Glycine receptor subunit alpha-3

Overview
NameGlycine receptor subunit alpha-3
Smed IDSMED30023116
Length (bp)1602
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine receptor subunit alpha-3 (SMED30023116) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30023116) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine receptor subunit alpha-3 (SMED30023116) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30023116) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023116

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023116SMESG000037124.1 SmedASXL_007641SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30023116SMESG000037124.1 dd_Smed_v4_15331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023116SMESG000037124.1 dd_Smed_v4_15331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30023116SMESG000037124.1 dd_Smed_v6_15331_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30023116SMESG000037124.1 OX_Smed_1.0.13396ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA3 (glycine receptor alpha 3 [Source:HGNC Symbol;Acc:HGNC:4328])

HSP 1 Score: 247.669 bits (631), Expect = 1.566e-75
Identity = 150/431 (34.80%), Postives = 242/431 (56.15%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSEL-WQRDVQNIVH----QELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W+   P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L ++R  +N       ++ +++S M  + ++S      + MG          A+   T    N            Q++  SP+E  +  I + +          +ID  S+  FP  F+++N FYW+ Y IL
Sbjct:   56 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEAFALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQ------AKDGMTPKGPNH---------PVQVMPKSPDEMRKVFIDRAK----------KIDTISRACFPLAFLIFNIFYWVIYKIL 454          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA3 (glycine receptor alpha 3 [Source:HGNC Symbol;Acc:HGNC:4328])

HSP 1 Score: 243.432 bits (620), Expect = 4.564e-74
Identity = 145/426 (34.04%), Postives = 231/426 (54.23%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W+   P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              H+EL ++ +    K   +   +               A+   T    N            Q++  SP+E  +  I + +          +ID  S+  FP  F+++N FYW+ Y IL
Sbjct:   56 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQ--------------HKELLRFRRKRKNKDDEVRESRFSFTAYGMGPCLQ--AKDGMTPKGPNH---------PVQVMPKSPDEMRKVFIDRAK----------KIDTISRACFPLAFLIFNIFYWVIYKIL 439          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 241.121 bits (614), Expect = 3.253e-73
Identity = 153/436 (35.09%), Postives = 236/436 (54.13%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDS----------EIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  SV    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG+VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W S  P+ +   + +P+F      +   C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  Q   ++E        + ++   NF                         S     H L+V      ++A+P   L      PQ   PP   D+           ID  S+  FP  F+++N FYW+ Y I+
Sbjct:   57 GYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKE------EDVTRESRFNF-------------------------SGYGMGHCLQV-KDGTAVKATPANPL------PQ---PPKDGDAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKII 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 240.736 bits (613), Expect = 6.009e-73
Identity = 152/436 (34.86%), Postives = 236/436 (54.13%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDS----------EIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG+VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W S  P+ +   + +P+F      +   C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  Q   ++E        + ++   NF                         S     H L+V      ++A+P   L      PQ   PP   D+           ID  S+  FP  F+++N FYW+ Y I+
Sbjct:   57 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDSRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKE------EDVTRESRFNF-------------------------SGYGMGHCLQV-KDGTAVKATPANPL------PQ---PPKDGDAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKII 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA1 (glycine receptor alpha 1 [Source:HGNC Symbol;Acc:HGNC:4326])

HSP 1 Score: 240.35 bits (612), Expect = 8.290e-73
Identity = 146/429 (34.03%), Postives = 237/429 (55.24%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA++        +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W+    + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  +      +    +     +   NF   + MG P      +   +   +NS                   + N     S S  ++ +  +Q   +ID  S+  FP  F+++N FYW+ Y I+ R+
Sbjct:   51 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKSPMLNLFQEDEAGEGRFNF-SAYGMG-PACLQAKDGISVKGANNS------------------NTTNPPPAPSKSPEEMRKLFIQRAKKIDKISRIGFPMAFLIFNMFYWIIYKIVRRE 452          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-3 (Glutamate-gated ChLoride channel; Glutamate-gated chloride channel subunit [Source:UniProtKB/TrEMBL;Acc:G5EEZ3])

