMRRFRYPERPIIFLSGCYFMVSIAFITGYVAG-DKIACNEPIKKGFPKTLVQGTKHEGCTVIFMMLYFFSMASSIWWVILTVTWFLAAGLKWGQEAIEANSQFFHLAAWAIPAVKTIAILLMTKVDGDELSGVCYVGLSDVSALRGYVLAPLFVYFIIGATFLLAGFISL-FRVRSVLKDDYSKREKIEKLM---IRIGVFSILYTVPALVVIGCLYYEQSNRELWDNSWIEGWKRQKKCTEVETKLKGEVSCPPYPVPLQKPDFMVFMVKYLMFLIVGITSGFWIWSSKTLNSWRR 525          
BLAST of Frizzled-4 vs. Ensembl Nematostella
Match: EDO40119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S829])

HSP 1 Score: 115.931 bits (289), Expect = 2.506e-27
Identity = 122/456 (26.75%), Postives = 202/456 (44.30%), Query Frame = 1
Query:  139 KCKP--KPIAIGQCQNKFYNFTSLSQDQEAEVQIP--IETYRSL-LSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDR------NNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRI--RYPEQPIIFLTFSYNIYSISILLRLFL-GREKVSCDFDPVSGQKILIQEGLENTN--CAITFLLNFFFSTATHMWWIMLCLCWTL-FCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA 1455
            KC+P  +   +G+  +  Y  T L  D  ++ Q+   +E +  L     C + L   LC +Y P C  +  ++L PCR+ C   +  C  +       WPE L C + P              E N      ++ L LN+           ++P  Y G                   C ++C  N  FS+E  T    ++    +LT V TLFT VTF    +   RYP   + F+   + + S+  L++     R KV C  D      + + E  E+ +  C +TF+L ++FS A   W++ML   W + F  L  +  + A  +G FH+  W + +VLT  VL+++ VDA+ + G+C VG + P +   F + P  + L+IG +FL  G F   ++ +K +   L +   I    +I  R+G F+ +    +     C +Y+YYN   W R+
Sbjct:   25 KCEPLKEQTCLGEKLDYHYTTTELVTDSSSQDQVKKNLEKWEGLKFLPKCWEVLQPFLCQIYKPKCK-NGSVEL-PCREQCFATRKPCSVVESYRR--WPEFLRCDKLP--------------EGNCNG--TLKKLHLNESACKAPLVETAYKPSWYEG----------------IEGCGIQCM-NPIFSEEEHTRIHRFVAAFGTLTTVCTLFTVVTFLVGWKSQNRYPSVILFFMNACFCVASVGFLIQFSSDARRKVVCRRD----DTMRLGEPTESDSFLCVLTFVLVYYFSLAGMTWFVMLAYSWCICFKTLGSTRDNFAGKTGYFHIISWSLPAVLTGCVLLVKQVDANSISGICFVGYKNPSMRAGFLLAPLGLDLVIGGMFLAKGLFTL-FKLRKSNPNFLSNRASIKIKETI-MRVGFFAFVAFAFVFITFACHVYEYYNQERWERS 437          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: fzd4 (frizzled class receptor 4 [Source:NCBI gene;Acc:101169962])

HSP 1 Score: 272.707 bits (696), Expect = 2.509e-83
Identity = 171/516 (33.14%), Postives = 267/516 (51.74%), Query Frame = 1
Query:  121 DSIENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCS-ENDFFSKESKTIAEIWMKVITSL-TFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSRE 1650
            D +E   C P  I I  CQ   YN T +        +++ ++ + T+  L+  GCS  L F LCSVYVP C     I + PC  +C  V+  C P+L     +WPE LNCSRFP ++ H   CM    +E+                 ++H P     Q       ++Y ++ +T  C L+C  +N  + + +K   + WM V   L    +TL        ++R  YPE+PIIFL+   N+YS++ L+RL LGRE+VSCD D V G  +L+QEGL++T CAI FLL +FF  A+ +WW++L L W L   L     ++  +S  FH+  W + +  T+ +LI+R VDAD+L GLC VG Q  + L  F + P    L++G +F+ +G     ++ +    K      K+  L+    ++G+FSI+Y +  +T+I C LYQ  ++  +       +   D+ V   +L+ FM+ +VGI S +WI S  ++  W++C   LL +    +  KS   E
Sbjct:   28 DEMEEMTCDP--IRISMCQGLGYNVTKMPNLVGNMLQSDAELQLTTFTPLIQCGCSSQLKFFLCSVYVPMCTDKVPIPIGPCGSMCLSVKRKCLPVLLEFGYTWPEALNCSRFPPQNDHNHMCMEGPGDED-------------PPYQSVHHPSDQDCQALD-STPDQYTWLKQTESCVLQCGYDNGLYRRGAKVFTDAWMAVWAVLCFLSTTLTVLTFLLDSQRFSYPERPIIFLSMCCNLYSVAYLVRLTLGRERVSCDLDAV-GVPVLVQEGLKSTGCAIVFLLLYFFGMASSLWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAAKTIVILIMRLVDADDLTGLCYVGNQQQEALTGFVVAPLATYLLVGTLFICAGLMAL-FKIRSNLQKDGTKTDKLERLM---VKIGVFSILYTVPASTVIGCYLYQLSHWGEFK------TSTHDSYVTSEMLRIFMSLLVGITSGMWIWSAKTLHTWQRCSSRLLREGHVGRGGKSAPGE 516          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: fzd10 (frizzled class receptor 10 [Source:NCBI gene;Acc:101161314])

