Carbonic anhydrase

Overview
NameCarbonic anhydrase
Smed IDSMED30023132
Length (bp)981
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Carbonic anhydrase (SMED30023132) t-SNE clustered cells

Violin plots show distribution of expression levels for Carbonic anhydrase (SMED30023132) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Carbonic anhydrase (SMED30023132) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Carbonic anhydrase (SMED30023132) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023132

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023132SMESG000035019.1 dd_Smed_v4_5411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023132SMESG000035019.1 dd_Smed_v4_5411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023132SMESG000035019.1 dd_Smed_v4_5411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023132SMESG000035019.1 dd_Smed_v4_5411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023132SMESG000035019.1 dd_Smed_v4_5411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30023132SMESG000035019.1 dd_Smed_v4_5411_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023132SMESG000022725.1 Contig4326GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023132SMESG000035019.1 Contig38864newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023132SMESG000035019.1 Contig38864uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023132SMESG000035019.1 Contig4326GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30023132SMESG000035019.1 dd_Smed_v6_5411_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30023132SMESG000035019.1 OX_Smed_1.0.03882ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023132SMESG000035019.1 dd_Smed_v4_5411_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-1 (Beta carbonic anhydrase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q22460])

HSP 1 Score: 141.354 bits (355), Expect = 6.915e-40
Identity = 82/243 (33.74%), Postives = 133/243 (54.73%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISD-----YIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFV---PTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDT--NLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            MN+I+  ++ F+  +        EEI +      +M +C+D R++P  FT+  +G ++VVRNAGN +   P Y   +E  +++E  A+ELAV    I+ I++ GHSDCKA++ L  L H     ++   P+  W R+ G  S K+  + L      ++F+ +  PS   +A ID    L + D LSQIN LQQ  N+ + +FL+E L + +L +H +W +I   ED    YLF    ++F+ I
Sbjct:    1 MNKILRGVIQFRNTIRKDLVKQFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSVNTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGL-HQCPKNFDVTSPMDHWVRRNGFASVKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEFLKEYLESGRLHIHGMWFDIYKGED----YLFSKDKKRFVVI 238          
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-1 (Beta carbonic anhydrase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q22460])

HSP 1 Score: 141.354 bits (355), Expect = 6.915e-40
Identity = 82/243 (33.74%), Postives = 133/243 (54.73%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISD-----YIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFV---PTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDT--NLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            MN+I+  ++ F+  +        EEI +      +M +C+D R++P  FT+  +G ++VVRNAGN +   P Y   +E  +++E  A+ELAV    I+ I++ GHSDCKA++ L  L H     ++   P+  W R+ G  S K+  + L      ++F+ +  PS   +A ID    L + D LSQIN LQQ  N+ + +FL+E L + +L +H +W +I   ED    YLF    ++F+ I
Sbjct:    1 MNKILRGVIQFRNTIRKDLVKQFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSVNTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGL-HQCPKNFDVTSPMDHWVRRNGFASVKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEFLKEYLESGRLHIHGMWFDIYKGED----YLFSKDKKRFVVI 238          
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-2 (Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D3NQB0])

HSP 1 Score: 129.798 bits (325), Expect = 1.517e-35
Identity = 79/245 (32.24%), Postives = 135/245 (55.10%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISD-----YIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHN----EKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDR-SKPIQFQLKPQPSPPNNAYIDT--NLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            +  I++ ++ F++ V        E I D      +  +C+D R++P   T   +G ++VVRN+GN +P   ++     E  +++E  A+ELAV    I  +I+ GHSDCKA++ L  L H     ++   P+  W R++G  S +K +K L D+ + PI+F +   P    +A ID    L + D LSQIN LQQ ENVA+  FL+E L++  + LH +W +I + E    +++F   +++F+ +
Sbjct:    4 LERILNGVIRFRQTVRKDLVKQFERIRDNPHPTAVFFTCMDSRMLPARITSSQVGDMFVVRNSGNMIPHANNYGPSGYEVSVTTEPAALELAVKRGKINHVIVCGHSDCKAINTLYNL-HKCPKSFDPESPMDHWLRRHGFNSIRKLEKRLADKNAGPIEF-VSDNPLFSFSAVIDPEDKLNVEDKLSQINTLQQLENVASHGFLKEFLVSQTVDLHAMWFDIYTGE----MHMFSKPNKQFVLV 242          
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-2 (Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D3NQB0])

