FERM domain-containing protein

Overview
NameFERM domain-containing protein
Smed IDSMED30023129
Length (bp)2677
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FERM domain-containing protein (SMED30023129) t-SNE clustered cells

Violin plots show distribution of expression levels for FERM domain-containing protein (SMED30023129) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FERM domain-containing protein (SMED30023129) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FERM domain-containing protein (SMED30023129) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023129

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30023129SMESG000077981.1 dd_Smed_v4_10131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023129SMESG000077981.1 dd_Smed_v6_10131_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023129SMESG000077981.1 dd_Smed_v4_10131_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30023129SMESG000077981.1 dd_Smed_v4_10131_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: EPB41L4A (erythrocyte membrane protein band 4.1 like 4A [Source:HGNC Symbol;Acc:HGNC:13278])

HSP 1 Score: 136.346 bits (342), Expect = 2.264e-32
Identity = 93/314 (29.62%), Postives = 149/314 (47.45%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDE 995
            M C       F   +  LD++K         +    KGS VL  + + + + + +YFGL+Y DR  + +W++  KTL    +  ++I +      P + + F +++Y  DP  + +E  RYQ FLQ+++D+   +L     T    L    +QS+ GD+   +    YV +          LEE I+  H  L G  P EAE  +L   + LE YG  L+PV   N    F GLTP G  +   K+    Y  FWPRI+ +  K  Q    ++ K+  + S   +FE   K  C  L+K S++H  FF++ ++E
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTL---AEHKELINTG-----PPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQ-LGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQIPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGKY--FWPRITKVHFKETQFELRVLGKDCNETS--FFFEARSKTACKHLWKCSVEHHTFFRMPENE 301          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: EPB41L4A (erythrocyte membrane protein band 4.1 like 4A [Source:HGNC Symbol;Acc:HGNC:13278])

HSP 1 Score: 136.346 bits (342), Expect = 2.264e-32
Identity = 93/314 (29.62%), Postives = 149/314 (47.45%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDE 995
            M C       F   +  LD++K         +    KGS VL  + + + + + +YFGL+Y DR  + +W++  KTL    +  ++I +      P + + F +++Y  DP  + +E  RYQ FLQ+++D+   +L     T    L    +QS+ GD+   +    YV +          LEE I+  H  L G  P EAE  +L   + LE YG  L+PV   N    F GLTP G  +   K+    Y  FWPRI+ +  K  Q    ++ K+  + S   +FE   K  C  L+K S++H  FF++ ++E
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTL---AEHKELINTG-----PPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQ-LGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQIPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGKY--FWPRITKVHFKETQFELRVLGKDCNETS--FFFEARSKTACKHLWKCSVEHHTFFRMPENE 301          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD5 (FERM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:28214])

HSP 1 Score: 125.176 bits (313), Expect = 2.552e-29
Identity = 86/305 (28.20%), Postives = 153/305 (50.16%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIV----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            R +   +  LDD++    +    KG  +   + + + + +K+YFG++++D  ++ HW+   K++  QL+           S+P F + F V++YP DP ++ +E  RY +FLQI++DL   +LL K     ++L   ILQ++ GD+ + +    Y    Q    H  +  LE KI   H  +L G  P  +E  FL K + LE YG   +P KD +    F   TP GF +   + +   + I W  ++ ++ +G+   +    KE+  I   ++  T E   C  L+K  +++ AF+KL+K  +
Sbjct:   15 REYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR-----------SQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDA-ALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKH--SEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVL--QGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEA--CKHLWKCGIENQAFYKLEKSSQ 301          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD5 (FERM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:28214])

HSP 1 Score: 124.405 bits (311), Expect = 6.025e-29
Identity = 86/305 (28.20%), Postives = 153/305 (50.16%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIV----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            R +   +  LDD++    +    KG  +   + + + + +K+YFG++++D  ++ HW+   K++  QL+           S+P F + F V++YP DP ++ +E  RY +FLQI++DL   +LL K     ++L   ILQ++ GD+ + +    Y    Q    H  +  LE KI   H  +L G  P  +E  FL K + LE YG   +P KD +    F   TP GF +   + +   + I W  ++ ++ +G+   +    KE+  I   ++  T E   C  L+K  +++ AF+KL+K  +
Sbjct:   15 REYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR-----------SQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDA-ALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKH--SEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVL--QGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEA--CKHLWKCGIENQAFYKLEKSSQ 301          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD5 (FERM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:28214])

HSP 1 Score: 118.242 bits (295), Expect = 2.676e-27
Identity = 82/282 (29.08%), Postives = 144/282 (51.06%), Query Frame = 3
Query:  174 KGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIV----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            KG  +   + + + + +K+YFG++++D  ++ HW+   K++  QL+           S+P F + F V++YP DP ++ +E  RY +FLQI++DL   +LL K     ++L   ILQ++ GD+ + +    Y    Q    H  +  LE KI   H  +L G  P  +E  FL K + LE YG   +P KD +    F   TP GF +   + +   + I W  ++ ++ +G+   +    KE+  I   ++  T E   C  L+K  +++ AF+KL+K  +
Sbjct:    4 KGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR-----------SQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDA-ALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKH--SEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVL--QGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEA--CKHLWKCGIENQAFYKLEKSSQ 267          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 115.546 bits (288), Expect = 1.868e-26
Identity = 84/303 (27.72%), Postives = 144/303 (47.52%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTS-VDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLK----LRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQG-FSLRYPKESNLNYEIFWPRISAIRRKGRQI--IVKEKTDISKKHYFETGEKILCLS-------LYKLSLDHFAFFKLK 986
            +  LD       VP    GS +   +  S+ +E+++YFGL+Y D F   HW++  K +  Q+           +  P F + F V+++  +P+S + +E  RYQ FLQI++D+ S +L    +  +  L    LQS+ GD+        +    IS    +P  +EK++ E L+     RG  P +AE  +L K RW+E YG  ++ V+  +      GLTPQG      P++  L     W ++  +  K ++I  +V+E  D S     +    +  L+        +K +++  AFF+LK
Sbjct:   55 VLLLDGAHLNIVVPRNAVGSELYEEVFYSLDLEERDYFGLQYTDPFNVQHWLDPTKKVAKQV-----------AIGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQLAIE-LAAFALQSELGDYNPELHTALF----ISEFRFHPEQDEKMEVEILERYKACRGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGL---FLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLK 338          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 115.161 bits (287), Expect = 2.434e-26
Identity = 84/303 (27.72%), Postives = 144/303 (47.52%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTS-VDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLK----LRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQG-FSLRYPKESNLNYEIFWPRISAIRRKGRQI--IVKEKTDISKKHYFETGEKILCLS-------LYKLSLDHFAFFKLK 986
            +  LD       VP    GS +   +  S+ +E+++YFGL+Y D F   HW++  K +  Q+           +  P F + F V+++  +P+S + +E  RYQ FLQI++D+ S +L    +  +  L    LQS+ GD+        +    IS    +P  +EK++ E L+     RG  P +AE  +L K RW+E YG  ++ V+  +      GLTPQG      P++  L     W ++  +  K ++I  +V+E  D S     +    +  L+        +K +++  AFF+LK
Sbjct:   39 VLLLDGAHLNIVVPRNAVGSELYEEVFYSLDLEERDYFGLQYTDPFNVQHWLDPTKKVAKQV-----------AIGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQLAIE-LAAFALQSELGDYNPELHTALF----ISEFRFHPEQDEKMEVEILERYKACRGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGL---FLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLK 322          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 115.161 bits (287), Expect = 2.434e-26
Identity = 84/303 (27.72%), Postives = 144/303 (47.52%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTS-VDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLK----LRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQG-FSLRYPKESNLNYEIFWPRISAIRRKGRQI--IVKEKTDISKKHYFETGEKILCLS-------LYKLSLDHFAFFKLK 986
            +  LD       VP    GS +   +  S+ +E+++YFGL+Y D F   HW++  K +  Q+           +  P F + F V+++  +P+S + +E  RYQ FLQI++D+ S +L    +  +  L    LQS+ GD+        +    IS    +P  +EK++ E L+     RG  P +AE  +L K RW+E YG  ++ V+  +      GLTPQG      P++  L     W ++  +  K ++I  +V+E  D S     +    +  L+        +K +++  AFF+LK
Sbjct:   39 VLLLDGAHLNIVVPRNAVGSELYEEVFYSLDLEERDYFGLQYTDPFNVQHWLDPTKKVAKQV-----------AIGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQLAIE-LAAFALQSELGDYNPELHTALF----ISEFRFHPEQDEKMEVEILERYKACRGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGL---FLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLK 322          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 115.161 bits (287), Expect = 2.434e-26
Identity = 84/303 (27.72%), Postives = 144/303 (47.52%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTS-VDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLK----LRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQG-FSLRYPKESNLNYEIFWPRISAIRRKGRQI--IVKEKTDISKKHYFETGEKILCLS-------LYKLSLDHFAFFKLK 986
            +  LD       VP    GS +   +  S+ +E+++YFGL+Y D F   HW++  K +  Q+           +  P F + F V+++  +P+S + +E  RYQ FLQI++D+ S +L    +  +  L    LQS+ GD+        +    IS    +P  +EK++ E L+     RG  P +AE  +L K RW+E YG  ++ V+  +      GLTPQG      P++  L     W ++  +  K ++I  +V+E  D S     +    +  L+        +K +++  AFF+LK
Sbjct:   39 VLLLDGAHLNIVVPRNAVGSELYEEVFYSLDLEERDYFGLQYTDPFNVQHWLDPTKKVAKQV-----------AIGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQLAIE-LAAFALQSELGDYNPELHTALF----ISEFRFHPEQDEKMEVEILERYKACRGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGL---FLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLK 322          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 107.457 bits (267), Expect = 2.808e-23
Identity = 77/297 (25.93%), Postives = 140/297 (47.14%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKP-HWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTA---NRFAPHYVRQTISPHL-LNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILY-PVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKL 983
            +   D  ++ F+V    +G A+   +   + +E++EYF L + D+ +   HW+  DK +  Q+K               +   FEV++YP  PT++ D++ RY +FLQ+R+DL + +L    +T  S+L   + Q +FGD  A   + +    V   + P    NP   +KI   H ++RG  P EAE +FL+  + L  YG  L+  + D + +    G+   G ++   ++    +   W  I  I  +     +K K    +K+    YF+    +     +K +++H  FF+L
Sbjct:   29 VLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLP------------WEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADT-HSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIY--QDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRL 310          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: CG34347 (gene:FBgn0085376 transcript:FBtr0334566)

HSP 1 Score: 155.606 bits (392), Expect = 3.267e-38
Identity = 89/301 (29.57%), Postives = 161/301 (53.49%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQ-TISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFK 980
            M C+   SR   + I  LD+T+ + ++     G A+L  +   + + +  YFG++Y+D   + HW++    +  QLK           S+P+ ++ F V++Y  DP  + +E  RYQ+FLQ+++D+   +L +  E + + L   ++QS+ GD+   R +  YV +  + P+  N  LE ++   H +L+G+ P  AE  +L+K++W + YG  L+PV   ++   F GLTP G  +   K +  +Y  +WPRI+ +  KGR  +++        + FET  K  C  L++  ++H AFF+
Sbjct:    1 MNCLCRPSRIMSVRINLLDETEFIHEIKDDLPGQALLDVVFARLNLIETSYFGIRYIDEENQTHWLDPASRISRQLKPK---------SDPY-DLYFGVKFYAADPCKLLEEITRYQLFLQVKQDVLQGRLPVAFE-LAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPNQSNE-LETRVSELHQQLKGMSPSSAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNKTTVAHY--YWPRIAKVYYKGRYFMLRISDKNLSTYGFETPRKSACKHLWRCCVEHHAFFR 287          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: CG34347 (gene:FBgn0085376 transcript:FBtr0290046)