HSP 1 Score: 262.307 bits (669), Expect = 8.041e-79
Identity = 175/522 (33.52%), Postives = 274/522 (52.49%), Query Frame = 1
Query:  109 ISIVDSIENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMH-PSQEENLQRKI-QIQNLSLNKDR----NNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYW------------SRAPIKFSKRKDAIVA--VFLLKFFMNQVVGINSAIWILSLDSVAAWKKCF 1593
            IS +D   + + + + I I  C++  YN T +      D + E  I ++ + SL+  GC  HL F LCS+Y P C       +  CR +CE+V+  C PIL+     WP+ L+CSR P ++     CM  P+   +   K+   Q       +     ++H PK   G+ +   N  K+ F+ ++  CA KC    + F+S+  K  + +WM + + L FVS+ FT +TF  + +R +YPE+PIIFL+ SY +YS+  L+RLF+G + ++CD D  +G + +IQEGLE+T C I FL+ ++F  A+ +WW++L L W L         ++  NS  FHL  W + +V T+ +L++R V  DEL G+C VG      L  F +IP    LIIG  FLLSGF    +  +K       +  K+  L+    R+G+FS++Y +    +I C  Y+  N  YW            SR        K +I A  +F++K FM  VVGI S +WI +  ++ +W+  F
Sbjct:   19 ISSIDPDWSGEGRCQHITIPLCKDIGYNMTRMPNLMGHDDQLEAAIKLQEFASLIQCGCHSHLKFFLCSLYAPMCTEQVSNPIPACRVMCEQVKVKCSPILEKFQFPWPDSLDCSRLPTKNDPNNLCMEAPNNSSDEPPKVPHTQPPDFRPQQPLSGQDLH-PKDI-GEKQTCSNPGKFHFVEKSESCAPKCYPKVDVFWSQGDKQFSLVWMAIWSILCFVSSAFTVLTFLIDPQRFKYPERPIIFLSMSYCVYSVGYLIRLFVGADGIACDRD--NGVQYIIQEGLESTGCTIVFLILYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRKVAGDELTGVCYVGSMDVKALTGFVLIPLSCYLIIGTSFLLSGFVAL-FHIRKVMKTEGENTDKLEKLM---VRIGVFSVLYTVPATCVIACYFYERLNMDYWRILAWKQKCVDGSRPESDECVMKASIPAIEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVF 532          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: fzd9b (frizzled class receptor 9 [Source:NCBI gene;Acc:101174936])

HSP 1 Score: 261.536 bits (667), Expect = 1.655e-78
Identity = 168/535 (31.40%), Postives = 266/535 (49.72%), Query Frame = 1
Query:  103 LLISIVDSIENEKCKPKPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLN------KDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSE--NDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFC-HNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIK-----FSKRKD--------AIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKK 1629
            L +S  D   +   K +PI I  C    YN T +      D +AE  I ++ +  L+  GC  HL F LCS+Y P C       +  CR +CE+ +  C PI+K  + +WP+ L+CS+ P  +     CM   + E      + +           + R       +  G      N +K+ F+ ++  CA +CS   + ++S++ K  A IWM V + L FVST FT +TF     R +YPE+PIIFL+  Y +YS++ ++R   G E ++CD +   G+  +IQEGLE+T C I FL+ ++F  A+ +WW++L L W L         ++  +S  FH+  W + ++ T+ +L +R V  DEL GLC VG      L  F +IP    LIIG  F+L+GF    +  +K       + +K+  L+    ++G++SI+Y +    +I C  Y+  N  YW    ++     FS              VAVF+LK FM+ VVGI S +W+ S  ++  W+      L   T ++K
Sbjct:   26 LEMSFYDLERDRPAKCEPIVIPMCVGIGYNLTRMPNFMDHDDQAEAAIKLQEFAPLVDYGCDVHLRFFLCSLYAPMCTDKVSTSIPACRPMCEQARDKCAPIMKKFSYTWPDSLDCSKLPTRNDPNALCMEAPENETRTEGKKDKKKGEGMLPVPPRPRQPDTPSSRLPGSGNSCENPDKFQFVEKSQSCAPRCSPAVDVYWSRQDKDFAFIWMTVWSILCFVSTAFTVLTFLLEPHRFQYPERPIIFLSMCYMVYSLAFIIRSVAGAENIACDRE--HGELYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIEAHSNYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDSGALTGFVLIPLSCYLIIGTSFILTGFVAL-FHIRKVMKTEGTNTEKLEKLM---VKIGIYSILYTVPATCVIVCYFYERLNMDYWKLRGLQEECDSFSSHNSKCSLETSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSRKLSDRTSSRK 554          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: ENSORLT00000013002.2 (pep primary_assembly:ASM223467v1:21:5638676:5644296:-1 gene:ENSORLG00000010376.2 transcript:ENSORLT00000013002.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.557 bits (571), Expect = 7.391e-65
