HIV Tat-specific factor 1

Overview
NameHIV Tat-specific factor 1
Smed IDSMED30023117
Length (bp)1464
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HIV Tat-specific factor 1 (SMED30023117) t-SNE clustered cells

Violin plots show distribution of expression levels for HIV Tat-specific factor 1 (SMED30023117) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HIV Tat-specific factor 1 (SMED30023117) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HIV Tat-specific factor 1 (SMED30023117) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023117

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023117h1SMcG0015259 SmedASXL_006598SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30023117h1SMcG0015259 dd_Smed_v4_4508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HIV Tat-specific factor 1 vs. Ensembl Human
Match: HTATSF1 (HIV-1 Tat specific factor 1 [Source:HGNC Symbol;Acc:HGNC:5276])

HSP 1 Score: 176.407 bits (446), Expect = 2.084e-47
Identity = 106/300 (35.33%), Postives = 173/300 (57.67%), Query Frame = 1
Query:  274 WFLRLTKDFLDICQL------ENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKT--IRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            WF ++T+DF+   Q       +    +T  +ED + +  +   +  EK  +     KK   + AES WF ++E++N N+Y+  LP DI  +EF++L+SK+G++M +P T   KVKLYK+  G  KGDG CCYLK ES+ LAL LLD   +RG  L V  AKF+ K  +D  K++K     KKKL  +Q+ L  W PE +    R + +  VI+KN+F P   +++P +  +I++ +  E    G ++ +++ D HP+ V  ++F+D   +D  ++  + + +  R I+A+ WDG T Y+V
Sbjct:   59 WFPKITEDFIATYQANYGFSNDGASSSTANVEDVHARTAEEPPQ--EKAPEPTDARKKGEKRKAESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVELALKLLDEDEIRGYKLHVEVAKFQLKGEYDASKKKKKCKDYKKKLSMQQKQL-DWRPERRAGPSRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQV 355          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Human
Match: HTATSF1 (HIV-1 Tat specific factor 1 [Source:HGNC Symbol;Acc:HGNC:5276])

HSP 1 Score: 176.407 bits (446), Expect = 2.084e-47
Identity = 106/300 (35.33%), Postives = 173/300 (57.67%), Query Frame = 1
Query:  274 WFLRLTKDFLDICQL------ENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKT--IRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            WF ++T+DF+   Q       +    +T  +ED + +  +   +  EK  +     KK   + AES WF ++E++N N+Y+  LP DI  +EF++L+SK+G++M +P T   KVKLYK+  G  KGDG CCYLK ES+ LAL LLD   +RG  L V  AKF+ K  +D  K++K     KKKL  +Q+ L  W PE +    R + +  VI+KN+F P   +++P +  +I++ +  E    G ++ +++ D HP+ V  ++F+D   +D  ++  + + +  R I+A+ WDG T Y+V
Sbjct:   59 WFPKITEDFIATYQANYGFSNDGASSSTANVEDVHARTAEEPPQ--EKAPEPTDARKKGEKRKAESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVELALKLLDEDEIRGYKLHVEVAKFQLKGEYDASKKKKKCKDYKKKLSMQQKQL-DWRPERRAGPSRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQV 355          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Human
Match: HTATSF1 (HIV-1 Tat specific factor 1 [Source:HGNC Symbol;Acc:HGNC:5276])

HSP 1 Score: 114.39 bits (285), Expect = 2.187e-28
Identity = 68/169 (40.24%), Postives = 99/169 (58.58%), Query Frame = 1
Query:  274 WFLRLTKDFLDICQL------ENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFD 762
            WF ++T+DF+   Q       +    +T  +ED + +  +      EK  +     KK   + AES WF ++E++N N+Y+  LP DI  +EF++L+SK+G++M +P T   KVKLYK+  G  KGDG CCYLK ES+ LAL LLD   +RG  L V  AKF+ K  +D
Sbjct:   59 WFPKITEDFIATYQANYGFSNDGASSSTANVEDVHARTAE--EPPQEKAPEPTDARKKGEKRKAESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVELALKLLDEDEIRGYKLHVEVAKFQLKGEYD 225          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Human
Match: HTATSF1 (HIV-1 Tat specific factor 1 [Source:HGNC Symbol;Acc:HGNC:5276])

HSP 1 Score: 112.849 bits (281), Expect = 4.253e-28
Identity = 67/165 (40.61%), Postives = 97/165 (58.79%), Query Frame = 1
Query:  274 WFLRLTKDFLDICQL------ENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKK 750
            WF ++T+DF+   Q       +    +T  +ED + +  +      EK  +     KK   + AES WF ++E++N N+Y+  LP DI  +EF++L+SK+G++M +P T   KVKLYK+  G  KGDG CCYLK ES+ LAL LLD   +RG  L V  AKF+ K
Sbjct:   59 WFPKITEDFIATYQANYGFSNDGASSSTANVEDVHARTAE--EPPQEKAPEPTDARKKGEKRKAESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVELALKLLDEDEIRGYKLHVEVAKFQLK 221          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Celegans
Match: cus-2 (pep chromosome:WBcel235:I:654090:658810:1 gene:WBGene00022025.1 transcript:Y65B4A.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cus-2)

HSP 1 Score: 188.348 bits (477), Expect = 3.843e-54
Identity = 97/237 (40.93%), Postives = 154/237 (64.98%), Query Frame = 1
Query:  445 AESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQES-LFRWGPET-KTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            A+  W ++  +K   +Y+ NLP DI + EF + +SK G++  +  TN PK KLY+  +G  KGDG+CCY+K ES+ LA N+LDG NL G  +KV  A+FE K  FDP ++R+     +KK   +Q++ +F W P+  +  RPK D TVI+KN+F   +M +N  L +D+K+++++  +  G VK ++V+  HP+ VV + F     SD+AV+Y + ++ + R ++AE+WDGRTK+KV
Sbjct:  167 AKEGWLDLG-DKVHAVYVSNLPEDITDEEFQKFMSKCGVIQPDIRTNKPKCKLYREENGKLKGDGRCCYIKKESVELACNILDGANLNGREVKVEEARFEMKGDFDPARKRRKLTAAQKKRYMEQQNKIFEWTPDKPRNYRPKSDCTVIVKNLFTQEMMNKNAALMLDLKEEMTQSCQKYGIVKKVVVYANHPDGVVSVTFPTTEESDMAVKYLHGRVVDGRKLTAELWDGRTKFKV 402          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Fly
Match: barc (gene:FBgn0037081 transcript:FBtr0078399)