HSP 1 Score: 236.113 bits (601), Expect = 2.486e-71
Identity = 162/492 (32.93%), Postives = 255/492 (51.83%), Query Frame = 3
Query:  171 RKMIKCFSICFFFMSTTSLGTSMNSDREQIQNHIFKGYKSNERP--------SENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAW----DHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQ--IPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSI--------NFLQMHLMGTP-----KTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLR-----KSISKPQVSEPPVQIDS---EIDGYSQFLFPAFFMLYNCFYWLYY 1541
            R ++    I  F++   +   S  SD E I+  + KGY    RP          +   IV V M + +I+ +D + MEYS  +  R+EW+D RLA+    D    F             ++IW+PD FF+N K  + H +  PN L+R+  +G +LYS +I+M  SC M LQ +PMD Q C +D+ SY YT + +++RW+  +P+ L   +   +P F +  NV T  C+  S T+TG Y+C++    L+RQ   YL   YIP+ ++V+VSW++FW+   AVPAR+TLG+ TLL + TQA+G++A LP VSY KAIDVWI AC+ F+ GAL+EFA  + IS +S    ++R+        L   +K AL    ++          ++M L   P     ++ +   ++++N   N  N+   +L +F          N +       ++I   +     + +D      D  S+ LFP  F+ +N  YW  Y
Sbjct:    4 RSLLNILLIVAFWIVGGNCDAS--SDTEIIKKLLGKGYDWRVRPPGINLTIPGTHGAVIVYVNMLIRSISKIDDVNMEYSVQLTFREEWVDGRLAYGFPGDSTPDFLILTAG-------QQIWMPDSFFQNEKQAHKHDIDKPNVLIRIHRDGRILYSVRISMVLSCPMHLQYYPMDVQTCLIDLASYAYTENDIEYRWKKTDPVQLKKGLHSSLPSF-ELNNVDTTLCT--SKTNTGTYSCLRTVLELRRQFSYYLLQLYIPSTMLVIVSWVSFWLDRGAVPARVTLGVTTLLTMTTQASGINAKLPPVSYTKAIDVWIGACLTFIFGALLEFAWVTYISSRS---FYKRNKNCSSRNSLLIETKQALIIPNTVVAQFPEHPEEVEMGLAQAPDVWIRQSGNGKTVSRVNGHINHNNDEAAELIIFDAKH-----KNRRFVWWTNFRNIRLIRWIRNRLNVDDNAKRADLISRVLFPTLFVCFNFVYWTKY 475          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-1 (Glutamate-gated chloride channel alpha [Source:UniProtKB/Swiss-Prot;Acc:G5EBR3])

HSP 1 Score: 230.335 bits (586), Expect = 2.645e-69
Identity = 147/431 (34.11%), Postives = 229/431 (53.13%), Query Frame = 3
Query:  255 QIQNHIF-KGYKSNERPSENKQ--TIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQ--IPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYW 1532
            +I  H+F  GY    RP  +     +V+V M +  I+ +DV+ MEYS  + LR+ WID+RL++      +    + V      +IW+PD FF N K  Y H++  PN L+R+  +G VLYS +I++  SC M LQ +PMD Q+C++D+ SY YT   +++ W+   P+ L   +   +P F Q TN  T  C+  S T+TG Y+C++ T  L+R+   YL   YIP+ ++V+VSW++FW    A+PAR+TLG+ TLL +  Q+ G+++ LP VSYIKAIDVWI AC+ F+  AL+EFA+ + I+ K   E   R                  +++  I  LQ                  N  ++   + +++ E   T  L     N  L    +K + ++    I   +D  S+ LFP  F ++N  YW
Sbjct:   65 KILAHLFTSGYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRESWIDKRLSYGVKGDGQP---DFVILTVGHQIWMPDTFFPNEKQAYKHTIDKPNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKVGLSSSLPSF-QLTNTSTTYCT--SVTNTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRTAIPARVTLGVTTLLTMTAQSAGINSQLPPVSYIKAIDVWIGACMTFIFCALLEFALVNHIANKQGVERKAR----------------TEREKAEIPLLQ------------------NLHNDVPTKVFNQEEKVRTVPLNRRQMNSFLNLLETKTEWND----ISKRVDLISRALFPVLFFVFNILYW 451          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-1 (Glutamate-gated chloride channel alpha [Source:UniProtKB/Swiss-Prot;Acc:G5EBR3])