Identity = 158/501 (31.54%), Postives = 246/501 (49.10%), Query Frame = 1
Query:  151 KPIAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNG------EKYVFINR--TG---RCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA-----PIKFSKR-KDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKK 1587
            +PI +  C+   YN T +    + D + EV + +  +  L+   CS  L F LCS+Y P C  D    L PCR VCE+ +  C P++      WPE+++C   P +   +  CM  +  E           S  K R     P Q   +CR  R+       E +    R  TG    CAL C    +FS + +     W+ + + L F+STL T  TF  +  R +YPE+PIIFL   Y   S+  ++RL  G E+V+C     S   IL  +      C + FLL +FF  A+ +WW++L   W L   +   + ++A  S  FHL  WL+ SV ++ VL L SVD D + G+C VG Q+ + L  F + P ++ L  G +FLL+GF    +R +    +      K+  L+    R+GLF+++Y +    ++ C +Y+ +    W RA     P++  +  +    AVF+LK+FM  VVGI S +WI S  ++ +W+ 
Sbjct:   25 EPITVPMCKGIGYNLTYMPNKFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPICLPDYRKPLPPCRSVCERAKRGCSPLMSQYGFEWPERMSCEGLP-QLGDETLCMDQNSSEATTSAPPFPK-STPKVRTRPPSPSQCDRECR-CRDPLIPIKRESHALFGRVQTGPLPNCALPC-HLPYFSADERAFTSFWVGLWSVLCFISTLTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIIRLVAGHERVACGAGGTSQLHIL-YDATGPALCTLVFLLVYFFGMASSIWWVVLSFTWFLAAGMKWGSEAIAGYSQYFHLAAWLIPSVKSILVLALSSVDGDPVAGICYVGNQSLENLRGFVLAPLVVYLFTGTLFLLAGFVSL-FRIRSIIKQGGTKTDKLERLM---IRIGLFTVLYTVPATIVVACLVYEQHYRPSWERALACSCPLERQRSIRGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRS 516          
BLAST of Frizzled-4 vs. Ensembl Medaka
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 223.402 bits (568), Expect = 1.868e-64
Identity = 154/513 (30.02%), Postives = 248/513 (48.34%), Query Frame = 1
Query:  157 IAIGQCQNKFYNFTSL----SQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEEN------LQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNG------------EKYVFINR--TGR---CALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHN-RRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSC--DFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAP-------IKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            IA+  C+   YN+T +    + D + E  + +  +  L+   CS  L F LCS+Y P C  D    L PCR VCE+ +  C P+++     WP+++ C   P++ +    CM  ++ ++      L +       S          P +Y+        G            E++   NR  TG+   CA+ C  N +F+ + +     W+ + + L FVST  T  TF  +  R +YPE+PIIFL+  Y   S+  ++RL  G EKV+C  DFD     + +  E      C I FLL +FF  A+ +WW++L L W L   +     ++A  +  FHL  WL+ S+ +++VL L SVD D + G+C VG Q  D L  F + P +I L IG +FLL+GF    +R +    +      K+  L+    R+G+F+++Y +    ++ C  Y+ +N   W            +   R     AVF+LK+FM  +VGI S +WI S  ++ +W+
Sbjct:   24 IAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFPWPDRMRCDLLPVQGNPDTLCMDYNRNDSTTASPVLSKPTNHPGRSPKSKPGRAGAPGKYKPPAAPCEPGCRCLEPMVAVTTERHPLYNRVKTGQVTNCAMPC-HNPYFTHDERAFTAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLIAGHEKVACNRDFD----VEHIHYETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYAQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSL-FRIRSVIKQGGTKTDKLEKLM---IRIGIFTVLYTVPATVIVACYFYEQHNRQDWEMTHNCSSCLMERERARSGPDYAVFMLKYFMCLLVGITSGVWIWSGKTLDSWR 527          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000037982.1 (SMESG000037982.1)

HSP 1 Score: 1058.51 bits (2736), Expect = 0.000e+0
Identity = 549/551 (99.64%), Postives = 550/551 (99.82%), Query Frame = 1
Query:   67 MIKLPPVNICLFLLISIVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSNKYWLYCKSGN 1719
            MIKLPPVNICLFLLISIVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHE KQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSA+SLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQLICLIIGFIFLLSGFFFFKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSIIYIIAIATMICCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSNKYWLYCKSGN
Sbjct:    1 MIKLPPVNICLFLLISIVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHELKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSAMSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQLICLIIGFIFLLSGFFFFKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSIIYIIAIATMICCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSNKYWLYCKSGN 551          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000037981.1 (SMESG000037981.1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 371/535 (69.35%), Postives = 415/535 (77.57%), Query Frame = 1
Query:   85 VNICLFLLISIVDSIENEKCKPKPIAIGQCQNKFYNFTS----LSQDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKS---LCHHQKITFLLSIG---FRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKVTFNKKIKSNSREIES 1659
            +++C+ LL   + S  N KC  +      C+N F++ +S    +++D   + +I I+TY+S  ++ C K L  LLC +  P CD  T I+L PCRK CEKVQFDCEPILKLVNLSWPEKLNCSRFPL++SHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHE KQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLL FSIIP++ CL++G  FL  G      R+ K S K     C +Q+   L+ +     R+  F  IY + I+  ICC+ YQ+ NY  W             I  V+LLK F+NQVVGI SAIW LSLDS  AW + F  + +K    KK   NS+  +S
Sbjct:    8 ISLCIILLQ--IHSYTNRKCTKESKKHFYCRNDFFDLSSSKELIAEDYLLKFKIQIKTYKSFQNHKCIKTLITLLCLIQDPLCDPITNIRLGPCRKACEKVQFDCEPILKLVNLSWPEKLNCSRFPLKNSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHELKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLLFSIIPKISCLVLGLTFLTIGLAIHAGRSDKLSGKVQILTCLNQQSEQLMDLSPMKLRIKTFLFIYCVTISLSICCDAYQFNNYASWLVNNPNTLNLTFPIFTVYLLKMFVNQVVGIYSAIWFLSLDSRGAWVELFRKITKKWDSEKKTSPNSQHFKS 540          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000014322.1 (SMESG000014322.1)

HSP 1 Score: 356.681 bits (914), Expect = 5.306e-115
Identity = 194/495 (39.19%), Postives = 297/495 (60.00%), Query Frame = 1
Query:  115 IVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQ----DQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWK 1584
            +++ ++  KC PK I + +CQN FYNFT +      + + E Q  ++T++SL+   CS++L F LCSVY+P CD  +   + PC+ +CE+V+  CE I++  NL WP  LNCSRFP+ ++    CM                        ++   + ++  C  M+N   ++FINRT +C  KCS N  F+ + K IA+IW+ V+ SL F+S++FT +TF  N  R +YPE+P+IFL   Y+IYS+S  + L   R+  +C+ DPVSGQ IL QEGL+NT CAI FLLNFFFSTA+ +WW++L + W L      S  ++ + SG FHL  WL++S+LTV+VL+LRSVDADEL GLCSVG+Q    LL F +I   I  +I   F L G      R ++         +K+  L+    R+GLFS+++++  +T++ C  Y+Y N  +W ++        +  + V++LK FM+ VVGI S +W+ S+ ++ +W+
Sbjct:   37 VLEPVQTRKCLPKKILVPECQNLFYNFTGMPNLVNLETQIEAQSQLQTFQSLIKYKCSQNLLFFLCSVYIPMCDPISNYLIGPCQPLCEEVRDSCERIMRPFNLPWPVTLNCSRFPIRNAEGSMCMEGPGP-------------------SVKSTENFQTMCGGMKNPRLFIFINRTQKCVPKCSANILFTVDDKYIAKIWLTVLASLCFISSVFTILTFLINTDRFKYPERPVIFLAVCYSIYSVSHFINLANTRQSAACNRDPVSGQFILTQEGLDNTLCAIIFLLNFFFSTASQIWWVILTVAWLLAAGFKWSEEAIYQRSGYFHLAAWLISSLLTVAVLVLRSVDADELLGLCSVGQQNVSTLLIF-VIIPNIIFLIIGCFFLLGGLVALVRVRRHVKNDGIKTEKLEILM---VRIGLFSVLFLVPSSTVLGCNFYEYANRDHWLKS------GTNPNIEVYMLKIFMSSVVGITSGVWVWSIKTLESWQ 502          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000031852.1 (SMESG000031852.1)

HSP 1 Score: 200.675 bits (509), Expect = 4.830e-56