HSP 1 Score: 114.775 bits (286), Expect = 1.767e-29
Identity = 82/290 (28.28%), Postives = 138/290 (47.59%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISD-----YIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVP--------------TYEHHNEKE-----------------------------------ISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDR-SKPIQFQLKPQPSPPNNAYIDT--NLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            +  I++ ++ F++ V        E I D      +  +C+D R++P   T   +G ++VVRN+GN +P              T + + EKE                                   +++E  A+ELAV    I  +I+ GHSDCKA++ L  L H     ++   P+  W R++G  S +K +K L D+ + PI+F +   P    +A ID    L + D LSQIN LQQ ENVA+  FL+E L++  + LH +W +I + E    +++F   +++F+ +
Sbjct:    4 LERILNGVIRFRQTVRKDLVKQFERIRDNPHPTAVFFTCMDSRMLPARITSSQVGDMFVVRNSGNMIPHANNYGKILRRGDTTGKENREKENWKPRPFLPPETPRREDLVEKVIYCAKSPSGYEVSVTTEPAALELAVKRGKINHVIVCGHSDCKAINTLYNL-HKCPKSFDPESPMDHWLRRHGFNSIRKLEKRLADKNAGPIEF-VSDNPLFSFSAVIDPEDKLNVEDKLSQINTLQQLENVASHGFLKEFLVSQTVDLHAMWFDIYTGE----MHMFSKPNKQFVLV 287          
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Match: bca-2 (Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D3NQB0])

HSP 1 Score: 108.612 bits (270), Expect = 3.227e-28
Identity = 67/189 (35.45%), Postives = 110/189 (58.20%), Query Frame = 3
Query:  186 LYVVRNAGNFVPTYEHHN----EKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDR-SKPIQFQLKPQPSPPNNAYID--TNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            ++VVRN+GN +P   ++     E  +++E  A+ELAV    I  +I+ GHSDCKA++ L  L H     ++   P+  W R++G  S +K +K L D+ + PI+F +   P    +A ID    L + D LSQIN LQQ ENVA+  FL+E L++  + LH +W +I + E    +++F   +++F+ +
Sbjct:    1 MFVVRNSGNMIPHANNYGPSGYEVSVTTEPAALELAVKRGKINHVIVCGHSDCKAINTLYNL-HKCPKSFDPESPMDHWLRRHGFNSIRKLEKRLADKNAGPIEF-VSDNPLFSFSAVIDPEDKLNVEDKLSQINTLQQLENVASHGFLKEFLVSQTVDLHAMWFDIYTGE----MHMFSKPNKQFVLV 183          
BLAST of Carbonic anhydrase vs. Ensembl Fly
Match: CAHbeta (gene:FBgn0037646 transcript:FBtr0081958)