HSP 1 Score: 230.335 bits (586), Expect = 2.645e-69
Identity = 147/431 (34.11%), Postives = 229/431 (53.13%), Query Frame = 3
Query:  255 QIQNHIF-KGYKSNERPSENKQ--TIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQ--IPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYW 1532
            +I  H+F  GY    RP  +     +V+V M +  I+ +DV+ MEYS  + LR+ WID+RL++      +    + V      +IW+PD FF N K  Y H++  PN L+R+  +G VLYS +I++  SC M LQ +PMD Q+C++D+ SY YT   +++ W+   P+ L   +   +P F Q TN  T  C+  S T+TG Y+C++ T  L+R+   YL   YIP+ ++V+VSW++FW    A+PAR+TLG+ TLL +  Q+ G+++ LP VSYIKAIDVWI AC+ F+  AL+EFA+ + I+ K   E   R                  +++  I  LQ                  N  ++   + +++ E   T  L     N  L    +K + ++    I   +D  S+ LFP  F ++N  YW
Sbjct:   65 KILAHLFTSGYDFRVRPPTDNGGPVVVSVNMLLRTISKIDVVNMEYSAQLTLRESWIDKRLSYGVKGDGQP---DFVILTVGHQIWMPDTFFPNEKQAYKHTIDKPNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKVGLSSSLPSF-QLTNTSTTYCT--SVTNTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRTAIPARVTLGVTTLLTMTAQSAGINSQLPPVSYIKAIDVWIGACMTFIFCALLEFALVNHIANKQGVERKAR----------------TEREKAEIPLLQ------------------NLHNDVPTKVFNQEEKVRTVPLNRRQMNSFLNLLETKTEWND----ISKRVDLISRALFPVLFFVFNILYW 451          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-15 (pep chromosome:WBcel235:V:13498786:13502743:-1 gene:WBGene00000233.1 transcript:R11G10.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-15)

HSP 1 Score: 226.098 bits (575), Expect = 1.504e-67
Identity = 150/444 (33.78%), Postives = 238/444 (53.60%), Query Frame = 3
Query:  240 NSDREQIQNHIFKGYKSNERPSENKQTI------VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQ--IPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVF-LTAQLLEASPNEKLRKSISKPQVSEPPVQIDSE-IDGYSQFLFPAFFMLYNCFYWLYY 1541
             SD E +++ + +GY    RP     TI      V+V M + +I+ +D + MEYS  +  R+ W+D+RL++    K  +  + L+    +E IW+PD FF+N K  Y H +  PN L+R+  +G +LYS +I++  SC M LQ +PMD Q+C +D+ SY YT   +++ W+   P+ L   +   +P F Q TN  T  C+  S T+TG Y+C++    L+RQ   YL   YIP+ ++V+VSW++FW+   AVPAR+TLG+ TLL + TQ++G++A LP V+YIKAIDVWI AC+ F+  AL+EFA  + I+ K       +D       E         +++  + FLQ                      NS N+ +   EV     +++    N +   S+ K   ++      S+  D  S+ +FP  F+ +N  YW +Y
Sbjct:   70 TSDTEILEHLLTRGYDHRVRPPGEDGTIHGGPVVVSVNMLLRSISKIDNVNMEYSVQLTFRESWVDKRLSFG--VKGDAQPDFLILTAGQE-IWMPDSFFQNEKQAYKHMIDKPNVLIRVHKDGTILYSVRISLVLSCPMHLQYYPMDVQQCFIDLASYAYTTKDIEYVWKEETPVQLKAGLSSSLPSF-QLTNTSTTYCT--SKTNTGSYSCLRTIIQLRRQFSYYLLQLYIPSCMLVIVSWVSFWIDRTAVPARVTLGVTTLLTMTTQSSGINAKLPPVAYIKAIDVWIGACMTFIFCALLEFAWVTYIANK-------QDANKRARTE---------REKAELPFLQ----------------------NSHNDVWVPREVAEQEREVMTVRMNRRQTNSVWKWIKTKTEWNDKSKRADLISRVMFPVLFLTFNISYWTHY 469          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-15 (pep chromosome:WBcel235:V:13498786:13502582:-1 gene:WBGene00000233.1 transcript:R11G10.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-15)