HSP 1 Score: 155.606 bits (392), Expect = 3.511e-38
Identity = 89/301 (29.57%), Postives = 161/301 (53.49%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQ-TISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFK 980
            M C+   SR   + I  LD+T+ + ++     G A+L  +   + + +  YFG++Y+D   + HW++    +  QLK           S+P+ ++ F V++Y  DP  + +E  RYQ+FLQ+++D+   +L +  E + + L   ++QS+ GD+   R +  YV +  + P+  N  LE ++   H +L+G+ P  AE  +L+K++W + YG  L+PV   ++   F GLTP G  +   K +  +Y  +WPRI+ +  KGR  +++        + FET  K  C  L++  ++H AFF+
Sbjct:    1 MNCLCRPSRIMSVRINLLDETEFIHEIKDDLPGQALLDVVFARLNLIETSYFGIRYIDEENQTHWLDPASRISRQLKPK---------SDPY-DLYFGVKFYAADPCKLLEEITRYQLFLQVKQDVLQGRLPVAFE-LAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPNQSNE-LETRVSELHQQLKGMSPSSAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNKTTVAHY--YWPRIAKVYYKGRYFMLRISDKNLSTYGFETPRKSACKHLWRCCVEHHAFFR 287          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0114374)

HSP 1 Score: 120.553 bits (301), Expect = 1.739e-27
Identity = 82/304 (26.97%), Postives = 142/304 (46.71%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTAN----------RFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLK 986
            +  LD+T    ++  K  GS +   +  ++ + +K+YFGL+++D     HW++  K +  Q+K             P +    +V++Y  +P ++ +E  RY  FLQ+++DL   +L   ++     LC L LQS+ GD+             RF P               LE  I  E+   RG+ P +AE  FL K +WL+ YG  ++ V   +      GLTP G  L + ++  +    FWP+IS +  ++K   +IV E  D  ++      F    +  C  L+K +++H  FF+L+
Sbjct:   62 VILLDNTDLSIELSKKALGSFLYEQVFYALDIIEKDYFGLQFMDANHVKHWLDPTKPIKKQVKIG-----------PPYTFRLKVKFYSSEPNTLREELTRYLFFLQLKQDLLEGRLDCPEDKATE-LCALALQSELGDYDNQEHSAATVSEFRFVPEQTED----------LEIAILDEYKTCRGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGI-LVFERDQKIGL-FFWPKISKLDFKKKKLTLIVIEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLR 341          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0114376)

HSP 1 Score: 120.553 bits (301), Expect = 1.785e-27
Identity = 82/298 (27.52%), Postives = 144/298 (48.32%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPF----LEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLK 986
            +  LD+T    ++  K  GS +   +  ++ + +K+YFGL+++D     HW++  K +  Q+K             P +    +V++Y  +P ++ +E  RY  FLQ+++DL   +L   ++     LC L LQS+ GD+        +   T+S     P     LE  I  E+   RG+ P +AE  FL K +WL+ YG  ++ V   +      GLTP G  L + ++  +    FWP+IS +  ++K   +IV E  D  ++      F    +  C  L+K +++H  FF+L+
Sbjct:   62 VILLDNTDLSIELSKKALGSFLYEQVFYALDIIEKDYFGLQFMDANHVKHWLDPTKPIKKQVKIG-----------PPYTFRLKVKFYSSEPNTLREELTRYLFFLQLKQDLLEGRLDCPEDKATE-LCALALQSELGDYDNQE----HSAATVSEFRFVPEQTEDLEIAILDEYKTCRGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGI-LVFERDQKIGL-FFWPKISKLDFKKKKLTLIVIEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLR 341          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0082793)

HSP 1 Score: 120.553 bits (301), Expect = 1.857e-27
Identity = 82/298 (27.52%), Postives = 144/298 (48.32%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPF----LEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLK 986
            +  LD+T    ++  K  GS +   +  ++ + +K+YFGL+++D     HW++  K +  Q+K             P +    +V++Y  +P ++ +E  RY  FLQ+++DL   +L   ++     LC L LQS+ GD+        +   T+S     P     LE  I  E+   RG+ P +AE  FL K +WL+ YG  ++ V   +      GLTP G  L + ++  +    FWP+IS +  ++K   +IV E  D  ++      F    +  C  L+K +++H  FF+L+
Sbjct:   62 VILLDNTDLSIELSKKALGSFLYEQVFYALDIIEKDYFGLQFMDANHVKHWLDPTKPIKKQVKIG-----------PPYTFRLKVKFYSSEPNTLREELTRYLFFLQLKQDLLEGRLDCPEDKATE-LCALALQSELGDYDNQ----EHSAATVSEFRFVPEQTEDLEIAILDEYKTCRGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGI-LVFERDQKIGL-FFWPKISKLDFKKKKLTLIVIEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLR 341          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:30470])

HSP 1 Score: 130.568 bits (327), Expect = 8.578e-31
Identity = 89/315 (28.25%), Postives = 148/315 (46.98%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADL-SSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDE 995
            M C       F   +  LD++K +       +    +G  V+  + + + + + EYFGL+Y DR  +  W++  KTL          +  DL ++ P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + L  L +QS+ GD+   +    YV +          LE+ I+  H  L G  P EAE  +L   + LE YG  L+PV        F GLTP G  +   K     Y  FWPRI+ +  K  Q    ++ ++  + S   +F+   K  C +L+K  ++H  FF++ ++E
Sbjct:    1 MSCFCSVQEEFYCEVLLLDESKLILTTQQQGIKKSTRGCVVMDYVFSHVNLAETEYFGLRYCDRSHQTFWLDPSKTL---------AEHKDLIATGPPYTLYFGVKFYAEDPGKLKEEITRYQFFLQVKQDVLQGRLPCAF-NISAQLAALAIQSELGDYDPYKHTAGYVSEYRFVPDQKEDLEDSIEQIHKTLLGQVPAEAENNYLAIAKTLEMYGVDLHPVFGEKQAEYFLGLTPVGVVVYKNKTQVGKY--FWPRITKVYFKETQFELRVLGRDCNETS--FFFDAASKTACKNLWKCCVEHHTFFRMPENE 301          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 125.946 bits (315), Expect = 3.232e-29
Identity = 91/337 (27.00%), Postives = 154/337 (45.70%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTAN----------RFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSA----SKEFGYSSDT 1073
            ++ LD T     +P K KG+ +   I   + V +K+YFGL+++D  Q PHW+++ K++  Q+K             P + +   V++Y  +P ++ +E  RY   LQ+++D+ S KL    +T +  L    LQ++ GD+             RF P+              +E  I     + RG  P +AE  +L K +WLE YG  ++ VK  +      GLTP G  L +  E+ +    FWP+I+ +  ++    ++V E  +  K+      F       C  L+K +++H AFF+L+         P ++S  RS        F YS  T
Sbjct:   47 VSLLDGTDVSVDLPKKAKGAELFEQIMYHLDVVEKDYFGLRFMDSAQVPHWLDVTKSIKKQVKIG-----------PPYCLHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFDTTVE-LASYALQAELGDYDPAEHGLDLVSEFRFIPNQTED----------MEVAIYNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGV-LVFEGETKIGL-FFWPKITRLDFKKCKLTLVVVEDDEQGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRG--------PVQKSSARSGFIRMGSRFRYSGKT 351          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 123.635 bits (309), Expect = 2.085e-28
Identity = 92/344 (26.74%), Postives = 155/344 (45.06%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTAN----------RFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQII---------VKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSA----SKEFGYSSDT 1073
            ++ LD T     +P K KG+ +   I   + V +K+YFGL+++D  Q PHW+++ K++  Q+K             P + +   V++Y  +P ++ +E  RY   LQ+++D+ S KL    +T +  L    LQ++ GD+             RF P+              +E  I     + RG  P +AE  +L K +WLE YG  ++ VK  +      GLTP G  L +  E+ +    FWP+I+ +  K  ++          V ++T+  K+      F       C  L+K +++H AFF+L+         P ++S  RS        F YS  T
Sbjct:   47 VSLLDGTDVSVDLPKKAKGAELFEQIMYHLDVVEKDYFGLRFMDSAQVPHWLDVTKSIKKQVKIG-----------PPYCLHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFDTTVE-LASYALQAELGDYDPAEHGLDLVSEFRFIPNQTED----------MEVAIYNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGV-LVFEGETKIGL-FFWPKITRLDFKKCKLTLVVVEDDEQVMQETEEGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRG--------PVQKSSARSGFIRMGSRFRYSGKT 358          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 123.635 bits (309), Expect = 2.164e-28
Identity = 92/344 (26.74%), Postives = 155/344 (45.06%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTAN----------RFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQII---------VKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSA----SKEFGYSSDT 1073
            ++ LD T     +P K KG+ +   I   + V +K+YFGL+++D  Q PHW+++ K++  Q+K             P + +   V++Y  +P ++ +E  RY   LQ+++D+ S KL    +T +  L    LQ++ GD+             RF P+              +E  I     + RG  P +AE  +L K +WLE YG  ++ VK  +      GLTP G  L +  E+ +    FWP+I+ +  K  ++          V ++T+  K+      F       C  L+K +++H AFF+L+         P ++S  RS        F YS  T
Sbjct:   47 VSLLDGTDVSVDLPKKAKGAELFEQIMYHLDVVEKDYFGLRFMDSAQVPHWLDVTKSIKKQVKIG-----------PPYCLHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFDTTVE-LASYALQAELGDYDPAEHGLDLVSEFRFIPNQTED----------MEVAIYNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGV-LVFEGETKIGL-FFWPKITRLDFKKCKLTLVVVEDDEQVMQETEEGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRG--------PVQKSSARSGFIRMGSRFRYSGKT 358          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: farp1 (FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) [Source:ZFIN;Acc:ZDB-GENE-070424-163])

HSP 1 Score: 123.25 bits (308), Expect = 2.635e-28
Identity = 82/307 (26.71%), Postives = 149/307 (48.53%), Query Frame = 3
Query:   93 FPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHY----FETGEKILCLSLYKLSLDHFAFFKLKKDEKP 1001
             P  R   I +  LDDT+ +F+V  +  G A+   + + + + + +YFGL++ D+ +   W++L K +  Q+++ + I            + F V+++P D T + +E  RY   LQI+ DL   +L   +E+  ++L   I+QS+ GDF   +   H +     P      L +KI   H K  G  P E++Y+ LE  R LE YG  L+P KD         +   G  L +   + +N    W ++  +  K ++ ++K + D++        F  G +  C   +K+ +++ AFF+L ++ KP
Sbjct:   35 MPPGRQISIRVQMLDDTQEVFEVSQRAPGKALFDLVCSHLNLVEGDYFGLEFQDQRKMIVWLDLLKPILKQIRRPKNII-----------LRFVVKFFPPDHTQLLEELTRYLFALQIKHDLACGRLTC-NESSAALLVAHIVQSEIGDFDEVQCKQHLLNNKYIPE--QDTLMDKIIGYHRKHVGQTPAESDYQLLEIARRLEMYGVRLHPAKDREGTRLSLAVAHSGV-LVFQGHTKIN-AFNWSKVRKLSFKRKRFLIKLRPDLNSNCQDTLEFMMGSRDCCKVFWKICVEYHAFFRLFEEPKP 325          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:448757])