HSP 1 Score: 191.815 bits (486), Expect = 2.226e-54
Identity = 97/242 (40.08%), Postives = 155/242 (64.05%), Query Frame = 1
Query:  457 WFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPET-KTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDEEKVR 1179
            WFE+D  +N  +Y+ NLPLDI  +EF +L+ K G++M +P T   K+KLY   DG  KGDG C Y+K+ES+NLAL +LD YNLRG  ++V RA+F+ +  ++P  + K   K+K+KL K +E LF W P+  +  R K + TVI+KN+F P + ++  +L ++ ++ + +E    G V+ ++++D HP+ V QIN      +D+ ++    + +  R +SAE WDG+TKYK++E+  E   R
Sbjct:  275 WFEMDPLQNTKVYVSNLPLDITMDEFADLMGKCGMVMRDPQTQKFKLKLYAEKDGQIKGDGLCDYIKVESVNLALKILDEYNLRGHKIRVQRAQFQMRGEYNPALKPKRKKKDKEKLQKMKEKLFDWRPDKLRGERSKNEKTVIIKNLFTPELFEKEVELILEYQNNLREECSKCGMVRKVVIYDRHPDGVAQINMASPEEADLVIQMMQGRYFGQRQLSAEAWDGKTKYKIEESAVEAHER 516          

HSP 2 Score: 53.5286 bits (127), Expect = 3.316e-7
Identity = 20/38 (52.63%), Postives = 28/38 (73.68%), Query Frame = 1
Query:  109 TRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFL 222
            T  D+DG+E  WD  K AWFP IDD+F+ ++ +NYGF+
Sbjct:  178 TYTDKDGVEFFWDATKSAWFPKIDDDFMARYQMNYGFI 215          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Fly
Match: barc (gene:FBgn0037081 transcript:FBtr0078400)

HSP 1 Score: 191.815 bits (486), Expect = 2.226e-54
Identity = 97/242 (40.08%), Postives = 155/242 (64.05%), Query Frame = 1
Query:  457 WFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPET-KTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDEEKVR 1179
            WFE+D  +N  +Y+ NLPLDI  +EF +L+ K G++M +P T   K+KLY   DG  KGDG C Y+K+ES+NLAL +LD YNLRG  ++V RA+F+ +  ++P  + K   K+K+KL K +E LF W P+  +  R K + TVI+KN+F P + ++  +L ++ ++ + +E    G V+ ++++D HP+ V QIN      +D+ ++    + +  R +SAE WDG+TKYK++E+  E   R
Sbjct:  275 WFEMDPLQNTKVYVSNLPLDITMDEFADLMGKCGMVMRDPQTQKFKLKLYAEKDGQIKGDGLCDYIKVESVNLALKILDEYNLRGHKIRVQRAQFQMRGEYNPALKPKRKKKDKEKLQKMKEKLFDWRPDKLRGERSKNEKTVIIKNLFTPELFEKEVELILEYQNNLREECSKCGMVRKVVIYDRHPDGVAQINMASPEEADLVIQMMQGRYFGQRQLSAEAWDGKTKYKIEESAVEAHER 516          

HSP 2 Score: 53.5286 bits (127), Expect = 3.316e-7
Identity = 20/38 (52.63%), Postives = 28/38 (73.68%), Query Frame = 1
Query:  109 TRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFL 222
            T  D+DG+E  WD  K AWFP IDD+F+ ++ +NYGF+
Sbjct:  178 TYTDKDGVEFFWDATKSAWFPKIDDDFMARYQMNYGFI 215          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Zebrafish
Match: htatsf1 (HIV-1 Tat specific factor 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1578])

HSP 1 Score: 196.823 bits (499), Expect = 5.389e-57
Identity = 133/359 (37.05%), Postives = 195/359 (54.32%), Query Frame = 1
Query:   79 QEINNKIHPTTRID-EDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPE-TKTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            Q   N   P T  D EDG    WD EK+AWFP I+D+FI  +  NYGF   EE   +   AV   E     ++      + +  +  T P E             A +  KNK   KK   + A+ TWFE+++ KN N+Y+  LP DI  +EFVE++SK G++M +P T   K+K+YK+ DG  KGDG CCYLK ES+ LA  LLD   +RG  L V  A+FE K  FD   ++K  NKE +K L++Q+    W PE +  +R + +  +I++N+F P   +E+P +  + +D +  E +  G VK +I+ D HP+ V  + FK+   +D      N + +  R +SA +WDG T Y+V
Sbjct:   23 QRQENSDDPYTYTDPEDGTVYDWDHEKRAWFPKINDDFIAAYQANYGF--NEEGAPDPSAAVNSAESLPAKSE------EPKKPEEPTKPAE-------------APEQGKNKEGEKKGEKRKADPTWFEVEKEKNTNVYVTGLPPDITPDEFVEVMSKCGIVMRDPITEEYKIKIYKDKDGNQKGDGLCCYLKKESVALAKQLLDETEIRGYRLHVEEARFELKGQFD-ASKKKKKNKEYRKKLQQQQKQLDWRPEKSGEVRKRHEKVIIIQNMFHPTDFEEDPLVLNEYRDDLRTECEKFGQVKKVIIFDRHPDGVASVAFKEPEEADACQVALNGRWFGGRKLSALLWDGVTDYQV 359          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Mouse
Match: Htatsf1 (HIV TAT specific factor 1 [Source:MGI Symbol;Acc:MGI:1919709])