HSP 1 Score: 226.098 bits (575), Expect = 1.504e-67
Identity = 150/444 (33.78%), Postives = 238/444 (53.60%), Query Frame = 3
Query:  240 NSDREQIQNHIFKGYKSNERPSENKQTI------VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQ--IPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVF-LTAQLLEASPNEKLRKSISKPQVSEPPVQIDSE-IDGYSQFLFPAFFMLYNCFYWLYY 1541
             SD E +++ + +GY    RP     TI      V+V M + +I+ +D + MEYS  +  R+ W+D+RL++    K  +  + L+    +E IW+PD FF+N K  Y H +  PN L+R+  +G +LYS +I++  SC M LQ +PMD Q+C +D+ SY YT   +++ W+   P+ L   +   +P F Q TN  T  C+  S T+TG Y+C++    L+RQ   YL   YIP+ ++V+VSW++FW+   AVPAR+TLG+ TLL + TQ++G++A LP V+YIKAIDVWI AC+ F+  AL+EFA  + I+ K       +D       E         +++  + FLQ                      NS N+ +   EV     +++    N +   S+ K   ++      S+  D  S+ +FP  F+ +N  YW +Y
Sbjct:   70 TSDTEILEHLLTRGYDHRVRPPGEDGTIHGGPVVVSVNMLLRSISKIDNVNMEYSVQLTFRESWVDKRLSFG--VKGDAQPDFLILTAGQE-IWMPDSFFQNEKQAYKHMIDKPNVLIRVHKDGTILYSVRISLVLSCPMHLQYYPMDVQQCFIDLASYAYTTKDIEYVWKEETPVQLKAGLSSSLPSF-QLTNTSTTYCT--SKTNTGSYSCLRTIIQLRRQFSYYLLQLYIPSCMLVIVSWVSFWIDRTAVPARVTLGVTTLLTMTTQSSGINAKLPPVAYIKAIDVWIGACMTFIFCALLEFAWVTYIANK-------QDANKRARTE---------REKAELPFLQ----------------------NSHNDVWVPREVAEQEREVMTVRMNRRQTNSVWKWIKTKTEWNDKSKRADLISRVMFPVLFLTFNISYWTHY 469          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335420)