HSP 1 Score: 134.806 bits (338), Expect = 4.713e-32
Identity = 98/320 (30.63%), Postives = 155/320 (48.44%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTK-----RLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADL-SSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVS 1010
            M C       F   +  LD++K     +   V    KGS VL  +   + + + +YFGL+Y DR  + +W++  KT         I +  DL S+ P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + L    +QS+ GD+   +    YV +          LEE I+  H  L G  P  AE  +L   + LE YG  L+PV   NN   F GLTP G  +   K+    Y  +WPRI+ +  K  Q    ++ K+ T+ S   +FET  K+ C SL+K  ++H  FF++ +++   +S
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLPLTCQQQGVKKSTKGSVVLDYVFRHLNLVEIDYFGLRYCDRNHQTYWLDPMKT---------ISEHRDLISTGPPYTLYFGVKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPF-NIAAQLGAYAIQSELGDYDPFKHVTGYVSEYRFVPDQKEDLEEAIEKIHKTLMGQVPAVAESNYLGVAKSLEMYGVDLHPVYGENNSEYFLGLTPVGLFVYKNKKQVGKY--YWPRITKLHFKETQFEVRVLGKDCTETS--FFFETRNKVSCKSLWKCCVEHHTFFRIPENDSSTLS 306          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:448757])

HSP 1 Score: 134.42 bits (337), Expect = 7.909e-32
Identity = 98/320 (30.63%), Postives = 155/320 (48.44%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTK-----RLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADL-SSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVS 1010
            M C       F   +  LD++K     +   V    KGS VL  +   + + + +YFGL+Y DR  + +W++  KT         I +  DL S+ P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + L    +QS+ GD+   +    YV +          LEE I+  H  L G  P  AE  +L   + LE YG  L+PV   NN   F GLTP G  +   K+    Y  +WPRI+ +  K  Q    ++ K+ T+ S   +FET  K+ C SL+K  ++H  FF++ +++   +S
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLPLTCQQQGVKKSTKGSVVLDYVFRHLNLVEIDYFGLRYCDRNHQTYWLDPMKT---------ISEHRDLISTGPPYTLYFGVKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPF-NIAAQLGAYAIQSELGDYDPFKHVTGYVSEYRFVPDQKEDLEEAIEKIHKTLMGQVPAVAESNYLGVAKSLEMYGVDLHPVYGENNSEYFLGLTPVGLFVYKNKKQVGKY--YWPRITKLHFKETQFEVRVLGKDCTETS--FFFETRNKVSCKSLWKCCVEHHTFFRIPENDSSTLS 306          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:448757])

HSP 1 Score: 132.494 bits (332), Expect = 2.287e-31
Identity = 97/319 (30.41%), Postives = 153/319 (47.96%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVS 1010
            M C       F   +  LD++K         V    KGS VL  +   + + + +YFGL+Y DR  + +W++  KT         I +  DL + P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + L    +QS+ GD+   +    YV +          LEE I+  H  L G  P  AE  +L   + LE YG  L+PV   NN   F GLTP G  +   K+    Y  +WPRI+ +  K  Q    ++ K+ T+ S   +FET  K+ C SL+K  ++H  FF++ +++   +S
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLPLTCQQQGVKKSTKGSVVLDYVFRHLNLVEIDYFGLRYCDRNHQTYWLDPMKT---------ISEHRDLITGPPYTLYFGVKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPF-NIAAQLGAYAIQSELGDYDPFKHVTGYVSEYRFVPDQKEDLEEAIEKIHKTLMGQVPAVAESNYLGVAKSLEMYGVDLHPVYGENNSEYFLGLTPVGLFVYKNKKQVGKY--YWPRITKLHFKETQFEVRVLGKDCTETS--FFFETRNKVSCKSLWKCCVEHHTFFRIPENDSSTLS 305          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:448757])

HSP 1 Score: 130.954 bits (328), Expect = 1.039e-30
Identity = 98/311 (31.51%), Postives = 149/311 (47.91%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADL-SSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKL 983
            M C       F   +  LD++K         V    KGS VL  +   + + + +YFGL+Y DR  + +W++  KT         I +  DL S+ P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + L    +QS+ GD+   +    YV +          LEE I+  H  L G  P  AE  +L   + LE YG  L+PV   NN   F GLTP G  +   K+    Y  +WPRI+ +  K  Q    ++ K+ T+ S   +FET  K+ C SL+K  ++H  FF+L
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLPLTCQQQGVKKSTKGSVVLDYVFRHLNLVEIDYFGLRYCDRNHQTYWLDPMKT---------ISEHRDLISTGPPYTLYFGVKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPF-NIAAQLGAYAIQSELGDYDPFKHVTGYVSEYRFVPDQKEDLEEAIEKIHKTLMGQVPAVAESNYLGVAKSLEMYGVDLHPVYGENNSEYFLGLTPVGLFVYKNKKQVGKY--YWPRITKLHFKETQFEVRVLGKDCTETS--FFFETRNKVSCKSLWKCCVEHHTFFRL 297          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:448757])

HSP 1 Score: 130.183 bits (326), Expect = 1.486e-30
Identity = 98/320 (30.63%), Postives = 154/320 (48.12%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADL-SSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVS 1010
            M C       F   +  LD++K         V    KGS VL  +   + + + +YFGL+Y DR  + +W++  KT         I +  DL S+ P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + L    +QS+ GD+   +    YV +          LEE I+  H  L G  P  AE  +L   + LE YG  L+PV   NN   F GLTP G  +   K+    Y  +WPRI+ +  K  Q    ++ K+ T+ S   +FET  K+ C SL+K  ++H  FF++ +++   +S
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLPLTCQQQGVKKSTKGSVVLDYVFRHLNLVEIDYFGLRYCDRNHQTYWLDPMKT---------ISEHRDLISTGPPYTLYFGVKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPF-NIAAQLGAYAIQSELGDYDPFKHVTGYVSEYRFVPDQKEDLEEAIEKIHKTLMGQVPAVAESNYLGVAKSLEMYGVDLHPVYGENNSEYFLGLTPVGLFVYKNKKQVGKY--YWPRITKLHFKETQFEVRVLGKDCTETS--FFFETRNKVSCKSLWKCCVEHHTFFRIPENDSSTLS 306          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Epb41l4a (erythrocyte membrane protein band 4.1 like 4a [Source:MGI Symbol;Acc:MGI:103007])

HSP 1 Score: 132.88 bits (333), Expect = 1.797e-31
Identity = 91/310 (29.35%), Postives = 144/310 (46.45%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKL 983
            M C       F   +  LD++K         +    KGS VL  +   I + + +YFGL+Y DR  + +W++  KTL    +  ++I +      P + + F +++Y  DP  + +E  RYQ FLQ+++D    +L      I + +    +Q++ GD    +    YV +          LEE I+  H  L G  P EAE  +L   + LE YG  L+PV   N    F GLTP G  +   K+    Y  FWPRI+ +  K  Q    ++ K+  + S   +FE   K  C  L+K S++H  FF++
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFRHINLVEIDYFGLRYCDRSHQTYWLDPAKTL---AEHKELINTG-----PPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDALQGRLPCP-VNIAAQMGAYAIQAELGDHDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQAPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPSGVVVYKNKKQVGKY--FWPRITKVHFKETQFELRVLGKDCNETS--FFFEARSKTACKHLWKCSVEHHTFFRM 297          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd5 (FERM domain containing 5 [Source:MGI Symbol;Acc:MGI:2442557])

HSP 1 Score: 124.405 bits (311), Expect = 2.996e-29
Identity = 86/305 (28.20%), Postives = 153/305 (50.16%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIV----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            R +   +  LDD++    +    KG  +   + + + + +K+YFG++++D  ++ HW+   K++  QL+           S+P F + F V++YP DP ++ +E  RY +FLQI++DL   +LL K     ++L   ILQ++ GD+   +    Y    Q    H  +  LE+KI   H  +L G  P  +E  FL K + LE YG   +P KD +    F   TP GF +   + +   + I W  ++ ++ +G+   +    KE+  I   ++  T E   C  L+K  +++ AF+KL+K  +
Sbjct:   15 REYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR-----------SQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDA-ALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKH--SEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVL--QGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEA--CKHLWKCGIENQAFYKLEKSSQ 301          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd5 (FERM domain containing 5 [Source:MGI Symbol;Acc:MGI:2442557])

HSP 1 Score: 124.405 bits (311), Expect = 4.863e-29
Identity = 86/305 (28.20%), Postives = 153/305 (50.16%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIV----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            R +   +  LDD++    +    KG  +   + + + + +K+YFG++++D  ++ HW+   K++  QL+           S+P F + F V++YP DP ++ +E  RY +FLQI++DL   +LL K     ++L   ILQ++ GD+   +    Y    Q    H  +  LE+KI   H  +L G  P  +E  FL K + LE YG   +P KD +    F   TP GF +   + +   + I W  ++ ++ +G+   +    KE+  I   ++  T E   C  L+K  +++ AF+KL+K  +
Sbjct:   15 REYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR-----------SQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDA-ALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKH--SEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVL--QGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEA--CKHLWKCGIENQAFYKLEKSSQ 301          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:MGI Symbol;Acc:MGI:103006])

HSP 1 Score: 120.939 bits (302), Expect = 1.409e-27
Identity = 94/336 (27.98%), Postives = 157/336 (46.73%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKL---------RGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSA----SKEFGYSSDT 1073
            ++ LD T     +P K KG  +   I   + + + +YFGL+++D  Q  HW++  K++  Q+K    I S        + +   V++Y  +P ++ +E  RY   LQ+++D+ S KL    +T +  L    LQ++ GD+     A H      SP L++ F    I+ E ++L         RG  P +AE  +L K +WLE YG  ++ VK  +      GLTP G  L +  E+ +    FWP+I+ +  ++    ++V E  D  K+      F       C  L+K +++H AFF+L+         P ++S  RS        F YS  T
Sbjct:   47 VSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVK----IGSP-------YCLHLRVKFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQ-LAAYNLQAELGDYD---LAEH------SPELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGV-LVFEGETKIGL-FFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRG--------PVQKSSHRSGFIRLGSRFRYSGKT 351          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:MGI Symbol;Acc:MGI:103006])