Identity = 145/511 (28.38%), Postives = 247/511 (48.34%), Query Frame = 1
Query:  124 SIENEKCKPK---PIAIGQCQNKFYNFTSLSQDQE----AEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCR-----HMRNGEKYVFINRTGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENT-NCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRA---PIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLL 1605
            SI     +P    PI I  C+   YN T +  D       E  + I+ + +L+   CS+ L   LCS+Y P C  +   ++  CR +C   +  C  ++      WPE +NC + P +++    C+   +++N  R  +  N     +R  + + K+    CR       R+    V       C + C  + +F +  K+ +  W+ +   +  +ST  T +TFC ++ R +YPE+PIIFL+  Y + S+  L+R+ LG E V+C  D        I+ G      C+I FL  +FF  A+ +WW++L   W L   L   + ++   + I+H F W +  + ++ +L + SVD D + G+C VG      LL F IIP ++ L++G  FLL+GF       K    K      K+  L+    R+ +F I+Y +   T++ C +Y++     W ++   P + +K+     +VF+LK+FMN VVG  +  WI +  ++ +W K F  LL
Sbjct:   24 SISKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNA----CL---RKDNKTRSNKTANFV--SERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNC-RSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDA-------IRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGESKTDKLEKLM---IRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPCR-TKKYQPEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLL 513          
BLAST of Frizzled-4 vs. Planmine SMEST
Match: SMESG000005043.1 (SMESG000005043.1)

HSP 1 Score: 194.512 bits (493), Expect = 1.250e-53
Identity = 145/526 (27.57%), Postives = 240/526 (45.63%), Query Frame = 1
Query:  118 VDSIENEKCKPK---PIAIGQCQNKFYNFTSLS----QDQEAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVCEKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKIQIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINR----------TGRCALKCSENDFFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNR-RIRYPEQPIIFLTFSYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLEN-TNCAITFLLNFFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLTVSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQXXXXXXXXXXXXXXXXXXKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSXXXXXXXXXXXCCELYQYYNYHYWSRAPIKFSKRK--------DAIVAVFLLKFFMNQVVGINSAIWILSLDSVAAWKKCFVMLLEKV 1614
             D    E  +P    PIAI  C+N  YN T +      + + E  + +  +  L+   CS +L   LCS+Y P C  +    ++ CR VCE  +  C P++      WP+ ++C +     +    C                   L KD  N+ +P     +C+       Y++ N+             C   C   +F S + K+    W+ +   L  +S+  T +TF  +R R +YPE+PI+FL+  Y + SI  ++R+ +G E ++CD D        ++ G      C+I FLL +FF  A  +WW++L + W L   L   + +++K S IFH   W ++ V ++  L L ++D D + G+C +G      L  F I+P  + L+IG  FLLSGF       K    K      K+  L+    R+G+F ++Y +  A +I C LY+  N  +W ++   +  R             +VF+LK+FM  VVGI S  WI +  ++ +W   F  L + +
Sbjct:   46 ADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQAC-------------------LKKDTKNVTKPPSKGCECKCR---SPYIYDNKPQFNSVITGGVANCFQSCHSANFVSID-KSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK-------LRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLM---MRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSI 534          
The following BLAST results are available for this feature:
BLAST of Frizzled-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD42.207e-9836.58frizzled class receptor 4 [Source:HGNC Symbol;Acc:... [more]
FZD103.321e-7731.42frizzled class receptor 10 [Source:HGNC Symbol;Acc... [more]
FZD92.353e-7529.84frizzled class receptor 9 [Source:HGNC Symbol;Acc:... [more]