HSP 1 Score: 131.339 bits (329), Expect = 4.251e-36
Identity = 78/243 (32.10%), Postives = 129/243 (53.09%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISD-----YIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPD-SSEYN-SCGPLSQWTRKYGKESWKKYQKYLQDRSK-PIQFQLKPQPSPPNNAYID--TNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            M  I+  I+ ++    +    + +++ D      +  +C+D R+IP  +T   +G ++VVRNAGN +P  +H  ++  S E  A+EL    + I+ II+ GHSDCKAM+ L +L  PD +S+ N    PL  W   +   S +++Q++     K P+ F     P     AYID      + D LSQIN LQQ  N+A++ FL+  L +H L +H +W +I + +    +Y F    ++FL +
Sbjct:    1 MERILRGIMRYRNTTREQMVKEFQKVRDNPEPKAVFFTCMDSRMIPTRYTDTHVGDMFVVRNAGNLIPHAQHFQDEYFSCEPAALELGCVVNDIRHIIVCGHSDCKAMNLLYQLRDPDFASKLNRRLSPLRSWLCTHANTSLERFQEWRDAGMKDPLIFS-SETPLRRFVAYIDEEQKFALEDKLSQINTLQQMSNIASYGFLKARLESHDLHIHALWFDIYTGD----IYYFSRGAKRFLPV 238          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|A8XKV0|BCA1_CAEBR (Beta carbonic anhydrase 1 OS=Caenorhabditis briggsae OX=6238 GN=bca-1 PE=3 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 1.203e-40
Identity = 85/243 (34.98%), Postives = 134/243 (55.14%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISDY-----IMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPT---YEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYID--TNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            MN II  ++ + + +        E +SD+     +M +C+D R++P  FT+  +G ++VVRNAGN +P    Y  ++E  I++E  A+ELAV    I+ +++ GHSDCKAM+ L +L H   ++++   P+ QW R+ G ES KK  + L    K ++F+ +  PS    A ID        D LSQIN LQQ  N++T +FL++ L    L LH  W  I   E    ++LF    ++F+ I
Sbjct:    1 MNRIIRGVIQYNQKIKAGLVKQFEHVSDHPNPTAVMFTCMDSRMLPTRFTQSAVGDMFVVRNAGNMIPAAPNYGSYSEVSINTEPAALELAVKRGKIRHVVVCGHSDCKAMNTLYQL-HQCPTKFDVSSPMDQWLRRNGFESMKKLNERLHIGPKTMKFESEVAPSQSFEAIIDPMEKWSAEDKLSQINVLQQIMNISTHEFLKDYLEAGNLHLHGAWFNIYDGE----VFLFSKDRKRFVVI 238          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|Q22460|BCA1_CAEEL (Beta carbonic anhydrase 1 OS=Caenorhabditis elegans OX=6239 GN=bca-1 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 8.796e-39
Identity = 82/243 (33.74%), Postives = 133/243 (54.73%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISD-----YIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFV---PTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDT--NLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            MN+I+  ++ F+  +        EEI +      +M +C+D R++P  FT+  +G ++VVRNAGN +   P Y   +E  +++E  A+ELAV    I+ I++ GHSDCKA++ L  L H     ++   P+  W R+ G  S K+  + L      ++F+ +  PS   +A ID    L + D LSQIN LQQ  N+ + +FL+E L + +L +H +W +I   ED    YLF    ++F+ I
Sbjct:    1 MNKILRGVIQFRNTIRKDLVKQFEEIKNNPSPTAVMFTCMDSRMLPTRFTQSQVGDMFVVRNAGNMIPDAPNYGAFSEVSVNTEPAALELAVKRGGIRHIVVCGHSDCKAINTLYGL-HQCPKNFDVTSPMDHWVRRNGFASVKRLNERLHRGPSSMKFESEVAPSQSFDAIIDPMDTLAMEDKLSQINVLQQLINICSHEFLKEYLESGRLHIHGMWFDIYKGED----YLFSKDKKRFVVI 238          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|P27134|CYNT_SYNE7 (Carbonic anhydrase OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=icfA PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.478e-14
Identity = 54/193 (27.98%), Postives = 83/193 (43.01%), Query Frame = 3
Query:  120 IMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPL-------SQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDTNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSE 677
            + I+C D RI PN  T+  +G L+V+RNAGN +P +   N      EG +IE A+    I+ +++ GHS C AM  L KLN           PL       +Q TR+   +++  Y+                               +++ L   N L Q EN+ T+  +R  L   KL++     E+ S E
Sbjct:   35 LFITCSDSRIDPNLITQSGMGELFVIRNAGNLIPPFGAAN----GGEGASIEYAIAALNIEHVVVCGHSHCGAMKGLLKLNQLQEDM-----PLVYDWLQHAQATRRLVLDNYSGYETD----------------------------DLVEILVAENVLTQIENLKTYPIVRSRLFQGKLQIFGWIYEVESGE 190          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|Q9ZN54|CYNT_HELPJ (Carbonic anhydrase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=cynT PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 8.992e-14
Identity = 50/175 (28.57%), Postives = 85/175 (48.57%), Query Frame = 3
Query:  120 IMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDTNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKL 644
            + ISC+D R++PN  T    G LYV+RN GN +P    +  KE  S   ++E A+ H  ++++II GHSDC A                 CG +     +  K        ++Q   +PI+ +LK  P   N+    + L       ++N   Q  N+ ++ F++E ++N++LK+
Sbjct:   34 LFISCVDSRVVPNLITGTQPGELYVIRNMGNVIPPKTSY--KESLSTIASVEYAIAHVGVQNLIICGHSDCGA-----------------CGSIHLIHDETTKAKTPYIANWIQFL-EPIKEELKNHPQFSNHFAKRSWLT-----ERLNARLQLNNLLSYDFIQERVINNELKI 183          
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Match: sp|P0ABE9|CYNT_ECOLI (Carbonic anhydrase 1 OS=Escherichia coli (strain K12) OX=83333 GN=cynT PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.358e-11
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISD-----YIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLS 353
            M EII   + FQ+          ++++       + ISC D R++P   T+   G L+V+RNAGN VP+Y      E      ++E AV    + DI+I GHS+C AM  ++