HSP 1 Score: 186.037 bits (471), Expect = 5.542e-51
Identity = 122/367 (33.24%), Postives = 195/367 (53.13%), Query Frame = 1
Query:   55 DTMNDDICQEINNKIHPTTRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKTI--RPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            D    D   E + + H   +  +D    +WD +K+AWFP I ++FI  +  NYGF S   + + + TA VQ                    D  T  +E+   K          +  +     +K   + AES WF ++E++N N+Y+  LP DI  +EF++L+SK+G++M +P T   KVKLYK+  G  KGDG CCYLK ES+ LAL LLD   +RG  L V  AKF+ K  +D  K++K     KKKL  +Q+ L  W PE +    R + +  VILKN+F P   +++P +  +I++ +  E    G ++ +++ D HP+ V  ++F++   +D  ++  + + +  R I+A+ WDG T Y+V
Sbjct:   25 DPKEGDTQNEPSGEAHSLGQPPDD-TPYEWDLDKKAWFPKITEDFIATYQANYGFSS---DGASSSTANVQ--------------------DANTKAVEEPPQK----------EVPETPDSKRKGEKRKAESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDDQGNLKGDGLCCYLKKESVELALKLLDEDEIRGYKLHVEVAKFQLKGEYDASKKKKKCKDYKKKLSLQQKQL-DWRPERRAGPNRLRHERVVILKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFREPEEADHCIQTLDGRWFGGRQITAQAWDGTTDYQV 356          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Mouse
Match: Htatsf1 (HIV TAT specific factor 1 [Source:MGI Symbol;Acc:MGI:1919709])