FZD55.598e-5829.45frizzled class receptor 5 [Source:HGNC Symbol;Acc:... [more]
FZD29.808e-5227.34frizzled class receptor 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-172.421e-4826.94Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-172.421e-4826.94Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-172.421e-4826.94Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-173.515e-4827.63Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-173.515e-4827.63Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz3.832e-4627.05gene:FBgn0001085 transcript:FBtr0075743[more]
fz4.640e-4627.05gene:FBgn0001085 transcript:FBtr0330102[more]
fz41.107e-4428.32gene:FBgn0027342 transcript:FBtr0071017[more]
fz41.107e-4428.32gene:FBgn0027342 transcript:FBtr0071018[more]
fz23.764e-4331.85gene:FBgn0016797 transcript:FBtr0112890[more]
back to top
BLAST of Frizzled-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd41.510e-8731.87frizzled class receptor 4 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd9b1.684e-8232.23frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b1.684e-8232.23frizzled class receptor 9b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9a6.440e-8232.10frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9a8.848e-8232.10frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD42.235e-9735.42frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
FZD94.328e-7731.13frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
fzd85.002e-6830.94frizzled class receptor 8 [Source:NCBI gene;Acc:10... [more]
zdhhc93.272e-6631.50zinc finger DHHC-type containing 9 [Source:Xenbase... [more]
ntrk12.429e-5828.63neurotrophic receptor tyrosine kinase 1 [Source:Xe... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fzd47.075e-9836.19frizzled class receptor 4 [Source:MGI Symbol;Acc:M... [more]
Fzd91.202e-7630.17frizzled class receptor 9 [Source:MGI Symbol;Acc:M... [more]
Fzd103.338e-7329.94frizzled class receptor 10 [Source:MGI Symbol;Acc:... [more]
Fzd51.033e-5929.53frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
Fzd51.033e-5929.53frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Frizzled-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ULV1|FZD4_HUMAN1.060e-9736.58Frizzled-4 OS=Homo sapiens OX=9606 GN=FZD4 PE=1 SV... [more]
sp|Q9QZH0|FZD4_RAT1.815e-9736.38Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 P... [more]
sp|Q9IA05|FZD4_CHICK4.058e-9737.30Frizzled-4 OS=Gallus gallus OX=9031 GN=FZD4 PE=1 S... [more]
sp|Q61088|FZD4_MOUSE4.949e-9736.19Frizzled-4 OS=Mus musculus OX=10090 GN=Fzd4 PE=1 S... [more]
sp|Q9PT62|FZD4_XENLA4.390e-9535.42Frizzled-4 OS=Xenopus laevis OX=8355 GN=fzd4 PE=2 ... [more]
back to top
BLAST of Frizzled-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1DBJ60.000e+0100.00Fzd-4-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV... [more]
T1E1110.000e+058.88Fzd-4-3b OS=Dendrocoelum lacteum OX=27895 PE=2 SV=... [more]
T1D1429.562e-15548.98Fzd-4-3a (Fragment) OS=Dendrocoelum lacteum OX=278... [more]
T1E1E87.168e-11940.43Fzd-4-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1D1102.406e-11440.20Fzd-4-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd43.904e-8733.20frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
fzd9a2.427e-8232.69frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b4.067e-8131.65frizzled-9 [Source:NCBI gene;Acc:103027133][more]