Sbjct:    1 MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLVPELVTQREPGDLFVIRNAGNIVPSY----GPEPGGVSASVEYAVAALRVSDIVICGHSNCGAMTAIA 108          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A2G9V396 (Carbonic anhydrase (Fragment) OS=Teladorsagia circumcincta OX=45464 GN=TELCIR_00957 PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 9.200e-42
Identity = 89/243 (36.63%), Postives = 138/243 (56.79%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISDY-----IMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHH---NEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDT--NLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            MN ++  +V F++ +        EEIS++     +M +C+D R++P  FT+  +G ++VVRNAGN +P   H+   +E  I++E  A+ELAV    I+ II+ GHSDCKAM+ L  L H     ++   P+  W R+ G  S K+  + L   +K ++F+    PS    A ID    LP+ D LSQIN LQQ EN+A+ +FL++   +  L LH +W +I S +D    YLF    ++F+ I
Sbjct:   38 MNRVLRGVVKFRQTLRKELVKQFEEISNHPKPTAVMFTCMDSRMLPTHFTQSYVGDMFVVRNAGNMIPDAPHYGTSSEISITTEPAALELAVTRGGIRHIIVCGHSDCKAMNLLHSL-HQCPKNFDMDSPMDHWVRRNGFRSMKRLNERLHKGAKIMKFETDIAPSQNFEAIIDPFDKLPVEDKLSQINVLQQLENIASHEFLKQYFESGNLFLHGMWFDIYSGDD----YLFSKDKKRFILI 275          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A0N4XIZ5 (Carbonic anhydrase OS=Nippostrongylus brasiliensis OX=27835 GN=NBR_LOCUS2497 PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.801e-39
Identity = 84/243 (34.57%), Postives = 138/243 (56.79%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISDY-----IMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFV---PTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDTN--LPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            MN I+  +V F++ + +  A   +EISD+     +M +C+D R++P  FT+  +G ++VVRNAGN +   P Y   +E  +++E  A+ELAV    I+ I++ GHSDCKAM+ L  L H   + +++  P+  W R+ G  S K+  + L     P++F+    PS    A +D    LP+ D LSQIN LQQ  NV++ +FL+    +  + +H +W +I + +D    YLF    ++F+ I
Sbjct:    1 MNRILRGVVKFRQTIRNDLAKQFDEISDHPRPTAVMFTCMDSRMLPTRFTQSNVGDMFVVRNAGNMIPDAPRYGVSSEISVTTEPAALELAVKRGGIRHIVVCGHSDCKAMNLLHSL-HQCCTNFDASSPMDHWVRQNGYRSVKRLTERLHKGGTPLKFESSVAPSQNFEAIVDPFDLLPVEDKLSQINVLQQLVNVSSHEFLQSYFESGLVFVHGMWFDIYNGDD----YLFSKDKKQFVLI 238          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A2G5SUN1 (Carbonic anhydrase OS=Caenorhabditis nigoni OX=1611254 GN=Cnig_chr_X.g24466 PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 4.448e-39
Identity = 85/245 (34.69%), Postives = 136/245 (55.51%), Query Frame = 3
Query:   27 LIMNEIIHRIVNFQKHVSDSEAGDKEEISDY-----IMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPT---YEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYID--TNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
             +MN II  ++ + +++        E +SD+     +M +C+D R++P  FT+  +G ++VVRNAGN +P    Y  ++E  I++E  A+ELAV    I+ +++ GHSDCKAM+ L +L H   ++++   P+ QW R+ G ES KK  + L    K ++F+ +  PS    A ID        D LSQIN LQQ  N++T +FL++ L    L LH  W  I   E    ++LF    ++F+ I
Sbjct:    8 FVMNRIIRGVIKYNQNIKSGLVKQFEHVSDHPNPTAVMFTCMDSRMLPTRFTQSAVGDMFVVRNAGNMIPAAPNYGSYSEVSINTEPAALELAVKRGKIRHVVVCGHSDCKAMNTLYQL-HQCPTKFDVSSPMDQWLRRNGFESMKKLNERLHIGPKTMKFESEVAPSQSFEAIIDPLEKWSAEDKLSQINVLQQIMNISTHEFLKDFLEAGNLHLHGAWFNIYDGE----VFLFSKDRKRFIVI 247          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A2G5SUK0 (Carbonic anhydrase OS=Caenorhabditis nigoni OX=1611254 GN=Cnig_chr_X.g24466 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.260e-38
Identity = 85/243 (34.98%), Postives = 135/243 (55.56%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISDY-----IMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPT---YEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYID--TNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            MN II  ++ + +++        E +SD+     +M +C+D R++P  FT+  +G ++VVRNAGN +P    Y  ++E  I++E  A+ELAV    I+ +++ GHSDCKAM+ L +L H   ++++   P+ QW R+ G ES KK  + L    K ++F+ +  PS    A ID        D LSQIN LQQ  N++T +FL++ L    L LH  W  I   E    ++LF    ++F+ I
Sbjct:    1 MNRIIRGVIKYNQNIKSGLVKQFEHVSDHPNPTAVMFTCMDSRMLPTRFTQSAVGDMFVVRNAGNMIPAAPNYGSYSEVSINTEPAALELAVKRGKIRHVVVCGHSDCKAMNTLYQL-HQCPTKFDVSSPMDQWLRRNGFESMKKLNERLHIGPKTMKFESEVAPSQSFEAIIDPLEKWSAEDKLSQINVLQQIMNISTHEFLKDFLEAGNLHLHGAWFNIYDGE----VFLFSKDRKRFIVI 238          
BLAST of Carbonic anhydrase vs. TrEMBL
Match: A0A084VC30 (Carbonic anhydrase OS=Anopheles sinensis OX=74873 GN=ZHAS_00002311 PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.709e-37
Identity = 84/243 (34.57%), Postives = 129/243 (53.09%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISD-----YIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNS--CGPLSQWTRKYGKESWKKYQKYLQ-DRSKPIQFQLKPQPSPPNNAYID--TNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            M  I+  ++ ++    +    +  ++ D      +  +C+D R+IP  FT+  +G ++VVRNAGN VP  EH  ++  S E  A+EL    + IK II+ GHSDCKAM+ L +L  PD S   +    PL  W  ++   S  K+Q   Q    KP+ F     P     AYID   N  I D LSQ+N LQQ EN+A++ FL+  L +H L +H +W +I + +    +Y F  + ++F+ I
Sbjct:    1 MERILRGVMRYRHTTREQMVQEFRKVRDNPQPKAVFFTCMDSRMIPTRFTETHVGDMFVVRNAGNLVPHAEHFQDEYFSCEPAALELGCVVNNIKHIIVCGHSDCKAMNLLYQLKDPDFSSLKNRRISPLRAWLCEHANTSLDKFQNLKQIGLDKPLIFS-SETPLRKFVAYIDPENNFAIEDKLSQVNTLQQIENIASYGFLKRRLESHDLHIHALWFDIYTGD----IYFFSRNSKRFIAI 238          
BLAST of Carbonic anhydrase vs. Ensembl Nematostella
Match: EDO40556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S717])