HSP 1 Score: 103.99 bits (258), Expect = 2.618e-25
Identity = 68/205 (33.17%), Postives = 104/205 (50.73%), Query Frame = 1
Query:   55 DTMNDDICQEINNKIHPTTRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESI 669
            D    D   E + + H   +  +D    +WD +K+AWFP I ++FI  +  NYGF S   + + + TA VQ                    D  T  +E+   K          +  +     +K   + AES WF ++E++N N+Y+  LP DI  +EF++L+SK+G++M +P T   KVKLYK+  G  KGDG CCYLK+ S+
Sbjct:   25 DPKEGDTQNEPSGEAHSLGQPPDD-TPYEWDLDKKAWFPKITEDFIATYQANYGFSS---DGASSSTANVQ--------------------DANTKAVEEPPQK----------EVPETPDSKRKGEKRKAESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDDQGNLKGDGLCCYLKVFSV 195          
BLAST of HIV Tat-specific factor 1 vs. UniProt/SwissProt
Match: sp|Q8BGC0|HTSF1_MOUSE (HIV Tat-specific factor 1 homolog OS=Mus musculus OX=10090 GN=Htatsf1 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 3.877e-50
Identity = 122/367 (33.24%), Postives = 195/367 (53.13%), Query Frame = 1
Query:   55 DTMNDDICQEINNKIHPTTRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKTI--RPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            D    D   E + + H   +  +D    +WD +K+AWFP I ++FI  +  NYGF S   + + + TA VQ                    D  T  +E+   K          +  +     +K   + AES WF ++E++N N+Y+  LP DI  +EF++L+SK+G++M +P T   KVKLYK+  G  KGDG CCYLK ES+ LAL LLD   +RG  L V  AKF+ K  +D  K++K     KKKL  +Q+ L  W PE +    R + +  VILKN+F P   +++P +  +I++ +  E    G ++ +++ D HP+ V  ++F++   +D  ++  + + +  R I+A+ WDG T Y+V
Sbjct:   25 DPKEGDTQNEPSGEAHSLGQPPDD-TPYEWDLDKKAWFPKITEDFIATYQANYGFSS---DGASSSTANVQ--------------------DANTKAVEEPPQK----------EVPETPDSKRKGEKRKAESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDDQGNLKGDGLCCYLKKESVELALKLLDEDEIRGYKLHVEVAKFQLKGEYDASKKKKKCKDYKKKLSLQQKQL-DWRPERRAGPNRLRHERVVILKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFREPEEADHCIQTLDGRWFGGRQITAQAWDGTTDYQV 356          
BLAST of HIV Tat-specific factor 1 vs. UniProt/SwissProt
Match: sp|O43719|HTSF1_HUMAN (HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.001e-46
Identity = 106/300 (35.33%), Postives = 173/300 (57.67%), Query Frame = 1
Query:  274 WFLRLTKDFLDICQL------ENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKT--IRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            WF ++T+DF+   Q       +    +T  +ED + +  +   +  EK  +     KK   + AES WF ++E++N N+Y+  LP DI  +EF++L+SK+G++M +P T   KVKLYK+  G  KGDG CCYLK ES+ LAL LLD   +RG  L V  AKF+ K  +D  K++K     KKKL  +Q+ L  W PE +    R + +  VI+KN+F P   +++P +  +I++ +  E    G ++ +++ D HP+ V  ++F+D   +D  ++  + + +  R I+A+ WDG T Y+V
Sbjct:   59 WFPKITEDFIATYQANYGFSNDGASSSTANVEDVHARTAEEPPQ--EKAPEPTDARKKGEKRKAESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVELALKLLDEDEIRGYKLHVEVAKFQLKGEYDASKKKKKCKDYKKKLSMQQKQL-DWRPERRAGPSRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQV 355          
BLAST of HIV Tat-specific factor 1 vs. UniProt/SwissProt
Match: sp|Q5RB63|HTSF1_PONAB (HIV Tat-specific factor 1 homolog OS=Pongo abelii OX=9601 GN=HTATSF1 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.635e-46
Identity = 106/300 (35.33%), Postives = 173/300 (57.67%), Query Frame = 1
Query:  274 WFLRLTKDFLDICQL------ENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKT--IRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            WF ++T+DF+   Q       +    +T  +ED + +  +   +  EK  +     KK   + AES WF ++E++N N+Y+  LP DI  +EF++L+SK+G++M +P T   KVKLYK+  G  KGDG CCYLK ES+ LAL LLD   +RG  L V  AKF+ K  +D  K++K     KKKL  +Q+ L  W PE +    R + +  VI+KN+F P   +++P +  +I++ +  E    G ++ +++ D HP+ V  ++F+D   +D  ++  + + +  R I+A+ WDG T Y+V
Sbjct:   59 WFPKITEDFIATYQANYGFSNDGASSSTANVEDVHARTAEEPPQ--EKAPEPTDPRKKGEKRKAESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGDGLCCYLKRESVELALKLLDEDEIRGYKLHVEVAKFQLKGEYDASKKKKKCKDYKKKLSMQQKQL-DWRPERRAGPSRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQV 355          
BLAST of HIV Tat-specific factor 1 vs. UniProt/SwissProt
Match: sp|O43120|UAP2_SCHPO (Splicing factor U2AF-associated protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uap2 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 4.790e-23
Identity = 64/246 (26.02%), Postives = 128/246 (52.03%), Query Frame = 1
Query:  481 NKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLR---GCILKVSRAK--FEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKTIRPKK----DNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYK------VKETEDEEK 1173
            NK +YI+ LPLD+  +E  E+  K G++        P++K+Y+  DGT KGD    + + ES+ LA  L D    R   G  ++V +A   ++K++  +      +  K  +   ++ + +  W    + +  K+    +  V+LK++F    + + P+L +D+KD I++E +  G V +++++D  P+ VV + F +   ++  V     + ++ R + A I+DG+ +++      + + EDEEK
Sbjct:  109 NKAVYIQGLPLDVTVDEIEEVFKKCGVIAKNIDNGTPRIKIYRTEDGTPKGDALIVFFRSESVELAEQLFDDTEFRYGSGQKMRVQKANIDYKKEKTVNKDVGGALKKKALRLRQQQMQQISSWDDVDEEVDDKRKKRFNKIVVLKHIFTLEELDKTPELLIDLKDDITEEAEKCGRVTNVVLYDKEPDGVVTVRFSNNEEAEACVRLMQGRYFDGRVVEASIYDGKVRFQKSGKHTLDDEEDEEK 354          
BLAST of HIV Tat-specific factor 1 vs. UniProt/SwissProt
Match: sp|P53830|CUS2_YEAST (Cold sensitive U2 snRNA suppressor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CUS2 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 4.497e-8
Identity = 64/208 (30.77%), Postives = 87/208 (41.83%), Query Frame = 1
Query:  475 NKNKNIYIENLPLDIEENE-FVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRW-GPETKTIRPKK---------------------DNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVV 1029
            +KN +IYI  LP D    E   E   KYG++        P  KLY N  G  KGD    Y K ES+ LA+ +++     G  ++V RA+F+ KEG                +  K+  L  + GPE    R KK                     D TVI  NVF+      N D+  DI++ + +  + IG V SI V     EA V
Sbjct:   42 SKNTSIYISGLPTDKTTKEGLTEQFCKYGMIRTNR-DGEPLCKLYVNDKGAFKGDALITYSKEESVTLAIEMMNESIFLGKQIRVERAQFQNKEG--------------DNMHGKENDLKEFNGPEPPIKRLKKAKSEGEGEVIDYNDDESLAKADRTVIFANVFNIYKSYTNDDIN-DIQEDLLEGCEEIGQVDSISVSPNKGEATV 233          
BLAST of HIV Tat-specific factor 1 vs. TrEMBL
Match: A0A087UHQ3 (HIV Tat-specific factor 1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_23879 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 4.270e-64
Identity = 135/362 (37.29%), Postives = 203/362 (56.08%), Query Frame = 1
Query:  103 PTTRIDE-DGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPX-XXXXXXXXXXXXXXXXQESLFRWGPET-KTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDEEKVR 1179
            P T +D  DG   +W+ EKQAWFP +DD+FI K+  NY + S E ++S+  +   QP+   R   D                                                     WF++DE+ N N+Y+  LP D  E EF+EL+SK GL+M +P     K+KLY++ DGT KGDG+CCY+KIES+ LAL++LDGY  +G  + V RA+FE K  +DP  K +K   KEK+KL KK + LF W P+  + +R + +NTVI+KN+FDP    E+  L +D ++ I +E    G VK ++++D +P+ VV + F +  ++D  +   N + + +R ++AE WDG+TKYK+ ETE+E + R
Sbjct:   30 PYTYVDPNDGTVYEWNTEKQAWFPKVDDDFIAKYQSNYTYQSNE-DESKGTSPEPQPKGEKRKAND---------------------------------------------------PGWFQVDEDHNTNVYVSGLPQDTTEEEFIELMSKCGLIMKDPDNMKYKIKLYRDSDGTLKGDGRCCYIKIESVKLALDILDGYLFKGKPIHVERAQFELKGQYDPSKKPKKKKAKEKEKLKKKLDKLFDWRPDKLRGMRSRNENTVIIKNMFDPKEFDEDAALLLDYQNDIREECSKCGEVKKVVIYDRNPDGVVAVTFSEPEMADECINLMNGRWFASRQLTAETWDGKTKYKIVETEEEREKR 339          
BLAST of HIV Tat-specific factor 1 vs. TrEMBL
Match: A0A1Y1KY94 (RRM domain-containing protein OS=Photinus pyralis OX=7054 GN=PPYR_12769 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.829e-62
Identity = 133/356 (37.36%), Postives = 198/356 (55.62%), Query Frame = 1
Query:  109 TRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTN-KGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXX-XXQESLFRWGPE-TKTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDE 1167
            T  D DG++  WD +K AWFP +DDEF+  + LNYGF+  E+   + +  +                                        ++  EK  +   +  KR   P E TWF++D+  N N+Y+ NLPL + E+EFVE + K GL+M +  T   KVKLY +P+  + KGD  C Y++IES+NLAL LLDG +L+G  +K+ RAKF+ K  FDPK + K   K++++ L + QE LF W PE  +  R K +  VIL NVF P++   +  L ++I+  + +E    G VK +I++D HPE V Q+N K+   +D  V+  N + +  R + AEIWDGRTKYK+ ET+ +
Sbjct:   98 TYTDSDGVKYFWDTQKNAWFPKLDDEFMAMYQLNYGFVQNEQAPPKADEVI----------------------------------------TKEVEKKPEKVEQAPKRKAPPPEPTWFDVDDEHNTNVYVTNLPLSLTEDEFVEFMQKCGLVMRDLSTGKMKVKLYIDPETKSFKGDALCTYIRIESVNLALQLLDGSDLKGNKVKLERAKFQMKGAFDPKLKPKKRKKKEREKLKRMQEKLFDWRPEKMRGERAKHEKVVILTNVFVPSMFDADVSLILEIQQDLREECSKCGTVKKVIMYDQHPEGVAQVNMKEPEEADAVVQLLNGRWFGKRKLFAEIWDGRTKYKIAETDSQ 413          
BLAST of HIV Tat-specific factor 1 vs. TrEMBL
Match: A0A1S3KG96 (HIV Tat-specific factor 1 homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106181608 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 3.927e-62
Identity = 110/243 (45.27%), Postives = 165/243 (67.90%), Query Frame = 1
Query:  454 TWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETK-TIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDEEKVR 1179
            TWFE+D+N+N N+Y+  LP ++EE EF EL+SK G++MY+  T  PK+KLY+N DGT KGDG+CCY+K+ES++LAL +LDG + +   + V RA+F+ K  +DP K++K++NK K+K+ +KQE +F W P+     R K +  V++K++FDP   + +P L  DI+D I  E    G V+ +IV+D +PE V  + F     +D+ VE FN + +  R + AE WDG+TKY+VKET  E + R
Sbjct:  263 TWFEVDQNRNTNVYVSGLPANMEETEFQELMSKCGMIMYDHITRKPKIKLYRNEDGTLKGDGRCCYIKVESVDLALKILDGSSYKDHTIHVERAQFQLKGDYDPSKKKKVSNKMKRKIKEKQEKMFDWRPDKPLGTRGKHEKVVVIKHMFDPKEFETDPSLINDIRDDIRTEASKYGEVRKVIVYDRNPEGVATVAFHAPEHADLCVEAFNGRWFAKRQLVAETWDGKTKYEVKETAAEREAR 505          
BLAST of HIV Tat-specific factor 1 vs. TrEMBL
Match: Q7Q5Q6 (AGAP006266-PA OS=Anopheles gambiae OX=7165 GN=1276920 PE=4 SV=4)