fzd108.266e-7632.92frizzled class receptor 10 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000026985.21.315e-6430.50pep primary_assembly:Astyanax_mexicanus-2.0:19:270... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011009.11.392e-6629.81pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gen... [more]
fzd7a1.607e-5026.35frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd29.992e-5026.91frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd8a4.818e-4030.56frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
smo1.202e-2222.76smoothened, frizzled class receptor [Source:ZFIN;A... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Frizzled-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO308659.986e-7730.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385672.352e-6827.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429325.613e-6128.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357511.114e-6030.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401192.506e-2726.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Frizzled-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd42.509e-8333.14frizzled class receptor 4 [Source:NCBI gene;Acc:10... [more]
fzd108.041e-7933.52frizzled class receptor 10 [Source:NCBI gene;Acc:1... [more]
fzd9b1.655e-7831.40frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000013002.27.391e-6531.54pep primary_assembly:ASM223467v1:21:5638676:564429... [more]
fzd8a1.868e-6430.02frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037982.10.000e+099.64SMESG000037982.1[more]
SMESG000037981.10.000e+069.35SMESG000037981.1[more]
SMESG000014322.15.306e-11539.19SMESG000014322.1[more]
SMESG000031852.14.830e-5628.38SMESG000031852.1[more]
SMESG000005043.11.250e-5327.57SMESG000005043.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023158 ID=SMED30023158|Name=Frizzled-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1947bp
CGAAAAACGAAAAGTAATATTTCATATTTAAGTGACCGTTTGAATATCAA
ATTTAGCAGATAAAAAATGATTAAATTGCCACCAGTGAATATTTGTTTAT
TTTTACTGATTTCCATAGTAGATTCAATTGAAAATGAAAAATGTAAACCA
AAACCAATTGCAATTGGACAGTGTCAAAATAAATTCTATAATTTTACAAG
TTTAAGTCAAGATCAAGAGGCAGAAGTTCAAATTCCTATTGAAACTTATC
GTTCCCTGTTATCAAATGGCTGCTCAAAGCATTTGAATTTTCTACTTTGT
TCAGTCTATGTTCCGTTCTGTGATTACGATACTGGTATCCAACTTGAACC
ATGTCGGAAAGTCTGTGAAAAAGTCCAATTCGATTGTGAACCGATATTGA
AGCTAGTCAACCTTTCATGGCCAGAAAAATTGAATTGTTCTCGATTTCCG
TTAGAAAGTTCCCATCAAATGCAGTGCATGCATCCAAGCCAGGAGGAGAA
TTTGCAAAGGAAAATCCAAATCCAAAACCTCAGCCTGAACAAAGACCGCA
ACAATATCCATGAACCGAAACAATATCGCGGCCAATGCAGACACATGCGA
AACGGTGAAAAGTACGTGTTTATCAATCGAACCGGCCGATGTGCTCTGAA
ATGCTCGGAGAACGATTTCTTCTCGAAAGAATCGAAAACGATAGCAGAAA
TCTGGATGAAAGTCATCACGAGTTTGACTTTCGTTTCGACGTTGTTTACG
TGTGTCACATTTTGTCACAATCGCCGAATTCGGTATCCAGAACAGCCGAT
TATTTTCCTGACATTCTCCTATAACATTTATAGTATTTCCATTCTGTTGC
GTTTGTTTCTCGGCCGAGAGAAAGTGTCGTGCGATTTCGATCCGGTTTCC
GGGCAGAAAATCCTTATCCAAGAAGGCTTAGAAAACACAAACTGTGCGAT
AACATTTCTGTTGAATTTTTTCTTCAGCACAGCCACCCACATGTGGTGGA
TAATGCTGTGCTTGTGTTGGACTCTGTTCTGCGCTTTGAATGTGTCGGCG
CTGAGTTTGGCTAAAAATTCCGGTATTTTCCATTTGTTTGTCTGGTTGAT
GACATCAGTGCTGACTGTGTCGGTTTTGATTTTGCGATCTGTCGACGCTG
ACGAATTGTTTGGATTGTGTTCGGTAGGCGAGCAGACTCCAGATTTACTA
CTGACATTTTCAATAATTCCCCAACTCATTTGTCTGATTATCGGTTTCAT
TTTTCTCTTATCTGGGTTTTTCTTTTTTAAATATCGCACGAAAAAATTCA
GCAATAAAAGCCTCTGTCACCATCAGAAAATCACTTTTCTTCTTTCAATT
GGTTTCCGATTGGGATTGTTTTCTATTATCTATATCATAGCAATCGCAAC
GATGATATGTTGTGAGCTTTACCAATATTACAATTACCATTACTGGTCGA
GGGCCCCGATTAAATTCAGTAAAAGAAAAGATGCCATTGTTGCGGTATTT