HSP 1 Score: 238.424 bits (607), Expect = 1.649e-72
Identity = 150/426 (35.21%), Postives = 237/426 (55.63%), Query Frame = 3
Query:  282 YKSNERPS-----ENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYL 1544
            Y +  RPS     +NK T V+V M + +I+ +D  KMEYS  +  R++W DERL +D I+    Y    ++     ++W+PDLFF N K+G+ H++  PN  +R+ PNG VLYS +I++  +C M+L+ +P+D Q C++ + SYG+T + L F W+  +P+ +   + +P F     + T  C+  S T+TG+Y+C+K     +R+   YL   YIP  ++V+VSW++FW+   AVPAR++LG+ TLL + TQ +G++A+LP VSY KAIDVW   C+ FV GAL+EFA+ +  SR              +H+E  K  +  L +Q S++     L+ T    +F     +    +        LE  L  ++   +P    R +  K  +S+ P +    ID  S+  FP  F L+N  YW  YL
Sbjct:   46 YDARIRPSGINGTDNKATNVSVNMFLRSISKIDDYKMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKFL-TDYCN--SKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSD------------MHKENMKKKRRDL-EQASLD-AASDLLDTDSNATFAMKPLVRHPGDPL-----ALEKRLQCEVHMQAPK---RPNCCKTWLSKFPTR-SKRIDVISRITFPLVFALFNLVYWSTYL 441          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335418)

HSP 1 Score: 238.424 bits (607), Expect = 2.345e-72
Identity = 152/429 (35.43%), Postives = 240/429 (55.94%), Query Frame = 3
Query:  282 YKSNERPS-----ENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDS---EIDGYSQFLFPAFFMLYNCFYWLYYL 1544
            Y +  RPS     +NK T V+V M + +I+ +D  KMEYS  +  R++W DERL +D I+    Y    ++     ++W+PDLFF N K+G+ H++  PN  +R+ PNG VLYS +I++  +C M+L+ +P+D Q C++ + SYG+T + L F W+  +P+ +   + +P F     + T  C+  S T+TG+Y+C+K     +R+   YL   YIP  ++V+VSW++FW+   AVPAR++LG+ TLL + TQ +G++A+LP VSY KAIDVW   C+ FV GAL+EFA+ +  SR   +       +  +H+E  K  +  L +Q S++     L     T+S    A      +  +     LE  L  ++   +P    R +  K  +S+ P +  S    ID  S+  FP  F L+N  YW  YL
Sbjct:   46 YDARIRPSGINGTDNKATNVSVNMFLRSISKIDDYKMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKFL-TDYCN--SKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSN-------KANMHKENMKKKRRDL-EQASLDAASDLL----DTDSNATFAMKPLVRHPGDPL--ALEKRLQCEVHMQAPK---RPNCCKTWLSKFPTRQCSRSKRIDVISRITFPLVFALFNLVYWSTYL 450          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0343788)

HSP 1 Score: 235.728 bits (600), Expect = 2.652e-71
Identity = 148/431 (34.34%), Postives = 236/431 (54.76%), Query Frame = 3
Query:  282 YKSNERPSENKQT----IVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHK------LEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYL 1544
            Y +  RPS    T    +V V + V +I+ +D + MEYS  +  R++W DERL +D I+    Y    ++     ++W+PDLFF N K+G+ H++  PN  +R+ PNG VLYS +I++  +C M+L+ +P+D Q C++ + SYG+T + L F W+  +P+ +   + +P F     + T  C+  S T+TG+Y+C+K     +R+   YL   YIP  ++V+VSW++FW+   AVPAR++LG+ TLL + TQ +G++A+LP VSY KAIDVW   C+ FV GAL+EFA+ +  SR   +       +  +H+E  K  +  L +Q S++     L+ T    +F   +Q                    LE  L  ++   +P    R +  K  +S+ P +    ID  S+  FP  F L+N  YW  YL
Sbjct:   46 YDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKFL-TDYCN--SKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSN-------KANMHKENMKKKRRDL-EQASLD-AASDLLDTDSNATFAMASQFARGGGQQKPLVRHPGDPLALEKRLQCEVHMQAPK---RPNCCKTWLSKFPTR-SKRIDVISRITFPLVFALFNLVYWSTYL 456          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0343790)