HSP 1 Score: 224.172 bits (570), Expect = 4.036e-62
Identity = 137/367 (37.33%), Postives = 208/367 (56.68%), Query Frame = 1
Query:   64 NDDICQEINNKIHPTTRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGP-ETKTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETE 1161
             DD      + +H  T  D+DG    WDEE++AWFP +DDEF+  + LNYGF+   +N S             R+      + +    +L   P  D ++   +   E          K KKR   P    WFEI    N  +Y+ NLP DI E EF EL+SK G++M +P T+  K+KLY+ PDGT KGDG C Y+KIES++LAL +LD Y++RG  +KV RA+F+ +  ++P  + K+  KEK++L K QESLF W P + +  R K +  VI+KN+F+P +      L ++ ++ + +E    G V+ ++++D HPE V Q+   D   +D+ V+  N + +  R ++A IWDGRTKY++ ET+
Sbjct:  208 GDDRSYGYEDGVH--TYKDKDGAVYFWDEERKAWFPKVDDEFMAIYQLNYGFI---DNTSSGGGPAAAAPAPARV------VSEPSGREL---PGCDEDDDADEQGEEAQRALAAAAAKGKKRKAPPEPPKWFEIAPEHNTKVYVSNLPTDISEEEFGELMSKCGMVMKDPKTHKLKLKLYREPDGTLKGDGLCHYIKIESVDLALKILDNYDVRGHKIKVQRAEFQMRGEYNPTLKPKMRKKEKERLKKIQESLFDWRPVKMRGERSKHERIVIIKNLFEPELFDREVHLLLEYQNDLREECGKCGTVRRVLLYDRHPEGVAQVTMGDPEEADLVVQLMNGRFFGQRKLTAAIWDGRTKYRIAETD 560          
BLAST of HIV Tat-specific factor 1 vs. TrEMBL
Match: A0A1S3KFU8 (HIV Tat-specific factor 1 homolog isoform X2 OS=Lingula unguis OX=7574 GN=LOC106181608 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 4.069e-62
Identity = 110/243 (45.27%), Postives = 165/243 (67.90%), Query Frame = 1
Query:  454 TWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETK-TIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDEEKVR 1179
            TWFE+D+N+N N+Y+  LP ++EE EF EL+SK G++MY+  T  PK+KLY+N DGT KGDG+CCY+K+ES++LAL +LDG + +   + V RA+F+ K  +DP K++K++NK K+K+ +KQE +F W P+     R K +  V++K++FDP   + +P L  DI+D I  E    G V+ +IV+D +PE V  + F     +D+ VE FN + +  R + AE WDG+TKY+VKET  E + R
Sbjct:  263 TWFEVDQNRNTNVYVSGLPANMEETEFQELMSKCGMIMYDHITRKPKIKLYRNEDGTLKGDGRCCYIKVESVDLALKILDGSSYKDHTIHVERAQFQLKGDYDPSKKKKVSNKMKRKIKEKQEKMFDWRPDKPLGTRGKHEKVVVIKHMFDPKEFETDPSLINDIRDDIRTEASKYGEVRKVIVYDRNPEGVATVAFHAPEHADLCVEAFNGRWFAKRQLVAETWDGKTKYEVKETAAEREAR 505          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Cavefish
Match: htatsf1 (HIV-1 Tat specific factor 1 [Source:NCBI gene;Acc:103032098])