HSP 1 Score: 120.553 bits (301), Expect = 1.771e-27
Identity = 94/336 (27.98%), Postives = 157/336 (46.73%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKL---------RGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSA----SKEFGYSSDT 1073
            ++ LD T     +P K KG  +   I   + + + +YFGL+++D  Q  HW++  K++  Q+K    I S        + +   V++Y  +P ++ +E  RY   LQ+++D+ S KL    +T +  L    LQ++ GD+     A H      SP L++ F    I+ E ++L         RG  P +AE  +L K +WLE YG  ++ VK  +      GLTP G  L +  E+ +    FWP+I+ +  ++    ++V E  D  K+      F       C  L+K +++H AFF+L+         P ++S  RS        F YS  T
Sbjct:   47 VSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVK----IGSP-------YCLHLRVKFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQ-LAAYNLQAELGDYD---LAEH------SPELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGV-LVFEGETKIGL-FFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRG--------PVQKSSHRSGFIRLGSRFRYSGKT 351          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9HCS5|E41LA_HUMAN (Band 4.1-like protein 4A OS=Homo sapiens OX=9606 GN=EPB41L4A PE=1 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 1.087e-31
Identity = 93/314 (29.62%), Postives = 149/314 (47.45%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDE 995
            M C       F   +  LD++K         +    KGS VL  + + + + + +YFGL+Y DR  + +W++  KTL    +  ++I +      P + + F +++Y  DP  + +E  RYQ FLQ+++D+   +L     T    L    +QS+ GD+   +    YV +          LEE I+  H  L G  P EAE  +L   + LE YG  L+PV   N    F GLTP G  +   K+    Y  FWPRI+ +  K  Q    ++ K+  + S   +FE   K  C  L+K S++H  FF++ ++E
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTL---AEHKELINTG-----PPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQ-LGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQIPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGKY--FWPRITKVHFKETQFELRVLGKDCNETS--FFFEARSKTACKHLWKCSVEHHTFFRMPENE 301          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|P52963|E41LA_MOUSE (Band 4.1-like protein 4A OS=Mus musculus OX=10090 GN=Epb41l4a PE=2 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 1.257e-30
Identity = 91/310 (29.35%), Postives = 144/310 (46.45%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKL 983
            M C       F   +  LD++K         +    KGS VL  +   I + + +YFGL+Y DR  + +W++  KTL    +  ++I +      P + + F +++Y  DP  + +E  RYQ FLQ+++D    +L      I + +    +Q++ GD    +    YV +          LEE I+  H  L G  P EAE  +L   + LE YG  L+PV   N    F GLTP G  +   K+    Y  FWPRI+ +  K  Q    ++ K+  + S   +FE   K  C  L+K S++H  FF++
Sbjct:    1 MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFRHINLVEIDYFGLRYCDRSHQTYWLDPAKTL---AEHKELINTG-----PPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDALQGRLPCP-VNIAAQMGAYAIQAELGDHDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQAPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPSGVVVYKNKKQVGKY--FWPRITKVHFKETQFELRVLGKDCNETS--FFFEARSKTACKHLWKCSVEHHTFFRM 297          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|O57457|E41L4_DANRE (Band 4.1-like protein 4 OS=Danio rerio OX=7955 GN=epb4.1l4 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 7.883e-30
Identity = 90/315 (28.57%), Postives = 149/315 (47.30%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADL-SSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDE 995
            M C       F   +  LD++K +       +    +GS VL  + + + + + EYFG++Y DR  +  W++  KTL          +  DL ++ P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + L  L +QS+ GD+   +    YV +          LE+ I+  H  L G  P EAE  +L   + LE YG  L+PV        F GLTP G  +   K     Y  FWPRI+ +  K  Q    ++ ++  + S   +F+   K  C +L+K  ++H  FF++ ++E
Sbjct:    1 MSCFCSVQEEFYCEVLLLDESKLILTTQQQGIKKSTRGSVVLDYVFSHVNLAETEYFGVRYCDRSHQTFWLDPSKTL---------AEHKDLIATGPPYTLYFGVKFYAEDPGKLKEEITRYQFFLQVKQDVLQGRLPCAF-NISAQLAALAIQSELGDYDPYKHTAGYVSEYRFVPDQKEDLEDSIEQIHKTLLGQVPAEAENNYLAIAKTLEMYGVDLHPVFGEKQAEYFLGLTPVGVVVYKNKTQVGKY--FWPRITKVYFKETQFELRVLGRDCNETS--FFFDAASKTACKNLWKCCVEHHTFFRMPENE 301          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P5H6|FRMD5_MOUSE (FERM domain-containing protein 5 OS=Mus musculus OX=10090 GN=Frmd5 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.095e-28
Identity = 86/305 (28.20%), Postives = 153/305 (50.16%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIV----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            R +   +  LDD++    +    KG  +   + + + + +K+YFG++++D  ++ HW+   K++  QL+           S+P F + F V++YP DP ++ +E  RY +FLQI++DL   +LL K     ++L   ILQ++ GD+   +    Y    Q    H  +  LE+KI   H  +L G  P  +E  FL K + LE YG   +P KD +    F   TP GF +   + +   + I W  ++ ++ +G+   +    KE+  I   ++  T E   C  L+K  +++ AF+KL+K  +
Sbjct:   15 REYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR-----------SQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDA-ALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKH--SEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVL--QGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEA--CKHLWKCGIENQAFYKLEKSSQ 301          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7Z6J6|FRMD5_HUMAN (FERM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FRMD5 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.894e-28
Identity = 86/305 (28.20%), Postives = 153/305 (50.16%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIV----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            R +   +  LDD++    +    KG  +   + + + + +K+YFG++++D  ++ HW+   K++  QL+           S+P F + F V++YP DP ++ +E  RY +FLQI++DL   +LL K     ++L   ILQ++ GD+ + +    Y    Q    H  +  LE KI   H  +L G  P  +E  FL K + LE YG   +P KD +    F   TP GF +   + +   + I W  ++ ++ +G+   +    KE+  I   ++  T E   C  L+K  +++ AF+KL+K  +
Sbjct:   15 REYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLR-----------SQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDA-ALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKH--SEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVL--QGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEA--CKHLWKCGIENQAFYKLEKSSQ 301          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A210QRN4 (Band 4.1-like protein 4A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14638 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.189e-41
Identity = 103/292 (35.27%), Postives = 160/292 (54.79%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQ-TISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQII--VKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKK 989
            + FLDDT+ L       KGS +L  +   + + +K+YFGL+YLD   + HW++  K+L  QLK   I         P+  + F V++YP DP  + +E  RYQ +LQ+++D+   +L +  E    +     +QS+ GD+   R  P YV +    P+     LE+ I A H +L G+ P +AE +FL+K++WL+ YG  L+PV   +N   F GLTP G  +   K    NY  FWPRI+ +  KG+  I  VK+K +    + FE   K+ C  L+K  ++H AFF+L++
Sbjct:   43 VLFLDDTEILLPFKGSSKGSVLLDEVYGHLNLVEKDYFGLRYLDTSDQTHWLDNQKSLSSQLKGCSI---------PYL-LYFGVKFYPVDPCKLKEEITRYQFYLQVKRDIVQGRLPVTFEEAAELFA-YAVQSELGDY-GQRLVPGYVSEFRFVPNQTE-ELEDTISALHKRLSGLRPYQAEAKFLDKVKWLDMYGVDLHPVMGESNTEYFLGLTPMGIVVYKNKTKVGNY--FWPRINKVTFKGKIFIIKVKDKNNDEHTYAFELMSKLACKHLWKCCVEHHAFFRLRQ 319          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A3S1BB10 (FERM domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_008144 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.188e-41
Identity = 100/290 (34.48%), Postives = 151/290 (52.07%), Query Frame = 3
Query:  117 ILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIK-DETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHY--FETGEKILCLSLYKLSLDHFAFF 977
              I FLDDT          KG  +L  + + + + +K+YFGL+++D   + HW++  K++  QLK           S PF    F V++Y  DP  + +E  RY  FLQ+++D+   +L +  DE   S LCG  LQS+ GDF        YV +          LE +I   H +  G  P+ AE+RFLEK++WLE YG  L+PV+  ++   F GLTP G  +   K    +Y  FWPR++   +KG+  ++K K   +++H   FE   K  C  L+K S++H AFF
Sbjct:   30 CCIVFLDDTTHQMPYKNNSKGQVLLDQVFDLLDLLEKDYFGLRFVDNSGQAHWLDAQKSISSQLKGC---------SAPF-KFYFGVKFYAADPCKLGEEITRYLFFLQVKRDILQGRLPVTFDEA--SELCGYALQSELGDFDPRVHTAGYVSEFCFVPNQTQELEARISGIHRRCVGATPVMAEHRFLEKVQWLEMYGVDLHPVQGESSVEYFLGLTPTGIVVYKHKSKVASY--FWPRVTKSSQKGKMFMLKVKDKSNEEHLYAFELSTKAACKHLWKCSIEHHAFF 305          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A2S2QH84 (Band 4.1-like protein 4A OS=Sipha flava OX=143950 GN=Epb41l4a_0 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 5.526e-41
Identity = 98/303 (32.34%), Postives = 156/303 (51.49%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVK--EKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKL 983
            M C    +RT    I  LDD + + +V     G  V   +   + + +  YFGL+YLD   + HW++L K +  Q+K ++            F   F V++Y  DP  + +E  RYQ FLQ+++D+   ++ +  E +++ L   ++QS+ GDF   R  P YV +       N  LE +I   H +L G  P  AE  FL+K++WL+ YG  L+PV   +N   + GLTP G  +   K    NY  +WPRI+ I  KG+  +++  +K +    + FET  +  C  LYK S++H +FF+L
Sbjct:    1 MGCFCTSARTHHCKIVLLDDQELVHEVQGSSTGQEVFDVVVRHLSLLETAYFGLRYLDSQNQTHWLDLSKKMNKQMKGNE-----------NFTFYFGVKFYAADPCKLVEEITRYQFFLQLKQDILQGRVPVTQE-LMAELGAYVVQSELGDFDPRRHTPGYVSEFRFVSNQNAELETRIGEIHKELTGQVPAVAELNFLDKVKWLDMYGVDLHPVLGEDNVEYYLGLTPTGVIVLRNKNIVANY--YWPRITKIFSKGKYFMLRVCDKNNDENTYGFETPSRPACKHLYKCSMEHHSFFRL 289          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: J9JWD3 (FERM domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 6.727e-41
Identity = 99/303 (32.67%), Postives = 156/303 (51.49%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVK--EKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKL 983
            M C    +RT    I FLDD + + +V     G  V   +   + + +  YFGL+YLD   + HW++L K +  Q+K ++            F   F V++Y  DP  + +E  RYQ FLQ+++D+   ++ +  E ++S L   ++QS+ GDF   R    YV +       N  LE +I   H +L G  P  AE  FL+K++WL+ YG  L+PV   +N   + GLTP G  +   K    NY  +WPRI+ I  KG+  +++  +K +    + FET  +  C  LYK S++H +FF+L
Sbjct:    1 MGCFCTSARTHHCKIVFLDDQELVHEVQGSSLGQEVFDVVVRHLSLLETAYFGLRYLDSQNQTHWLDLSKKMNKQMKGNE-----------NFTFYFGVKFYAADPCKLVEEITRYQFFLQLKQDILQGRVPVTQE-LMSELGAYVVQSELGDFDPRRHTLGYVSEFRFVSNQNAELENRIGEIHKELTGQVPAVAELNFLDKVKWLDMYGVDLHPVLGEDNVEYYLGLTPTGVIVLRNKNIVANY--YWPRITKIFSKGKYFMLRVCDKNNDENTYGFETPSRPACKHLYKCSMEHHSFFRL 289          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A3S2PJ57 (FERM domain-containing protein OS=Chilo suppressalis OX=168631 GN=evm_002420 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.683e-40
Identity = 94/305 (30.82%), Postives = 161/305 (52.79%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQII--VKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKK 989
            M C+ P  RT    +  LD+ + L ++     G A+L  +   + + +  YFGL+Y+D+  + HW++  K L  QL+ S         +  F+   F +++Y  DP  + +E  RYQ+FLQ+++D+   +L +  + + + L   +LQS+ GD+   R +P YV +        P LE +    H  L G+ P +AE  +L+K++WL+ YG  L+PV   ++   F GL P G  L   K +  NY  +WPR+S +  KGR  +  V +K + +  + FE+  +  C  L++   DH AFF+L++
Sbjct:    1 MDCLCPAPRTLACRVVLLDERELLHEIQDNSTGQALLDVVFKHLDLLETAYFGLRYVDQDNQTHWLDSTKRLRRQLRGSD--------THTFY---FGIKFYAADPCKLLEEITRYQLFLQLKQDVLRGRLPVSFD-LAAELAAFVLQSELGDYDPRRHSPGYVSEFRLLAHQTPELEARAAEIHRTLTGISPAQAELSYLDKVKWLDMYGVDLHPVLGEDSVEYFLGLAPSGLLLLRGKHTVANY--YWPRVSKLYYKGRYFMLRVADKNNETSTYGFESPTRSACRHLWRCCSDHHAFFRLQQ 291          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:103031303])