HSP 1 Score: 106.686 bits (265), Expect = 3.060e-27
Identity = 68/241 (28.22%), Postives = 121/241 (50.21%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISD-----YIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLK-PQPSPPNNAYIDTN--LPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKI 731
            M +I+  +V F+  +  S      E+++      ++++C+D RI+P  +     G ++VVR AGN +P  + + +    SE  A+++A+    ++++++ GHS+CK M FL  L+H DS   N   P   W +K G  S  +++K    +   ++   +      P    ID    L  +D LSQ+N LQQ  N+ +F F+   L    L L+ +W +I   E    +Y+F    +KF+ I
Sbjct:    1 MEKILQGVVRFRHVLRPSLLPSLREVAEKVAPKTVLVACVDCRIMPETYMSSEPGDMFVVRTAGNLLPHAKLYGDVGSCSELAALQMAIQEGKVENVVVCGHSNCKGMTFL--LSH-DSRTDNHYIP---WLKKTGASSLTRFEKVDMSQEGGVKLLFEDATGGEPMEVTIDEGNKLDSVDKLSQVNVLQQLHNLKSFPFISNPLSKGALNLYGLWFDIKEGE----MYMFSRKQKKFVLI 231          
BLAST of Carbonic anhydrase vs. Planmine SMEST
Match: SMESG000035019.1 (SMESG000035019.1)