HSP 1 Score: 191.43 bits (485), Expect = 5.656e-55
Identity = 124/351 (35.33%), Postives = 194/351 (55.27%), Query Frame = 1
Query:  103 PTTRID-EDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPE-TKTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            P T +D EDG    WD +K+AWFP I ++FI  +  NYGF   E+   ++E A    E     ++   ++ + E         +  + K  +  S         K   +K   + AE  WF+I+++KN N+Y+  LP DI  +EFVE++SK G++M +P T   KVKLYK+ DG  KGDG CCYLK ES+ LA  LLD   +RG  L V  A+FE K  +D  K++K + + +KK+  +Q+ L  W PE T   R + +  VI++N+F P   +E+P    + ++ +  E +  G VK +I+ D HP+ V  + FK+   +D+     + + +  R +SA++WDG T Y+V
Sbjct:   31 PFTYVDPEDGTVYDWDHDKKAWFPKITEDFIAAYQANYGF--SEDGTPDSEAAGPPSE----TSEKPEEMEKPEEEKKKNEVKKPEDGKQPEISS--------TKEGKQKGEKRKAEPGWFDIEKDKNTNVYVSGLPPDITPDEFVEVMSKCGIIMRDPITEEYKVKLYKDSDGNQKGDGLCCYLKKESVALAERLLDEMEIRGYRLHVEAARFELKGQYDASKKKKKSKEYRKKMQLQQKQL-DWRPEKTADGRKRHERVVIIQNMFHPKDFEEDPLELNEYREDLRSECEKFGEVKKVIIFDRHPDGVASVAFKEPEEADMCQTVLDGRWFGGRKLSAQLWDGVTDYQV 366          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Yeast
Match: CUS2 (Putative checkpoint factor in transcription; binds to U2 snRNA and Prp11p; regulates toggling of the U2 snRNA stem II region between different structures; contains two RNA recognition motifs (RRMs) [Source:SGD;Acc:S000005230])

HSP 1 Score: 58.151 bits (139), Expect = 6.476e-10
Identity = 64/208 (30.77%), Postives = 87/208 (41.83%), Query Frame = 1
Query:  475 NKNKNIYIENLPLDIEENE-FVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRW-GPETKTIRPKK---------------------DNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVV 1029
            +KN +IYI  LP D    E   E   KYG++        P  KLY N  G  KGD    Y K ES+ LA+ +++     G  ++V RA+F+ KEG                +  K+  L  + GPE    R KK                     D TVI  NVF+      N D+  DI++ + +  + IG V SI V     EA V
Sbjct:   42 SKNTSIYISGLPTDKTTKEGLTEQFCKYGMIRTNR-DGEPLCKLYVNDKGAFKGDALITYSKEESVTLAIEMMNESIFLGKQIRVERAQFQNKEG--------------DNMHGKENDLKEFNGPEPPIKRLKKAKSEGEGEVIDYNDDESLAKADRTVIFANVFNIYKSYTNDDIN-DIQEDLLEGCEEIGQVDSISVSPNKGEATV 233          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Nematostella
Match: EDO33511 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRZ1])

HSP 1 Score: 147.517 bits (371), Expect = 1.779e-40
Identity = 82/241 (34.02%), Postives = 141/241 (58.51%), Query Frame = 1
Query:  457 WFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDEEKVR 1179
            WF+ D  KN N+Y+  LPLDI + EFVEL+SKYG++M +P T+                 G+CCYLK+ S++LA++LLD    +   L V +A+F  K  ++P  ++K   K+KK+  + QE L  W  +    RPK +  +++KN+FDP + +++P L +  ++ + KE +  G V+ +IV D H E +  + FK+   +D  +E  N + +  R ++A+ WDG + + ++E++ + K R
Sbjct:   63 WFQPDPEKNPNVYVSGLPLDITDEEFVELMSKYGIIMEDPDTH-----------------GRCCYLKMASVHLAIDLLDEAEYKKSTLHVEQAQFNMKGNYNPALKKKKKKKKKKQGKQ-QEKLLDW-VDRDNRRPKNERVIVIKNMFDPKVFEKDPQLIITTRNDLRKECEKFGDVRKVIVFDRHSEGICSVAFKEHPPADACLERMNGRWFAGRRLAADRWDGVSNFNIQESDKDLKDR 284          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Medaka
Match: htatsf1 (HIV Tat-specific factor 1 [Source:NCBI gene;Acc:101155132])

HSP 1 Score: 201.06 bits (510), Expect = 9.791e-59
Identity = 134/373 (35.92%), Postives = 197/373 (52.82%), Query Frame = 1
Query:   61 MNDDICQEINNKIHPTTRID-EDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWY-KFYSENA-------EXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKT-IRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            M++   Q  ++   P T  D  DG    WD EK+AWFP + D+FI  +  NYGF +KE +   N  AV                        +  P  + N+K   K  SE +       +         +K   + A+  WFEIDE KN N+Y+  LP DI   EFV L+SKYG++M +P T   KVKLYK+ DG  KGDG CCYLK ES+ LA+ LLD Y +RG  L V  A+FE K G     ++K  +K+ KK L++Q+    W PE K  +R + +  VI++N+F P+  +E+P +  + ++ +  E +  G VK +++ D HP+ V  + FK+   +D  V  FN + +  R + A +WDG T Y+V
Sbjct:   17 MHELYGQRKDDGSDPFTYTDPADGTVYDWDPEKKAWFPKVTDDFIAAYQANYGF-TKEGDPDTNAGAVSS----------------------SDPPAPEPNSKAPEKAKSETSAAKPAPDQTEATTNQAKQKGEKRKADPGWFEIDEGKNTNVYVSGLPPDITPEEFVGLMSKYGIVMRDPITEEYKVKLYKDKDGNLKGDGLCCYLKKESLELAVRLLDEYEVRGYKLHVEAAQFELK-GQYDASKKKKKSKDYKKKLQQQQKQLDWRPEKKGDVRKRHEKVVIIRNMFHPSDFEEDPLVLNEYREDLRTECEKFGGVKKVVLFDRHPDGVASVAFKEPEEADACVLSFNGRWFGGRQLIAHLWDGTTDYQV 365          
BLAST of HIV Tat-specific factor 1 vs. Ensembl Medaka
Match: htatsf1 (HIV Tat-specific factor 1 [Source:NCBI gene;Acc:101155132])