HSP 1 Score: 134.806 bits (338), Expect = 3.583e-32
Identity = 94/315 (29.84%), Postives = 149/315 (47.30%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADL-SSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDE 995
            M C       F   +  LD+TK         +    KGS VL  + + + + + +YFGL+Y DR  + +W++  KTL          +  DL ++ P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + +  L +QS+ GD+   R    YV +          LEE I+  H  L G  P EAE  +L   + LE YG  L+PV        F GLTP G  +   K     Y  FWPRI+ +  K  Q    ++ K+  + S   +FE   K  C +L+K  ++H  FF++ +++
Sbjct:    1 MSCFCSVQEEFYCEVLLLDETKLTLTSQQQGIKKSTKGSVVLDYVFSHVNLAEIDYFGLRYCDRSHQTYWLDPTKTL---------AEHKDLITTGPPYTLYFGVKFYTEDPCKLKEEITRYQFFLQVKQDVLQGRLPCAF-NISTQMAALAIQSELGDYDPYRHVSGYVSEYRFVPDQKEDLEEAIEQIHKTLMGQTPSEAENNYLSIAKGLEMYGVDLHPVFGEKQSEYFLGLTPVGVVVYKNKTQVGKY--FWPRITKVFFKETQFELRVLGKDCNETS--FFFEAPSKTACKNLWKCCVEHHTFFRMPEND 301          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:103031303])

HSP 1 Score: 134.035 bits (336), Expect = 7.181e-32
Identity = 94/315 (29.84%), Postives = 149/315 (47.30%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADL-SSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDE 995
            M C       F   +  LD+TK         +    KGS VL  + + + + + +YFGL+Y DR  + +W++  KTL          +  DL ++ P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + +  L +QS+ GD+   R    YV +          LEE I+  H  L G  P EAE  +L   + LE YG  L+PV        F GLTP G  +   K     Y  FWPRI+ +  K  Q    ++ K+  + S   +FE   K  C +L+K  ++H  FF++ +++
Sbjct:    1 MSCFCSVQEEFYCEVLLLDETKLTLTSQQQGIKKSTKGSVVLDYVFSHVNLAEIDYFGLRYCDRSHQTYWLDPTKTL---------AEHKDLITTGPPYTLYFGVKFYTEDPCKLKEEITRYQFFLQVKQDVLQGRLPCAF-NISTQMAALAIQSELGDYDPYRHVSGYVSEYRFVPDQKEDLEEAIEQIHKTLMGQTPSEAENNYLSIAKGLEMYGVDLHPVFGEKQSEYFLGLTPVGVVVYKNKTQVGKY--FWPRITKVFFKETQFELRVLGKDCNETS--FFFEAPSKTACKNLWKCCVEHHTFFRMPEND 301          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:103031303])

HSP 1 Score: 132.494 bits (332), Expect = 1.610e-31
Identity = 94/315 (29.84%), Postives = 149/315 (47.30%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLF-----KVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADL-SSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ----IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDE 995
            M C       F   +  LD+TK         +    KGS VL  + + + + + +YFGL+Y DR  + +W++  KTL          +  DL ++ P + + F V++Y  DP  + +E  RYQ FLQ+++D+   +L      I + +  L +QS+ GD+   R    YV +          LEE I+  H  L G  P EAE  +L   + LE YG  L+PV        F GLTP G  +   K     Y  FWPRI+ +  K  Q    ++ K+  + S   +FE   K  C +L+K  ++H  FF++ +++
Sbjct:    1 MSCFCSVQEEFYCEVLLLDETKLTLTSQQQGIKKSTKGSVVLDYVFSHVNLAEIDYFGLRYCDRSHQTYWLDPTKTL---------AEHKDLITTGPPYTLYFGVKFYTEDPCKLKEEITRYQFFLQVKQDVLQGRLPCAF-NISTQMAALAIQSELGDYDPYRHVSGYVSEYRFVPDQKEDLEEAIEQIHKTLMGQTPSEAENNYLSIAKGLEMYGVDLHPVFGEKQSEYFLGLTPVGVVVYKNKTQVGKY--FWPRITKVFFKETQFELRVLGKDCNETS--FFFEAPSKTACKNLWKCCVEHHTFFRMPEND 301          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:103044356])

HSP 1 Score: 122.479 bits (306), Expect = 1.172e-28
Identity = 89/306 (29.08%), Postives = 149/306 (48.69%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIF-WPRISAIRRKGRQIIV----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            R F   +  LDDT+    +    KG  +   I + + + +K+YFG++Y+D  ++ HW+   K++  Q+K           S+P F +   V++YP DP ++ +E  RY +FLQ+++DL   +LL K     +IL   ILQ++ GD+   +    Y    Q    H  +  LE +I   H  +L G  P  +E  FL+K + LE YG   +P KD +    F   TP GF +    + N       W  ++ ++ +G+   V    KE   I   ++  T E   C  L+K  +++ AF+KL+K  +
Sbjct:   15 REFSCTVRLLDDTEYTCTIQRDAKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEFTKSISKQMK-----------SQPPFTMCLRVKFYPPDPAALKEEITRYLVFLQLKRDLYHGRLLCKTSDA-AILAAYILQAEIGDYDPGKHPEGYSSKFQFFPKH--SEKLERRIAEIHKTELIGQTPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVL---QGNKRVHFLKWNEVTKLKFEGKTFHVYANQKEDKKIILTYFAPTPEA--CKHLWKCGVENQAFYKLEKSSQ 301          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:103044356])

HSP 1 Score: 122.865 bits (307), Expect = 1.204e-28
Identity = 89/306 (29.08%), Postives = 149/306 (48.69%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIF-WPRISAIRRKGRQIIV----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            R F   +  LDDT+    +    KG  +   I + + + +K+YFG++Y+D  ++ HW+   K++  Q+K           S+P F +   V++YP DP ++ +E  RY +FLQ+++DL   +LL K     +IL   ILQ++ GD+   +    Y    Q    H  +  LE +I   H  +L G  P  +E  FL+K + LE YG   +P KD +    F   TP GF +    + N       W  ++ ++ +G+   V    KE   I   ++  T E   C  L+K  +++ AF+KL+K  +
Sbjct:   15 REFSCTVRLLDDTEYTCTIQRDAKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEFTKSISKQMK-----------SQPPFTMCLRVKFYPPDPAALKEEITRYLVFLQLKRDLYHGRLLCKTSDA-AILAAYILQAEIGDYDPGKHPEGYSSKFQFFPKH--SEKLERRIAEIHKTELIGQTPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVL---QGNKRVHFLKWNEVTKLKFEGKTFHVYANQKEDKKIILTYFAPTPEA--CKHLWKCGVENQAFYKLEKSSQ 301          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 107.842 bits (268), Expect = 2.671e-25
Identity = 78/283 (27.56%), Postives = 132/283 (46.64%), Query Frame = 3
Query:  168 KQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            K  G  +   +   + + + +YFGL+++D  Q  HW++  K +  Q+K             P +     V++Y  +P ++ +E  RY   LQ+++D+ S KL    ET +  L    LQ++ GD       P  V +       +  +EE I  +    RG  P +AE  +L K +WLE YG  ++ VK  +      GLTP G  L +  E+ +    FWP+I+ +  +R    ++V E  D +K+      F       C  L+K +++H AFF+L+   K
Sbjct:    2 KAVGQDLFDQVMYHLDILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVKIG-----------PPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQ-LATYSLQAELGDCDPVEHNPALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGV-LVFEGENKIGL-FFWPKITRLDFKRTKLTLVVVEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSK 270          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: frmd3 (FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-070523-1])

HSP 1 Score: 109.768 bits (273), Expect = 2.715e-25
Identity = 75/283 (26.50%), Postives = 141/283 (49.82%), Query Frame = 3
Query:  174 KGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKA-----EHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIF-WPRISAIRRKGRQIIV-----KEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKK 989
            KG  ++  + N + + +++YFG++++D  ++ HW++  K++  Q+K            +P F + F V++YP++P+ V +E  RYQ++LQI++D+   +LL       + L   ILQ++ GD+        YV    S   L P L +K++A        +LRG  P  AE  FL + + L+ Y    +P KD +    F G TP GF      + N   ++  W  +  ++ +G+   +     ++KT ++    +       C  L+K  +++ AF+K +K
Sbjct:    8 KGRFLMDHVCNHLDLLERDYFGIRFVDPDKQRHWLDPKKSIVRQMK-----------CQPPFTMCFRVKFYPQEPSKVREEITRYQLYLQIKRDVVHGRLLCPTSEA-AWLGACILQAELGDYNPLDHHDGYV----SAMQLFPRLSQKLEARVAEIHRHELRGQTPAVAEINFLIRAQGLDTYTVDPHPCKDPSGATVFLGFTPAGF---VGFQGNKRVQLLKWMDVGKLKYEGKSFYIHGVQNRKKTVLT----YHAPTPSACKHLWKCGVENQAFYKFEK 267          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 107.457 bits (267), Expect = 2.760e-25
Identity = 78/283 (27.56%), Postives = 132/283 (46.64%), Query Frame = 3
Query:  168 KQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            K  G  +   +   + + + +YFGL+++D  Q  HW++  K +  Q+K             P +     V++Y  +P ++ +E  RY   LQ+++D+ S KL    ET +  L    LQ++ GD       P  V +       +  +EE I  +    RG  P +AE  +L K +WLE YG  ++ VK  +      GLTP G  L +  E+ +    FWP+I+ +  +R    ++V E  D +K+      F       C  L+K +++H AFF+L+   K
Sbjct:    2 KAVGQDLFDQVMYHLDILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVKIG-----------PPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQ-LATYSLQAELGDCDPVEHNPALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGV-LVFEGENKIGL-FFWPKITRLDFKRTKLTLVVVEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSK 270          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 107.071 bits (266), Expect = 4.571e-25
Identity = 78/283 (27.56%), Postives = 132/283 (46.64%), Query Frame = 3
Query:  168 KQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLKKDEK 998
            K  G  +   +   + + + +YFGL+++D  Q  HW++  K +  Q+K             P +     V++Y  +P ++ +E  RY   LQ+++D+ S KL    ET +  L    LQ++ GD       P  V +       +  +EE I  +    RG  P +AE  +L K +WLE YG  ++ VK  +      GLTP G  L +  E+ +    FWP+I+ +  +R    ++V E  D +K+      F       C  L+K +++H AFF+L+   K
Sbjct:    2 KAVGQDLFDQVMYHLDILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVKIG-----------PPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQ-LATYSLQAELGDCDPVEHNPALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGV-LVFEGENKIGL-FFWPKITRLDFKRTKLTLVVVEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSK 270          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 1.452e-22
Identity = 77/305 (25.25%), Postives = 142/305 (46.56%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLD-RFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYV-------RQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLKKDEKP 1001
            I  LD+T    +    + G A+L ++   + + + +YFGL++ D   + P W++  K L  Q+K+S         S   FN  F V+++  DP+ + +E  RY  FLQ+R D+   +L     T  ++L   I+QS+ GD++     P Y+       RQ +         E+++   H +  G+ P +AE+ +L   + +E YG  L+  +D +N     G+T  G ++        N+   W +I  I  K +   V+ + + ++       F  G    C +L+K  ++H  FF++ +   P
Sbjct:   33 INLLDNTAITLRANKSEAGKALLDAVFAHLDLAETDYFGLQFADDSTETPRWLDPTKPLRKQIKRS---------SPYIFN--FRVKFFVTDPSKLQEEYTRYHYFLQLRNDILEARLPCPHNTA-ALLASYIVQSELGDYSETEHLPGYLSDLRFLPRQGLD-------FEKEVAKLHKQHVGMTPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVYNNGVRISNFP--WIKIVKIFFKLKHFFVQLRKEQNETRENIIGFNLGNYRACKTLWKACVEHHTFFRMARPASP 316          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO34391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH7])