CTTTTGAAGTTCTTTATGAACCAAGTTGTCGGAATCAACAGCGCAATTTG
GATTTTGTCTTTAGATTCAGTGGCAGCATGGAAGAAGTGTTTTGTAATGT
TGCTAGAAAAAGTGACCTTCAATAAGAAAATCAAATCCAATTCTCGAGAG
ATTGAATCGTATGGACAGTTAAATTCCACCAATTCAAACAAATATTGGTT
GTATTGTAAATCGGGGAATTAAAAGTGAACTGAGCCCCACTGCAACATTT
TTCATCCTGTGCTGAAATCACGAGGAATTTCTGCCTGTTATTCATATCAC
ATTAGTTAGTCACAATGATTATTCAAGCCGTTCGAATTTCATTTGCAGCT
CGAAGAATTTTGTACAAAAAATTTATGTCACTCTCTGTTTGTGACATTAT
CATTTATCAAGGGCAACAATCTGATTAATTTATTGTTTTAATGGTTG
back to top

protein sequence of SMED30023158-orf-1

>SMED30023158-orf-1 ID=SMED30023158-orf-1|Name=SMED30023158-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=552bp
MIKLPPVNICLFLLISIVDSIENEKCKPKPIAIGQCQNKFYNFTSLSQDQ
EAEVQIPIETYRSLLSNGCSKHLNFLLCSVYVPFCDYDTGIQLEPCRKVC
EKVQFDCEPILKLVNLSWPEKLNCSRFPLESSHQMQCMHPSQEENLQRKI
QIQNLSLNKDRNNIHEPKQYRGQCRHMRNGEKYVFINRTGRCALKCSEND
FFSKESKTIAEIWMKVITSLTFVSTLFTCVTFCHNRRIRYPEQPIIFLTF
SYNIYSISILLRLFLGREKVSCDFDPVSGQKILIQEGLENTNCAITFLLN
FFFSTATHMWWIMLCLCWTLFCALNVSALSLAKNSGIFHLFVWLMTSVLT
VSVLILRSVDADELFGLCSVGEQTPDLLLTFSIIPQLICLIIGFIFLLSG
FFFFKYRTKKFSNKSLCHHQKITFLLSIGFRLGLFSIIYIIAIATMICCE
LYQYYNYHYWSRAPIKFSKRKDAIVAVFLLKFFMNQVVGINSAIWILSLD
SVAAWKKCFVMLLEKVTFNKKIKSNSREIESYGQLNSTNSNKYWLYCKSG
N*
back to top

protein sequence of SMED30023158-orf-2

>SMED30023158-orf-2 ID=SMED30023158-orf-2|Name=SMED30023158-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MKPIIRQMSWGIIENVSSKSGVCSPTEHNPNNSSASTDRKIKTDTVSTDV
INQTNKWKIPEFLAKLSADTFKAQNRVQHKHSIIHHMWVAVLKKKFNRNV
IAQFVFSKPSWIRIFCPETGSKSHDTFSRPRNKRNRMEIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR015526Frizzled/SFRP
IPR000539Frizzled/Smoothened_TM
IPR020067Frizzled_dom
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004888transmembrane signaling receptor activity
GO:0042813Wnt-activated receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000539Frizzled/Smoothened, transmembrane domainPRINTSPR00489FRIZZLEDcoord: 213..235
score: 34.26
coord: 383..405
score: 34.09
coord: 428..449
score: 29.27
coord: 338..361
score: 39.33
coord: 295..319
score: 38.56
coord: 477..497
score: 40.76
IPR000539Frizzled/Smoothened, transmembrane domainSMARTSM01330Frizzled_2coord: 200..515
e-value: 2.5E-74
score: 262.9
IPR000539Frizzled/Smoothened, transmembrane domainPFAMPF01534Frizzledcoord: 201..509
e-value: 7.4E-72
score: 242.1
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 25..142
e-value: 6.7E-24
score: 95.4
IPR020067Frizzled domainPFAMPF01392Fzcoord: 30..130
e-value: 5.2E-19
score: 68.9
IPR020067Frizzled domainPROSITEPS50038FZcoord: 5..140
score: 18.722
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 20..148
e-value: 1.1E-27
score: 98.7
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 30..141
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 172..513
e-value: 7.3E-81
score: 273.6
NoneNo IPR availablePANTHERPTHR11309:SF99FRIZZLED-3coord: 30..536
NoneNo IPR availableCDDcd150387tmF_FZD4coord: 200..510
e-value: 1.8566E-88
score: 273.177
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.752
NoneNo IPR availableTMHMMTMhelixcoord: 335..357
NoneNo IPR availableTMHMMTMhelixcoord: 382..404
NoneNo IPR availableTMHMMTMhelixcoord: 306..328
NoneNo IPR availableTMHMMTMhelixcoord: 425..447
NoneNo IPR availableTMHMMTMhelixcoord: 244..266
NoneNo IPR availableTMHMMTMhelixcoord: 209..231
NoneNo IPR availableTMHMMTMhelixcoord: 475..497
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 30..536
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 210..504
score: 20.696