HSP 1 Score: 166.007 bits (419), Expect = 1.042e-45
Identity = 125/367 (34.06%), Postives = 187/367 (50.95%), Query Frame = 1
Query:   61 MNDDICQEINNKIHPTTRID-EDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEEN--EFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKT-IRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKV 1149
            M++   Q  ++   P T  D  DG    WD EK+AWFP + D+FI  +  NYGF +KE +   N  AV                        +  P  + N+K        A +  K++    K      E+T    ++ K K    E    D   N  EFV L+SKYG++M +P T   KVKLYK+ DG  KGDG CCYLK ES+ LA+ LLD Y +RG  L V  A+FE K G     ++K  +K+ KK L++Q+    W PE K  +R + +  VI++N+F P+  +E+P +  + ++ +  E +  G VK +++ D HP+ V  + FK+   +D  V  FN + +  R + A +WDG T Y+V
Sbjct:   17 MHELYGQRKDDGSDPFTYTDPADGTVYDWDPEKKAWFPKVTDDFIAAYQANYGF-TKEGDPDTNAGAVSS----------------------SDPPAPEPNSK--------APEKAKSETSAAKPAPDQTEAT---TNQAKQKG---EKRKADPARNNFEFVGLMSKYGIVMRDPITEEYKVKLYKDKDGNLKGDGLCCYLKKESLELAVRLLDEYEVRGYKLHVEAAQFELK-GQYDASKKKKKSKDYKKKLQQQQKQLDWRPEKKGDVRKRHEKVVIIRNMFHPSDFEEDPLVLNEYREDLRTECEKFGGVKKVVLFDRHPDGVASVAFKEPEEADACVLSFNGRWFGGRQLIAHLWDGTTDYQV 345          
BLAST of HIV Tat-specific factor 1 vs. Planmine SMEST
Match: SMESG000021348.1 (SMESG000021348.1)