HSP 1 Score: 136.732 bits (343), Expect = 9.819e-36
Identity = 91/292 (31.16%), Postives = 153/292 (52.40%), Query Frame = 3
Query:  111 FEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQ-TISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHY-FETGEKILCLSLYKLSLDHFAFFK 980
            F + I+ LDDT+   +     KG  V  ++  ++ + +K+YFGL+Y+D  ++ HW++L K++  Q+K          S +P F + F V++Y  DP  + +E  RYQ FLQI++D+   +LL      L+ L   I+Q++ GD+       +YV +  I P   +  LE KI   H  L G  P  AE  FL+K++ L+ YG   +P KD +N   + GLTP G ++    +    +E  W +I     +G+   V+   D  K +Y F   + + C  L+K +++H AF++
Sbjct:   14 FVVKISLLDDTELTCEFRRDAKGQTVFDTVCKALDLVEKDYFGLRYVDDSKQRHWLDLSKSVIKQMK----------SLKPPFKLFFRVKFYALDPGLIHEEITRYQCFLQIKRDILHGRLLCSYNE-LAELGAYIVQAELGDYDPEDQEDNYVSEFRIVPK-QSEKLENKIADIHRSLSGQVPSVAEKNFLDKVKSLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKVSGFE--WAQIIKCSYEGKVFYVQVHKDDRKANYGFRLPDPLACKHLWKCAVEHHAFYR 291          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO32045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW61])

HSP 1 Score: 127.487 bits (319), Expect = 1.632e-32
Identity = 91/304 (29.93%), Postives = 150/304 (49.34%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDL--GSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQ--IIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFK 980
            M C       F   I  LD+++   ++    KG  VL  + + + + +++YFGL+++++  +  W++  K++  QLK             P + + F V++Y  DP  + +E  RY  FLQ+++D+  GS    I  +T++S     IL ++ GDF    + P YV +          LEEKI   H +L GV P  AEY +L+K +WLE YG  L+ VK  +    F  L P G  + + K +   Y   W +I+ I  KG++  + V+ K D    + F    K  C  L+K  ++H AFF+
Sbjct:    1 MACFGRTPTEFFCHIVLLDESEFPIEITKSTKGFEVLEKVFDHLNLLERDYFGLRFIEKNTQSRWLDPMKSVTKQLKAG-----------PPYLMYFCVKFYAADPNKLHEELTRYLFFLQVKRDIFQGSAPCEIHADTLIS---SFILLAELGDFDYQSYTPGYVSEFRFVPKQTEDLEEKISDCHKRLIGVVPSVAEYMYLDKAKWLEMYGVDLHLVKGEDGVEYFVALKPAGVVVYHNKTAVGTY--LWQKITKIDFKGKKFSLNVQGKEDREYVYVFYLPNKSACKHLWKCCVEHHAFFR 288          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO33626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN5])

HSP 1 Score: 112.464 bits (280), Expect = 3.103e-25
Identity = 100/383 (26.11%), Postives = 168/383 (43.86%), Query Frame = 3
Query:  117 ILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDL--GSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYV-------RQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHY-----FETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSASKEFGYSSDTSDYNQYSDDTFSSYPDSINTTQSSKTTKGFNKPSVPSRNCISDAEESALS 1223
            + +  LDD+   F +  K KG  +   +   + ++++EYFGL Y D+     W++  K +  Q+K+   +              F V++Y  DP  + +E  RY   LQ++KDL  G +K     E+  ++L   ++Q + GDF      P Y+        QT+         E +I   H + R + P + +Y  L+  R LE YG ILYP KD +N          G  + +   S +N  + W +I  +  K ++ ++K   +I   HY     F+   +  C S +K+++   AFF+  + + P    P  R   R +S  F   +     +    D+F S P S   TQS KT         P+RN +    +S+ S
Sbjct:   25 VKVCMLDDSVVKFDIEPKVKGDILYKQVYEYLNLDEREYFGLSYYDKSDNLFWLDQLKPIKKQVKEIGKVL-----------FRFCVKFYTADPAMLQEEYTRYLFALQVKKDLVNGGLKC---SESTAALLASYVVQGELGDFDTLSCRPGYLADFQFFPEQTVDS-------EARISDFHKQHRSLSPTDCDYNLLDVARRLEMYGVILYPAKDKDNVDLELAAANMGI-IVFQSGSKIN-TLSWAKIRKLSFKRKRFLIKLHPEIF-GHYKDVVEFQMASRNACKSFWKVAISTHAFFRQSESQSPPRHRP--RVFSRGSSYRFSGRTQKQIIDSMQ-DSFRSQP-SFQRTQSLKT---------PARNNLPHTSQSSAS 370          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO42892 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S031])

HSP 1 Score: 105.145 bits (261), Expect = 1.157e-24
Identity = 86/326 (26.38%), Postives = 150/326 (46.01%), Query Frame = 3
Query:  168 KQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIK---AEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSL-RYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHYFETGEKILCLS-------LYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSASKEFGYSSDTSDYNQYSDDTFSS 1112
            K KG  ++  +  ++ + +K+YFGL+++D  Q  HW++  K +  Q+K             P + + F V++Y  +P  + +E  RY  FLQ+++D+   KL +   T +  L    LQS  GD+ A      Y+ +      L      K K   +  L  +G+ P E E  FL  ++ ++ YG  L+ V D +      GLTP+G  + R  K+  L+Y   WPRI+ +  K +  ++  + ++  +   +    I  LS       L+K +++H  FF+L K      ++P + S        F YS  T +Y    D   S+
Sbjct:    2 KSKGQELIDLVMKNLDLVEKDYFGLQFMDTHQVGHWLDPTKKIKKQVKIG-----------PPYTLHFRVKFYAAEPHELGEELTRYHFFLQVKQDIARNKLEVPQRTAVD-LAAYSLQSQLGDYDAELHGDDYMAEF--KFFLTKIENWKFKFARSTKLLCKGLNPAECEVNFLRIVKGMDFYGVNLHSVVDQHKIEYELGLTPRGILVAREKKKVGLHY---WPRIAKMTFKKKNYLLDVQEEVGDR---QVHSYIYTLSSAQAAKHLWKCAVEHHTFFRLVKP----ANKPKRTSSFLRFGSRFRYSGRT-EYQTQKDSRLSA 302          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO30224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E3])

HSP 1 Score: 105.145 bits (261), Expect = 6.059e-24
Identity = 69/288 (23.96%), Postives = 143/288 (49.65%), Query Frame = 3
Query:  153 FKVPVKQ--KGSAVLLSIANSIPVEQKEYFGLKYLD-RFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKH------YFETGEKILCLSLYKLSLDHFAFFKLKK 989
            ++ P+ +  KG  +   + + I + +KEYFGL+Y+D +  + +W+  D+++  Q+ K+ +            +  F V++YP +PT++ ++  RYQ  LQ+R+DL   ++   +  I ++L   ++Q++ GD         Y+          P L +KI+A H K  G+ P +AE+++L+ +R L  YG  +Y       +     ++  G  +   + +   +   WP+I +I  K ++  +  +      +      YF+ G +     ++K+ ++H AFF+LK+
Sbjct:   20 YECPIDKTTKGDHLFDQVCDHIGLAEKEYFGLRYIDEKDGQFNWLEGDRSIKRQMGKAPL------------HFYFAVKFYPENPTTLREDITRYQFVLQLREDLLKGRIQCSN-PIHALLASYVMQAELGDLHPEEHEVAYLSDLKFFPKQPPELRQKIEAFHRKHVGMTPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVF--QNNRQMHRFVWPKIISIGFKSKKFSLTLRAPSEDDYYKSTTIYFKCGSQRAAKRVWKVCVEHHAFFRLKE 292          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:NCBI gene;Acc:111946734])

HSP 1 Score: 123.25 bits (308), Expect = 2.376e-28
Identity = 83/304 (27.30%), Postives = 144/304 (47.37%), Query Frame = 3
Query:  123 ITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDF----------TANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAI--RRKGRQIIVKEKTDISKKH----YFETGEKILCLSLYKLSLDHFAFFKLK 986
            ++ LD T     +P K KG  +   I   + + +K+YFGL+++D  Q PHW+++ K++  Q+K             P + +   V++Y  +P ++ +E  RY   LQ+++D+ S KL    +T +  L    LQ++ GD+          +  RF P    +          LE  I +     RG  P +AE  +L K +WLE YG  ++ VK  +      GLTP G  L +  ++ +    FWP+I+ +  R+    ++V E  +  K+      F       C  L+K +++H AFF+L+
Sbjct:   47 VSLLDGTDVSVDLPKKAKGEELFEQIMYHLDIVEKDYFGLRFMDYAQVPHWLDVTKSIKKQVKIG-----------PPYCLHMRVKFYSSEPNNLHEELTRYLFVLQLKQDVLSGKLECPFDTAVE-LGAFSLQAELGDYDPLEHNLDLVSEFRFIPDQTEE----------LERAIYSAWKDCRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGV-LVFEGQTKIGL-FFWPKITRLDFRKSKLTLVVVEDDEQGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLR 326          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:101158442])

HSP 1 Score: 120.168 bits (300), Expect = 7.659e-28
Identity = 83/298 (27.85%), Postives = 148/298 (49.66%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIF-WPRISAIRRKGRQI-IVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKK 989
            R +   +  LDDT+    +    KG  +   I +++ + +K+YFG++Y+D  ++ HW+   K++  Q+K           S+P F +   V++YP DP ++ +E  RY +FLQI++DL   +LL K     ++L   ILQ++ GD+   +    Y  +       +  LE +I   H  ++ G  P  +E  FL+K + LE YG   +P KD +    F   TP GF +    + N       W  ++ ++ +G+   I   + +I   ++  T E   C  L+K  +++ AF+KL+K
Sbjct:   15 REYNCTVRLLDDTEYTCTIQRDAKGQYLFDLICHNLNLLEKDYFGIRYVDPDKQRHWLEFTKSIAKQMK-----------SQPPFTMCLRVKFYPPDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDA-AMLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKQSEKLERRIADIHKTEMIGQTPETSERNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVL---QGNKRVHFLKWNEVTKLKFEGKTFHIYANQKEIILTYFAPTPEA--CKHLWKCGVENQAFYKLEK 295          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: frmd5 (FERM domain-containing protein 5 [Source:NCBI gene;Acc:101175227])

HSP 1 Score: 117.472 bits (293), Expect = 5.364e-27
Identity = 87/308 (28.25%), Postives = 149/308 (48.38%), Query Frame = 3
Query:  105 RTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVR--QTISPHLLNPFLEEKIKAEH-LKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFS----------LRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKK 989
            R     +  LDD++    +    KG  +   I + + + +K+YFG++Y+D  ++ HW+   K++  Q+K           S+P F +   V++YP DP ++ +E  RY +FLQ+++DL   +LL K     ++L   ILQ++ GD+   +    Y    Q    H  +  LE +I   H  +L G  P  +E  FL+K + LE YG   +P KD +    F   TP GF+          L + + + L +E     I A +++ R+II+          YF    +  C  L+K  +++ AF+KL+K
Sbjct:   15 RECNCTVRLLDDSEYTCTIQRDSKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEFTKSIAKQIK-----------SQPPFTMCLRVKFYPPDPAALREEITRYLVFLQVKRDLYHGRLLCKTSDA-ALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKH--SEKLERRIAEIHKTELIGQSPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFTVLQGNRRVHFLTWEEVTKLKFEAKTFHIYANQKEDRKIILT---------YFAPTPEA-CKHLWKCGVENQAFYKLEK 298          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: FARP1 (FERM, ARHGEF and pleckstrin domain-containing protein 1 [Source:NCBI gene;Acc:101165518])