HSP 1 Score: 234.572 bits (597), Expect = 5.909e-71
Identity = 151/425 (35.53%), Postives = 237/425 (55.76%), Query Frame = 3
Query:  282 YKSNERPSENKQT----IVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYL 1544
            Y +  RPS    T    +V V + V +I+ +D + MEYS  +  R++W DERL +D I+    Y    ++     ++W+PDLFF N K+G+ H++  PN  +R+ PNG VLYS +I++  +C M+L+ +P+D Q C++ + SYG+T + L F W+  +P+ +   + +P F     + T  C+  S T+TG+Y+C+K     +R+   YL   YIP  ++V+VSW++FW+   AVPAR++LG+ TLL + TQ +G++A+LP VSY KAIDVW   C+ FV GAL+EFA+ +  SR S S    R     +H+E  K  +  L +Q S++     L     T+S    A      +  +     LE  L  ++   +P    R +  K  +S+ P +    ID  S+  FP  F L+N  YW  YL
Sbjct:   46 YDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKFL-TDYCN--SKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASR-SGSNKANRAAD--MHKENMKKKRRDL-EQASLDAASDLL----DTDSNATFAMKPLVRHPGDPL--ALEKRLQCEVHMQAPK---RPNCCKTWLSKFPTR-SKRIDVISRITFPLVFALFNLVYWSTYL 449          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335416)

HSP 1 Score: 233.032 bits (593), Expect = 1.905e-70
Identity = 148/425 (34.82%), Postives = 234/425 (55.06%), Query Frame = 3
Query:  282 YKSNERPSENKQT----IVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYL 1544
            Y +  RPS    T    +V V + V +I+ +D + MEYS  +  R++W DERL +D I+    Y    ++     ++W+PDLFF N K+G+ H++  PN  +R+ PNG VLYS +I++  +C M+L+ +P+D Q C++ + SYG+T + L F W+  +P+ +   + +P F     + T  C+  S T+TG+Y+C+K     +R+   YL   YIP  ++V+VSW++FW+   AVPAR++LG+ TLL + TQ +G++A+LP VSY KAIDVW   C+ FV GAL+EFA+ +  SR              +H+E  K  +  L +Q S++     L     T+S    A      +  +     LE  L  ++   +P    R +  K  +S+ P +    ID  S+  FP  F L+N  YW  YL
Sbjct:   46 YDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKFL-TDYCN--SKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSD------------MHKENMKKKRRDL-EQASLDAASDLL----DTDSNATFAMKPLVRHPGDPL--ALEKRLQCEVHMQAPK---RPNCCKTWLSKFPTR-SKRIDVISRITFPLVFALFNLVYWSTYL 440          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 242.662 bits (618), Expect = 5.452e-74
Identity = 146/426 (34.27%), Postives = 235/426 (55.16%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W+   P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G   +LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              H+EL ++ +   K  +     +  L  TP  N+  + A   + +N+A              +     +E++RK           +    +ID  S+  FP  F+ +N FYW+ Y IL
Sbjct:   56 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEKGPVQVADGLTLPQFILKDESDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQ--------------HKELLRFRRRRKKSGKEEEVRESRLSFTP--NAGKDGAVPKTANNAATTPSE-------PAVAPGKSHEEMRKLF---------IDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKIL 442          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 241.121 bits (614), Expect = 1.783e-73
Identity = 149/438 (34.02%), Postives = 239/438 (54.57%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQEL--FKWSKMALKKQQSINF---LQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIE 1571
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + I+R+              H+EL  F+  +  LK+ ++ +       + MG     +   +A   + +N+                   +P EK  + + K  +S         ID  S+  FP  F+++N FYW+ Y I +R  +I 
Sbjct:   47 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQ--------------HKELLRFQRRRRHLKEDEAGDGRFSFAAYGMGPACLQAKDGMAIKGNNNNAPT---------------STNPPEKTVEEMRKLFISRA-----KRIDTVSRVAFPLVFLIFNIFYWITYKI-IRSEDIH 442          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra4b (glycine receptor, alpha 4b [Source:ZFIN;Acc:ZDB-GENE-020402-2])