HSP 1 Score: 486.493 bits (1251), Expect = 1.258e-175
Identity = 234/234 (100.00%), Postives = 234/234 (100.00%), Query Frame = 3
Query:   33 MNEIIHRIVNFQKHVSDSEAGDKEEISDYIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDTNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKIT 734
            MNEIIHRIVNFQKHVSDSEAGDKEEISDYIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDTNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKIT
Sbjct:    1 MNEIIHRIVNFQKHVSDSEAGDKEEISDYIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDTNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKIT 234          
BLAST of Carbonic anhydrase vs. Planmine SMEST
Match: SMESG000035022.1 (SMESG000035022.1)

HSP 1 Score: 308.531 bits (789), Expect = 2.716e-105
Identity = 148/237 (62.45%), Postives = 186/237 (78.48%), Query Frame = 3
Query:   33 MNEIIHRIVNFQK---HVSDSEAGDKEEISDYIMISCIDKRIIPNDFTKVPIGHLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDCKAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQFQLKPQPSPPNNAYIDTNLPILDCLSQINCLQQTENVATFQFLREDLLNHKLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKIT 734
            MN+IIHRI+ +QK      D     + E++DYI+ SCIDKRIIPNDFTKVP+GHLYVVRNAGNFVP Y +    EISSE GAIELAV  + IKDIIISGHSDC+AM++LS  N PD+ E  S GPLSQW +K+G+ESW K+Q +L++   P++FQLKP P+PP+ AY D   P LD LSQINCLQQ+ENVATF FLR +LL++ LK+HT+WKE+++  +DPTL+LFD++ EKFLKIT
Sbjct:    1 MNKIIHRIIKYQKIGRQSFDLHKVREPEVNDYILFSCIDKRIIPNDFTKVPVGHLYVVRNAGNFVPPY-NRGSHEISSEAGAIELAVKRAGIKDIIISGHSDCRAMEYLSNSNKPDTEECKSHGPLSQWVKKFGRESWVKFQMFLKNPKHPLKFQLKPPPTPPDLAYFDDKFPKLDILSQINCLQQSENVATFPFLRSELLDNSLKIHTLWKELNAVGEDPTLFLFDINKEKFLKIT 236          
The following BLAST results are available for this feature:
BLAST of Carbonic anhydrase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bca-16.915e-4033.74Beta carbonic anhydrase 1 [Source:UniProtKB/Swiss... [more]
bca-16.915e-4033.74Beta carbonic anhydrase 1 [Source:UniProtKB/Swiss... [more]
bca-21.517e-3532.24Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D... [more]
bca-21.767e-2928.28Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D... [more]
bca-23.227e-2835.45Carbonic anhydrase [Source:UniProtKB/TrEMBL;Acc:D... [more]
back to top
BLAST of Carbonic anhydrase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CAHbeta4.251e-3632.10gene:FBgn0037646 transcript:FBtr0081958[more]
back to top
BLAST of Carbonic anhydrase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8XKV0|BCA1_CAEBR1.203e-4034.98Beta carbonic anhydrase 1 OS=Caenorhabditis briggs... [more]
sp|Q22460|BCA1_CAEEL8.796e-3933.74Beta carbonic anhydrase 1 OS=Caenorhabditis elegan... [more]
sp|P27134|CYNT_SYNE75.478e-1427.98Carbonic anhydrase OS=Synechococcus elongatus (str... [more]
sp|Q9ZN54|CYNT_HELPJ8.992e-1428.57Carbonic anhydrase OS=Helicobacter pylori (strain ... [more]
sp|P0ABE9|CYNT_ECOLI1.358e-1133.04Carbonic anhydrase 1 OS=Escherichia coli (strain K... [more]
back to top
BLAST of Carbonic anhydrase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G9V3969.200e-4236.63Carbonic anhydrase (Fragment) OS=Teladorsagia circ... [more]
A0A0N4XIZ53.801e-3934.57Carbonic anhydrase OS=Nippostrongylus brasiliensis... [more]
A0A2G5SUN14.448e-3934.69Carbonic anhydrase OS=Caenorhabditis nigoni OX=161... [more]
A0A2G5SUK01.260e-3834.98Carbonic anhydrase OS=Caenorhabditis nigoni OX=161... [more]
A0A084VC304.709e-3734.57Carbonic anhydrase OS=Anopheles sinensis OX=74873 ... [more]
back to top
BLAST of Carbonic anhydrase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO405563.060e-2728.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Carbonic anhydrase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000035019.11.258e-175100.00SMESG000035019.1[more]
SMESG000035022.12.716e-10562.45SMESG000035022.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023132 ID=SMED30023132|Name=Carbonic anhydrase|organism=Schmidtea mediterranea sexual|type=transcript|length=981bp
TAAAAGTTGTTTTTGTTTATCAATAATTAATTATGAATGAAATAATTCAT
CGAATTGTAAATTTTCAAAAACATGTATCTGATTCTGAAGCAGGTGATAA
GGAGGAAATTAGTGACTACATAATGATTTCTTGTATTGACAAGAGAATAA
TTCCAAATGATTTTACCAAAGTTCCGATTGGCCATCTATATGTTGTAAGG
AATGCTGGAAATTTTGTTCCCACTTATGAACATCATAATGAGAAAGAGAT
CTCGAGTGAAGGAGGTGCAATTGAATTGGCAGTCTGTCATTCATTAATTA
AAGATATTATTATTTCTGGCCATTCCGATTGCAAAGCTATGGACTTTCTT
TCTAAGTTGAATCACCCTGATTCTTCTGAATATAATTCTTGTGGCCCATT
AAGCCAATGGACTAGAAAGTATGGCAAAGAAAGCTGGAAAAAATACCAAA
AATATCTGCAGGATCGAAGCAAACCTATACAATTTCAATTAAAACCTCAG
CCATCTCCACCAAATAATGCTTACATTGATACAAATCTTCCTATTTTGGA
TTGCTTATCACAAATAAACTGTTTACAGCAAACCGAAAACGTGGCAACCT
TTCAGTTTCTAAGGGAAGACTTATTGAACCATAAGTTAAAACTCCATACG
GTCTGGAAAGAGATATCGTCCAGTGAAGATGATCCAACTTTGTACTTATT
TGATGTTCACGATGAAAAATTTTTAAAGATTACCGATGAATCTTCGGATC
ATCTAATTCATGATTTAGATGATTAATATTGCAATGCTCGTGTTTAAACA
GTATTTCTTTAGCATAGAGTTATTATATTTAGGGTCTAGTTGGTGATTTT
CAATAAACAATTTATTTTTTGGTATTCTCATTTCCTATTTCCTTAGATCA
GTTTCCATAGAGTTCGATATTTTTAGTCTACTGTTATGATAATTATGTAT
TTGATTACTTACTTTTTAATATACTTTTTCC
back to top