HSP 1 Score: 783.097 bits (2021), Expect = 0.000e+0
Identity = 443/444 (99.77%), Postives = 443/444 (99.77%), Query Frame = 1
Query:   61 MNDDICQEINNKIHPTTRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEXXXXXXXXXXXXXXXXAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPXXXXXXXXXXXXXXXXXQESLFRWGPETKTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDEEKVRXXXXXXXXXXXXXXGNIDEFPSENDIETENLEDVLKLLKGDCSVEGDKSNNSQIATSINEGSFEDTEEQDT 1392
            MNDDICQEINNKIHPTTRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEKYEKNKIKPKKRHHKPAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPKKRRKITNKEKKKLLKKQESLFRWGPETKTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDEEKVRIEKWEKLLEEEKIEGNIDEF SENDIETENLEDVLKLLKGDCSVEGDKSNNSQIATSINEGSFEDTEEQDT
Sbjct:    1 MNDDICQEINNKIHPTTRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLNYGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYNNKWYKFYSENAEKYEKNKIKPKKRHHKPAESTWFEIDENKNKNIYIENLPLDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKIESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPKKRRKITNKEKKKLLKKQESLFRWGPETKTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKISKETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHISAEIWDGRTKYKVKETEDEEKVRIEKWEKLLEEEKIEGNIDEFHSENDIETENLEDVLKLLKGDCSVEGDKSNNSQIATSINEGSFEDTEEQDT 444          
The following BLAST results are available for this feature:
BLAST of HIV Tat-specific factor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
HTATSF12.084e-4735.33HIV-1 Tat specific factor 1 [Source:HGNC Symbol;Ac... [more]
HTATSF12.084e-4735.33HIV-1 Tat specific factor 1 [Source:HGNC Symbol;Ac... [more]
HTATSF12.187e-2840.24HIV-1 Tat specific factor 1 [Source:HGNC Symbol;Ac... [more]
HTATSF14.253e-2840.61HIV-1 Tat specific factor 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cus-23.843e-5440.93pep chromosome:WBcel235:I:654090:658810:1 gene:WBG... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
barc2.226e-5440.08gene:FBgn0037081 transcript:FBtr0078399[more]
barc2.226e-5440.08gene:FBgn0037081 transcript:FBtr0078400[more]
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
htatsf15.389e-5737.05HIV-1 Tat specific factor 1 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Htatsf15.542e-5133.24HIV TAT specific factor 1 [Source:MGI Symbol;Acc:M... [more]
Htatsf12.618e-2533.17HIV TAT specific factor 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BGC0|HTSF1_MOUSE3.877e-5033.24HIV Tat-specific factor 1 homolog OS=Mus musculus ... [more]
sp|O43719|HTSF1_HUMAN1.001e-4635.33HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 ... [more]
sp|Q5RB63|HTSF1_PONAB1.635e-4635.33HIV Tat-specific factor 1 homolog OS=Pongo abelii ... [more]
sp|O43120|UAP2_SCHPO4.790e-2326.02Splicing factor U2AF-associated protein 2 OS=Schiz... [more]
sp|P53830|CUS2_YEAST4.497e-830.77Cold sensitive U2 snRNA suppressor 2 OS=Saccharomy... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087UHQ34.270e-6437.29HIV Tat-specific factor 1 (Fragment) OS=Stegodyphu... [more]
A0A1Y1KY941.829e-6237.36RRM domain-containing protein OS=Photinus pyralis ... [more]
A0A1S3KG963.927e-6245.27HIV Tat-specific factor 1 homolog isoform X1 OS=Li... [more]
Q7Q5Q64.036e-6237.33AGAP006266-PA OS=Anopheles gambiae OX=7165 GN=1276... [more]
A0A1S3KFU84.069e-6245.27HIV Tat-specific factor 1 homolog isoform X2 OS=Li... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
htatsf15.656e-5535.33HIV-1 Tat specific factor 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CUS26.476e-1030.77Putative checkpoint factor in transcription; binds... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335111.779e-4034.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
htatsf19.791e-5935.92HIV Tat-specific factor 1 [Source:NCBI gene;Acc:10... [more]
htatsf11.042e-4534.06HIV Tat-specific factor 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of HIV Tat-specific factor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000021348.10.000e+099.77SMESG000021348.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023117 ID=SMED30023117|Name=HIV Tat-specific factor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1464bp
ATTGTTTTAATAATAATTTTTAATTAATTGTAAATTATAATTTATTTTAT
TAAAGATACAATGAATGATGATATTTGCCAAGAAATTAATAATAAAATTC
ACCCAACAACTAGAATAGATGAGGATGGAATTGAAGTTAAATGGGATGAA
GAGAAGCAAGCATGGTTTCCTAATATTGACGATGAATTTATTTATAAACA
CAATTTGAATTATGGATTTCTTTCTAAGGAAGAAAATAAATCAGAAAACG
AAACAGCTGTAGTTCAACCAGAATGGTTCTTACGCCTAACAAAAGATTTT
TTAGACATTTGTCAATTGGAAAATGTAGATTTAACAACATTCCCTTTAGA
GGATTACAATAACAAATGGTATAAATTCTATTCTGAAAACGCTGAAAAAT
ATGAGAAAAATAAGATTAAACCCAAAAAACGTCACCACAAACCTGCTGAA
TCAACATGGTTTGAAATCGACGAGAACAAAAACAAAAATATTTATATTGA
AAATTTACCACTAGACATCGAGGAAAATGAATTTGTTGAATTAGTTTCAA
AGTATGGATTGTTGATGTATGAACCATTTACAAACATTCCCAAAGTCAAA
TTGTATAAAAATCCCGATGGCACTAATAAAGGCGATGGAAAATGTTGTTA
TTTAAAAATAGAGTCAATTAATTTGGCGTTGAATCTTTTGGATGGATATA
ATCTTCGAGGATGTATTTTAAAAGTCTCACGAGCTAAATTCGAGAAAAAA
GAAGGTTTTGATCCAAAAAAACGACGAAAAATTACCAACAAAGAGAAAAA
AAAGTTATTGAAAAAACAAGAAAGCCTATTTCGCTGGGGCCCCGAAACCA
AAACAATCCGGCCGAAAAAAGACAATACAGTTATTTTAAAGAATGTTTTT
GACCCAAATATAATGAAAGAAAATCCCGACTTAGCTATGGATATAAAAGA
TAAAATCAGCAAAGAAACCAAAAATATAGGTGCTGTGAAATCTATAATAG
TTCACGATTTACATCCTGAGGCGGTTGTTCAAATTAATTTTAAAGATGCA
AATCTATCTGATATCGCAGTTGAATATTTCAACAACAAATTGTGGAATAA
TCGACATATCAGTGCTGAAATCTGGGACGGTAGAACCAAATATAAAGTAA
AAGAAACTGAAGATGAAGAAAAAGTAAGAATAGAAAAATGGGAAAAACTA
CTTGAAGAAGAAAAGATTGAAGGAAATATTGACGAGTTTCCCTCGGAAAA
TGATATTGAAACTGAAAATCTGGAAGATGTTTTAAAATTACTTAAAGGTG
ATTGTTCAGTTGAAGGTGACAAGTCAAACAACTCTCAAATCGCTACATCT
ATCAATGAAGGATCTTTTGAGGACACCGAGGAACAGGACACGTGAATGTT
TTTTTAATAAACTGTTGTTGATAATTTTAGTAATACAAATAATTAATAAT
AAATATTTAATAAT
back to top

protein sequence of SMED30023117-orf-1

>SMED30023117-orf-1 ID=SMED30023117-orf-1|Name=SMED30023117-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=445bp
MNDDICQEINNKIHPTTRIDEDGIEVKWDEEKQAWFPNIDDEFIYKHNLN
YGFLSKEENKSENETAVVQPEWFLRLTKDFLDICQLENVDLTTFPLEDYN
NKWYKFYSENAEKYEKNKIKPKKRHHKPAESTWFEIDENKNKNIYIENLP
LDIEENEFVELVSKYGLLMYEPFTNIPKVKLYKNPDGTNKGDGKCCYLKI
ESINLALNLLDGYNLRGCILKVSRAKFEKKEGFDPKKRRKITNKEKKKLL
KKQESLFRWGPETKTIRPKKDNTVILKNVFDPNIMKENPDLAMDIKDKIS
KETKNIGAVKSIIVHDLHPEAVVQINFKDANLSDIAVEYFNNKLWNNRHI
SAEIWDGRTKYKVKETEDEEKVRIEKWEKLLEEEKIEGNIDEFPSENDIE
TENLEDVLKLLKGDCSVEGDKSNNSQIATSINEGSFEDTEEQDT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR034393TatSF1-like
IPR034392TatSF1-like_RRM1
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 367..387
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 421..444
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 421..435
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 143..223
e-value: 1.6E-5
score: 34.4
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 142..227
score: 11.042
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 272..356
e-value: 4.9E-13
score: 50.9
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 134..256
e-value: 1.4E-14
score: 56.2
IPR034393TatSF1-likePANTHERPTHR15608SPLICING FACTOR U2AF-ASSOCIATED PROTEIN 2coord: 16..384
IPR034392TatSF1-like, RNA recognition motif 1CDDcd12281RRM1_TatSF1_likecoord: 141..231
e-value: 5.34564E-37
score: 128.42
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 294..358
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 126..234