HSP 1 Score: 117.472 bits (293), Expect = 1.859e-26
Identity = 84/307 (27.36%), Postives = 152/307 (49.51%), Query Frame = 3
Query:   93 FPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHY----FETGEKILCLSLYKLSLDHFAFFKLKKDEKP 1001
             P  R   I +  LDDT+ +F V  K  G  +   + + + + + +YFGL+Y +  +   W++  K +Y QL++    K A L        +F V+++P D   + +E  RY   LQI++DL   +L   +E+  +++   I+QS+ GDF  ++   H +     P  + P + +KI   H K  G  P E++Y+ LE  R L+ YG  L+P KD +       +   G  L + + + +N    W +I  +  K ++ ++K K D++  +     F    +  C   +K+ ++H AFF+L ++ KP
Sbjct:   37 MPPGRQVAIRVRMLDDTEEIFDVSQKASGKVLFDLVCSHMNLIEGDYFGLEYQNHQKMIVWLDHIKPIYKQLRRP---KHAIL--------KFSVKFFPPDHAQLLEELTRYLFALQIKQDLCCGRLTC-NESSAALMISHIIQSEIGDFEESQCRSHLLNNNYIPDQM-PLI-DKIMEFHSKHIGQTPAESDYQMLEVARKLDMYGIRLHPAKDRDRTKLSLAVAHTGV-LVFQRHTRIN-AFNWSKIRKLSFKRKRFLIKLKPDLNSSYQDTLEFLMASRDCCKVFWKICVEHHAFFRLFEEPKP 327          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: FARP1 (FERM, ARHGEF and pleckstrin domain-containing protein 1 [Source:NCBI gene;Acc:101165518])

HSP 1 Score: 116.701 bits (291), Expect = 3.287e-26
Identity = 84/307 (27.36%), Postives = 152/307 (49.51%), Query Frame = 3
Query:   93 FPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHY----FETGEKILCLSLYKLSLDHFAFFKLKKDEKP 1001
             P  R   I +  LDDT+ +F V  K  G  +   + + + + + +YFGL+Y +  +   W++  K +Y QL++    K A L        +F V+++P D   + +E  RY   LQI++DL   +L   +E+  +++   I+QS+ GDF  ++   H +     P  + P + +KI   H K  G  P E++Y+ LE  R L+ YG  L+P KD +       +   G  L + + + +N    W +I  +  K ++ ++K K D++  +     F    +  C   +K+ ++H AFF+L ++ KP
Sbjct:   37 MPPGRQVAIRVRMLDDTEEIFDVSQKASGKVLFDLVCSHMNLIEGDYFGLEYQNHQKMIVWLDHIKPIYKQLRRP---KHAIL--------KFSVKFFPPDHAQLLEELTRYLFALQIKQDLCCGRLTC-NESSAALMISHIIQSEIGDFEESQCRSHLLNNNYIPDQM-PLI-DKIMEFHSKHIGQTPAESDYQMLEVARKLDMYGIRLHPAKDRDRTKLSLAVAHTGV-LVFQRHTRIN-AFNWSKIRKLSFKRKRFLIKLKPDLNSSYQDTLEFLMASRDCCKVFWKICVEHHAFFRLFEEPKP 327          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000077981.1 (SMESG000077981.1)

HSP 1 Score: 1400.57 bits (3624), Expect = 0.000e+0
Identity = 684/686 (99.71%), Postives = 684/686 (99.71%), Query Frame = 3
Query:   81 MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSASKEFGYSSDTSDYNQYSDDTFSSYPDSINTTQSSKTTKGFNKPSVPSRNCISDAEESALSRKKRRVIVSKSQTETEDEGFRTYDFSVKNNTFDFSMHTNDIRKPSISHSQSYDRIPPDYIYENRLSKSKAQSNEPIRQKRMRKKVSSQINVEKKYRDHNESNNNSTAGLEVKPAHVRKNRSQVMDTKYPNSETSQIKTRSGELIEEKLIKTQRKLPCPNVLPQSFDSTKKNDNLSSDYRIKQSASTDSIITVKNEDNRVSPTKRMLPNLSAIVPSNHTINPPVPRHRIQPKLPLDQNSSSKTQSVYVDIWFKPAYTNPPPRVPQHSNAIVRVANSQSNFTERPLPVRNYRRPSANQLRTRPESGI 2138
            MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKK QIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSASKEFGYSSDTSDYNQYSDDTFSSYPDSINTTQSSKTTKGFNKPSVPSRNCISDAEESALSRKKRRVIVSKSQTETEDEGFRTYDFSVKNNTFDFSMHTNDIRKPSISHSQSYDRIPPDYIYENRLSKSKAQSNEPIRQKRMRKKVSSQINVEKKYRDHNESNNNSTAGLEVKPAHVRKNRSQVMDTKYPNSETSQIKTRSGELIEEKLIKTQRKLPCPNV PQSFDSTKKNDNLSSDYRIKQSASTDSIITVKNEDNRVSPTKRMLPNLSAIVPSNHTINPPVPRHRIQPKLPLDQNSSSKTQSVYVDIWFKPAYTNPPPRVPQHSNAIVRVANSQSNFTERPLPVRNYRRPSANQLRTRPESGI
Sbjct:    1 MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKCQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEKPLVSEPPKRSCGRSASKEFGYSSDTSDYNQYSDDTFSSYPDSINTTQSSKTTKGFNKPSVPSRNCISDAEESALSRKKRRVIVSKSQTETEDEGFRTYDFSVKNNTFDFSMHTNDIRKPSISHSQSYDRIPPDYIYENRLSKSKAQSNEPIRQKRMRKKVSSQINVEKKYRDHNESNNNSTAGLEVKPAHVRKNRSQVMDTKYPNSETSQIKTRSGELIEEKLIKTQRKLPCPNVPPQSFDSTKKNDNLSSDYRIKQSASTDSIITVKNEDNRVSPTKRMLPNLSAIVPSNHTINPPVPRHRIQPKLPLDQNSSSKTQSVYVDIWFKPAYTNPPPRVPQHSNAIVRVANSQSNFTERPLPVRNYRRPSANQLRTRPESGI 686          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000019493.1 (SMESG000019493.1)

HSP 1 Score: 108.997 bits (271), Expect = 7.607e-24
Identity = 80/304 (26.32%), Postives = 145/304 (47.70%), Query Frame = 3
Query:   96 PKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDF--TANRFAPHYVRQTISPHLLNP--FLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFWPRISAIRRKGRQIIVK----EKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKL 983
            P  +  E L+  LD T+ +F +     G  +  ++ + + + ++EYFG+ Y DR +   W++  K +   +  ++++             EF+V++YP + + V ++  RY + LQ+R+DL   KL      + +IL   ++QS+ GD+   A+R   +   Q ++P       F+ EK+ A H   RG  P EA+  FL+  R L  YG  ++ VK+S       G+   G  L   K   + +   W R+  +  K +++I+      K D  K+  F+  +  L    YK  +DH  FF++
Sbjct:   99 PSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDRCKIMFWLDFTKKITKHVPDNRLV------------FEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCS-FYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFM-EKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFS--WARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRM 386          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000062741.1 (SMESG000062741.1)

HSP 1 Score: 105.145 bits (261), Expect = 4.727e-23
Identity = 86/295 (29.15%), Postives = 137/295 (46.44%), Query Frame = 3
Query:  153 FKVPVKQKGSAVLLSIANSIP-VEQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTSVDDENFR-----YQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFS-LRYPKESNLNYEIFWPRISAIRRKGRQIIVKEKTD-------ISKKHY--FETGEKILCLSLYKLSLDHFAFFKLKK 989
             KV  +  G  +L  +   +  +++K+YFGL+Y D+ ++  WI+L + +Y+QLK +           P F V F +++YP  P     E+ R     Y ++LQ+RKDL S +LL +   +   L    +QS+ GD+ +       +        LN   E KI   H  L G+ P E E +FLEK   L+ YG   + VKD      + GLT +G S  +  + ++L     W  I+ I  +G+  I+    D         KKH   F+    I   +L+K + D   FF L +
Sbjct:   28 IKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDT-----------PSFIVSFRMKHYPASPI----EDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQ-LAAYAVQSEIGDYDSTSEDMRSLSNLKLLPNLNSKTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHL---FKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNR 303          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000007133.1 (SMESG000007133.1)

HSP 1 Score: 102.834 bits (255), Expect = 2.023e-22
Identity = 86/322 (26.71%), Postives = 148/322 (45.96%), Query Frame = 3
Query:   99 KSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPV-EQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTS-VDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKL-----------RGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIF-WPRISAIR-RKGR-QIIVK-----EKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEKP 1001
            K    E  I  LD T   F +  +  G  +     + I V + K YFGL+Y D+    HW+++ K +  QL+             P F + F V+++  DP S + DE  RY    Q++  L S +L   D+ + + +  L LQ + GD+     +P ++ Q         F  E  + E L+L           R + P  A+ +FLEK R L +YG   + +K  N++    GLTP G  L Y  E  +   +F W  ++ +  +K R +++V+     +  D+     F++ + + C  ++K  ++H AF++L+   KP
Sbjct:   29 KDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIG-----------PPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQF-------RFFPESQQTEELELLIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGI-LIY--EGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKP 329          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000007133.1 (SMESG000007133.1)