protein sequence of SMED30023132-orf-1

>SMED30023132-orf-1 ID=SMED30023132-orf-1|Name=SMED30023132-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MNEIIHRIVNFQKHVSDSEAGDKEEISDYIMISCIDKRIIPNDFTKVPIG
HLYVVRNAGNFVPTYEHHNEKEISSEGGAIELAVCHSLIKDIIISGHSDC
KAMDFLSKLNHPDSSEYNSCGPLSQWTRKYGKESWKKYQKYLQDRSKPIQ
FQLKPQPSPPNNAYIDTNLPILDCLSQINCLQQTENVATFQFLREDLLNH
KLKLHTVWKEISSSEDDPTLYLFDVHDEKFLKITDESSDHLIHDLDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036874Carbonic_anhydrase_sf
IPR001765Carbonic_anhydrase
Vocabulary: molecular function
TermDefinition
GO:0004089carbonate dehydratase activity
GO:0008270zinc ion binding
GO:0016829lyase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001765Carbonic anhydraseSMARTSM00947Pro_CA_2coord: 22..220
e-value: 1.6E-10
score: 50.9
IPR001765Carbonic anhydrasePFAMPF00484Pro_CAcoord: 29..213
e-value: 9.8E-26
score: 90.9
IPR036874Carbonic anhydrase superfamilyGENE3DG3DSA:3.40.1050.10coord: 1..220
e-value: 1.5E-27
score: 98.3
IPR036874Carbonic anhydrase superfamilySUPERFAMILYSSF53056beta-carbonic anhydrase, cabcoord: 28..213
NoneNo IPR availablePANTHERPTHR11002CARBONIC ANHYDRASEcoord: 1..246
NoneNo IPR availablePANTHERPTHR11002:SF49BETA CARBONIC ANHYDRASE 1coord: 1..246