HSP 1 Score: 102.834 bits (255), Expect = 2.438e-22
Identity = 86/322 (26.71%), Postives = 148/322 (45.96%), Query Frame = 3
Query:   99 KSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPV-EQKEYFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVRYYPRDPTS-VDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSDFGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKL-----------RGVEPIEAEYRFLEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIF-WPRISAIR-RKGR-QIIVK-----EKTDISKKHYFETGEKILCLSLYKLSLDHFAFFKLKKDEKP 1001
            K    E  I  LD T   F +  +  G  +     + I V + K YFGL+Y D+    HW+++ K +  QL+             P F + F V+++  DP S + DE  RY    Q++  L S +L   D+ + + +  L LQ + GD+     +P ++ Q         F  E  + E L+L           R + P  A+ +FLEK R L +YG   + +K  N++    GLTP G  L Y  E  +   +F W  ++ +  +K R +++V+     +  D+     F++ + + C  ++K  ++H AF++L+   KP
Sbjct:   29 KDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIG-----------PPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQF-------RFFPESQQTEELELLIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGI-LIY--EGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKP 329          
The following BLAST results are available for this feature:
BLAST of FERM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPB41L4A2.264e-3229.62erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
EPB41L4A2.264e-3229.62erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
FRMD52.552e-2928.20FERM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
FRMD56.025e-2928.20FERM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
FRMD52.676e-2729.08FERM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frm-21.868e-2627.72FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-22.434e-2627.72FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-22.434e-2627.72FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-22.434e-2627.72FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-12.808e-2325.93FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG343473.267e-3829.57gene:FBgn0085376 transcript:FBtr0334566[more]
CG343473.511e-3829.57gene:FBgn0085376 transcript:FBtr0290046[more]
yrt1.739e-2726.97gene:FBgn0004049 transcript:FBtr0114374[more]
yrt1.785e-2727.52gene:FBgn0004049 transcript:FBtr0114376[more]
yrt1.857e-2727.52gene:FBgn0004049 transcript:FBtr0082793[more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l4a8.578e-3128.25erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
epb41l53.232e-2927.00erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l52.085e-2826.74erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l52.164e-2826.74erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
farp12.635e-2826.71FERM, RhoGEF (ARHGEF) and pleckstrin domain protei... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l4a4.713e-3230.63erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
epb41l4a7.909e-3230.63erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
epb41l4a2.287e-3130.41erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
epb41l4a1.039e-3031.51erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
epb41l4a1.486e-3030.63erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epb41l4a1.797e-3129.35erythrocyte membrane protein band 4.1 like 4a [Sou... [more]
Frmd52.996e-2928.20FERM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
Frmd54.863e-2928.20FERM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
Epb41l51.409e-2727.98erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
Epb41l51.771e-2727.98erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
back to top
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HCS5|E41LA_HUMAN1.087e-3129.62Band 4.1-like protein 4A OS=Homo sapiens OX=9606 G... [more]
sp|P52963|E41LA_MOUSE1.257e-3029.35Band 4.1-like protein 4A OS=Mus musculus OX=10090 ... [more]
sp|O57457|E41L4_DANRE7.883e-3028.57Band 4.1-like protein 4 OS=Danio rerio OX=7955 GN=... [more]
sp|Q6P5H6|FRMD5_MOUSE2.095e-2828.20FERM domain-containing protein 5 OS=Mus musculus O... [more]
sp|Q7Z6J6|FRMD5_HUMAN2.894e-2828.20FERM domain-containing protein 5 OS=Homo sapiens O... [more]
back to top
BLAST of FERM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QRN41.189e-4135.27Band 4.1-like protein 4A OS=Mizuhopecten yessoensi... [more]
A0A3S1BB102.188e-4134.48FERM domain-containing protein (Fragment) OS=Elysi... [more]
A0A2S2QH845.526e-4132.34Band 4.1-like protein 4A OS=Sipha flava OX=143950 ... [more]
J9JWD36.727e-4132.67FERM domain-containing protein OS=Acyrthosiphon pi... [more]
A0A3S2PJ571.683e-4030.82FERM domain-containing protein OS=Chilo suppressal... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l4a3.583e-3229.84erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
epb41l4a7.181e-3229.84erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
epb41l4a1.610e-3129.84erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
si:ch211-69m14.11.172e-2829.08FERM domain containing 5 [Source:NCBI gene;Acc:103... [more]
si:ch211-69m14.11.204e-2829.08FERM domain containing 5 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l52.671e-2527.56erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
frmd32.715e-2526.50FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
epb41l52.760e-2527.56erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l54.571e-2527.56erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
ENSPMAT00000001312.11.452e-2225.25pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343919.819e-3631.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320451.632e-3229.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336263.103e-2526.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428921.157e-2426.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302246.059e-2423.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l52.376e-2827.30erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
si:ch211-69m14.17.659e-2827.85FERM domain containing 5 [Source:NCBI gene;Acc:101... [more]
frmd55.364e-2728.25FERM domain-containing protein 5 [Source:NCBI gene... [more]
FARP11.859e-2627.36FERM, ARHGEF and pleckstrin domain-containing prot... [more]
FARP13.287e-2627.36FERM, ARHGEF and pleckstrin domain-containing prot... [more]
back to top
BLAST of FERM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077981.10.000e+099.71SMESG000077981.1[more]
SMESG000019493.17.607e-2426.32SMESG000019493.1[more]
SMESG000062741.14.727e-2329.15SMESG000062741.1[more]
SMESG000007133.12.023e-2226.71SMESG000007133.1[more]
SMESG000007133.12.438e-2226.71SMESG000007133.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023129 ID=SMED30023129|Name=FERM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2677bp
CTTCCGATCTAGTTCTATGAAAATTAATTGTTTCAATTTGAAATTACAGA
GTCTGTTTCAAATGAAGTGATATTTAATTTATGCAGTGCATATTCCCAAA
ATCTCGTACCTTTGAAATTTTAATCACTTTTCTGGATGATACGAAACGGC
TTTTCAAGGTTCCAGTCAAACAAAAGGGATCAGCCGTTTTATTGTCTATT
GCCAATTCGATTCCTGTTGAGCAAAAAGAATATTTTGGATTAAAATATTT
AGACAGATTTCAAAAACCGCATTGGATTAACCTGGACAAGACGTTATACC
ACCAGTTGAAAAAAAGCCAAATTATCAAATCAGCGGACTTGTCCAGTGAA
CCGTTCTTTAACGTCGAATTTGAGGTTAGATACTACCCGCGTGATCCAAC
TTCAGTCGACGATGAAAATTTCAGGTACCAAATATTTCTACAAATCCGAA
AGGATCTTGGCTCTATGAAGCTTTTGATCAAAGATGAAACAATTTTATCG
ATTTTGTGTGGCCTAATTTTACAGTCGGATTTCGGTGATTTTACAGCAAA
TCGGTTTGCTCCTCATTATGTCAGGCAGACTATTAGTCCGCACTTGTTGA
ATCCATTTTTAGAAGAAAAAATAAAAGCAGAACATTTGAAATTAAGGGGG
GTAGAGCCAATCGAGGCTGAGTATCGATTTCTTGAAAAAATTAGATGGCT
TGAAAATTACGGAACAATATTATATCCAGTAAAAGATAGTAATAATAGAT
ATTGCTTTTTCGGTTTAACTCCTCAAGGATTTTCGCTGCGCTATCCCAAA
GAATCGAATCTTAATTACGAGATATTTTGGCCCAGAATCAGTGCAATTAG
GCGGAAAGGTCGTCAGATTATAGTAAAGGAGAAAACTGATATTTCAAAGA
AACATTATTTCGAAACCGGTGAAAAGATATTATGCTTGTCATTATATAAA
TTATCTTTGGATCACTTTGCCTTTTTCAAATTGAAAAAGGATGAAAAACC
TTTAGTAAGTGAACCACCAAAACGATCTTGTGGGCGAAGTGCGTCGAAAG
AATTCGGTTATTCATCAGACACATCAGATTACAACCAATACAGTGATGAC
ACTTTCTCAAGTTACCCTGATTCAATCAACACAACACAGAGTTCAAAAAC
AACGAAAGGATTCAATAAACCTAGTGTTCCTTCAAGGAATTGCATTTCTG
ATGCAGAAGAATCTGCTCTTTCAAGGAAAAAGCGTCGAGTAATTGTTTCA
AAATCCCAAACAGAAACAGAAGATGAAGGATTCAGAACATATGATTTTTC
AGTGAAGAATAATACGTTTGATTTCTCAATGCATACTAATGACATTAGAA
AACCATCAATATCGCATTCCCAGTCGTATGATAGAATCCCCCCAGATTAT
ATTTATGAAAATAGATTATCGAAATCCAAAGCACAATCAAACGAGCCAAT
TAGACAAAAACGAATGAGAAAAAAAGTGTCAAGTCAAATAAATGTCGAAA
AAAAATATCGTGACCATAATGAAAGCAATAATAATTCAACTGCAGGATTG
GAAGTCAAACCCGCCCATGTCAGAAAGAATCGCTCTCAAGTGATGGATAC
TAAATATCCTAATTCCGAAACCTCGCAAATCAAAACAAGATCCGGAGAGC
TCATTGAGGAAAAACTAATCAAAACGCAAAGAAAATTACCCTGCCCAAAT
GTTCTCCCTCAATCTTTTGATTCTACCAAAAAGAATGATAATTTGTCGTC
AGATTATCGGATAAAACAGTCTGCCTCCACAGACAGTATTATAACGGTTA
AAAATGAGGATAATCGAGTGTCGCCCACAAAAAGAATGTTGCCAAATCTA
TCAGCGATTGTGCCATCTAATCATACTATCAATCCGCCAGTCCCTAGGCA
TCGAATACAACCAAAGCTTCCATTAGATCAAAACAGTTCAAGCAAAACTC
AGTCTGTGTATGTAGATATTTGGTTTAAGCCTGCATATACTAATCCTCCA
CCTCGAGTACCTCAACATTCCAATGCTATTGTTCGAGTGGCAAATTCACA
AAGTAACTTCACTGAAAGACCTCTGCCAGTTAGAAATTATAGACGACCCA
GTGCAAATCAGCTTAGAACAAGACCCGAAAGTGGGATTTAGATGTTGTGT
AAAGAAAGATTTATTCTAGCCAAAGTGTAATAATAGTCGGGTGAAATGTC
GATTTTCCACATATCATTCAAATTGAATAAATGTCTTCTGGTTTTTTAAA
ATCGTACATTTTATAATATGCATTCGTTATTAAGTGAATATATATATTTT
ATTATGTAATTTTATTGTGTAATTTATTGCTTTTCTAAATTTATCTCTCT
CTCCCTATGCGTTAGATTGGCTTTGTTGATTTCCTTACTATCTGTACATT
TTATAAAGTTTGGAAGTCAATGTTTCTTCCTTTTACAGTTTCATTAAGTA
AATTATTTTAATCCGATTAAATCCATCAGTTTTCGAATGCGAATGTCAAC
AACTATAATTTAACCTAAAAAATGTCATAGAATCTAAATGAAAATTAAAT
TTCTTATTTATAAAATGTCTCTTTGGTTCACTCTGTACAGAGGGTTTTAA
AGGACAAGTTTGTGAATTATTTGTCATTTGAATATGTATTTTCTCATTCT
GGTAATATAATTTTAATTGAAAATAAC
back to top

protein sequence of SMED30023129-orf-1

>SMED30023129-orf-1 ID=SMED30023129-orf-1|Name=SMED30023129-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=687bp
MQCIFPKSRTFEILITFLDDTKRLFKVPVKQKGSAVLLSIANSIPVEQKE
YFGLKYLDRFQKPHWINLDKTLYHQLKKSQIIKSADLSSEPFFNVEFEVR
YYPRDPTSVDDENFRYQIFLQIRKDLGSMKLLIKDETILSILCGLILQSD
FGDFTANRFAPHYVRQTISPHLLNPFLEEKIKAEHLKLRGVEPIEAEYRF
LEKIRWLENYGTILYPVKDSNNRYCFFGLTPQGFSLRYPKESNLNYEIFW
PRISAIRRKGRQIIVKEKTDISKKHYFETGEKILCLSLYKLSLDHFAFFK
LKKDEKPLVSEPPKRSCGRSASKEFGYSSDTSDYNQYSDDTFSSYPDSIN
TTQSSKTTKGFNKPSVPSRNCISDAEESALSRKKRRVIVSKSQTETEDEG
FRTYDFSVKNNTFDFSMHTNDIRKPSISHSQSYDRIPPDYIYENRLSKSK
AQSNEPIRQKRMRKKVSSQINVEKKYRDHNESNNNSTAGLEVKPAHVRKN
RSQVMDTKYPNSETSQIKTRSGELIEEKLIKTQRKLPCPNVLPQSFDSTK
KNDNLSSDYRIKQSASTDSIITVKNEDNRVSPTKRMLPNLSAIVPSNHTI
NPPVPRHRIQPKLPLDQNSSSKTQSVYVDIWFKPAYTNPPPRVPQHSNAI
VRVANSQSNFTERPLPVRNYRRPSANQLRTRPESGI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR030696Band4.1-like4A
IPR035963FERM_2
IPR019749Band_41_domain
IPR018980FERM_PH-like_C
IPR019748FERM_central
IPR011993PH-like_dom_sf
IPR018979FERM_N
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR000299FERM_domain
IPR029071Ubiquitin-like_domsf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018980FERM, C-terminal PH-like domainSMARTSM01196FERM_C_3coord: 219..307
e-value: 0.0091
score: 21.4
IPR018980FERM, C-terminal PH-like domainPFAMPF09380FERM_Ccoord: 219..306
e-value: 4.1E-4
score: 20.7
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 7..215
e-value: 2.6E-29
score: 113.4
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 210..302
e-value: 5.6E-7
score: 31.8
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 101..209
e-value: 6.3E-20
score: 73.6
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 106..214
e-value: 2.5E-8
score: 34.3
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 115..207
e-value: 4.81578E-17
score: 74.9754
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 9..85
e-value: 1.9E-13
score: 52.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 504..518
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 531..552
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 662..686
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 538..552
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 454..481
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 445..518
NoneNo IPR availablePANTHERPTHR232804.1 G PROTEINcoord: 1..528
NoneNo IPR availableCDDcd01765FERM_F0_F1coord: 11..101
e-value: 4.93382E-15
score: 68.3831
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 208..321
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 15..77
e-value: 8.0E-10
score: 38.5
IPR030696Band 4.1-like protein 4APANTHERPTHR23280:SF4BAND 4.1-LIKE PROTEIN 4Acoord: 1..528
IPR000299FERM domainPROSITEPS50057FERM_3coord: 11..303
score: 46.436
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 8..103
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 99..210