HSP 1 Score: 240.35 bits (612), Expect = 4.971e-73
Identity = 149/437 (34.10%), Postives = 236/437 (54.00%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVS--PLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIEMGL 1580
            GY +  RP+     + VT  + + +  S+    M+Y  +V+LRQ+W D RLA      ++ Y ++ +   P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMDTQ C M + S+GYT++ L F+W    P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++L V++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              ++E F+  +    +Q+  N   ++  G     S        S D   +E          A +    P       I +  V +        ID  S+ +FP  F+++N FYW+ Y +L R  +I + L
Sbjct:   68 GYDARIRPNFKGPPVNVTCNIFINSFGSITETTMDYRLNVFLRQQWNDPRLA------YKEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDTQTCTMQLESFGYTMNDLIFQWLDEGPVQVADDLMLPQFVLKEEKDLGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLTVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQ--------------YKEFFRLRRKL--RQEQRNRADLYFPGFGIDTSL-------SGDGPLSE---------AAAMFAGLPPGHALFDIRRRFVEQA-----KRIDTISRAVFPLSFLVFNVFYWVTYKVL-RNEDIHLAL 458          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 240.35 bits (612), Expect = 5.739e-73
Identity = 148/438 (33.79%), Postives = 238/438 (54.34%), Query Frame = 3
Query:  276 KGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQEL--FKWSKMALKKQQSINF---LQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIE 1571
            +G KS+    +     VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + I+R+              H+EL  F+  +  LK+ ++ +       + MG     +   +A   + +N+                   +P EK  + + K  +S         ID  S+  FP  F+++N FYW+ Y I +R  +I 
Sbjct:   60 QGSKSDGTHKKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQ--------------HKELLRFQRRRRHLKEDEAGDGRFSFAAYGMGPACLQAKDGMAIKGNNNNAPT---------------STNPPEKTVEEMRKLFISRA-----KRIDTVSRVAFPLVFLIFNIFYWITYKI-IRSEDIH 455          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra4b (glycine receptor, alpha 4b [Source:ZFIN;Acc:ZDB-GENE-020402-2])

HSP 1 Score: 239.58 bits (610), Expect = 6.836e-73
Identity = 148/437 (33.87%), Postives = 239/437 (54.69%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVS--PLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIEMGL 1580
            GY +  RP+     + VT  + + +  S+    M+Y  +V+LRQ+W D RLA      ++ Y ++ +   P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMDTQ C M + S+GYT++ L F+W    P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++L V++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              ++E F+  +   ++Q++ +      +  P     T+L+       +A  F         A L        +R+           V+    ID  S+ +FP  F+++N FYW+ Y +L R  +I + L
Sbjct:   51 GYDARIRPNFKGPPVNVTCNIFINSFGSITETTMDYRLNVFLRQQWNDPRLA------YKEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDTQTCTMQLESFGYTMNDLIFQWLDEGPVQVADDLMLPQFVLKEEKDLGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLTVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQ--------------YKEFFRLRRKLRQEQRNRD------LYFPGFGIDTSLSGDGPLSEAAAMF---------AGLPPGHALFDIRRRF---------VEQAKRIDTISRAVFPLSFLVFNVFYWVTYKVL-RNEDIHLAL 440          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 244.202 bits (622), Expect = 2.169e-74
Identity = 158/471 (33.55%), Postives = 253/471 (53.72%), Query Frame = 3
Query:  201 FFFMSTTSLGTSMNSDREQIQNHIF--------KGYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFT----NLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIE 1571
            FF  ++  +G S  S  + +    F         GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    STG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K EL +   +   H            K   +N LQ       +  SF       A + + D  + +  +      +AQ +  SP+E  +  IS+ +          +ID  S+  FP  F+++N FYW+ Y I VR  ++ 
Sbjct:   11 FFLAASKEVGASARSSAKLMSPSDFLDKLMGKISGYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFILKEEKDLRYCTK--HYSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK-ELLRFRRRRRHH------------KSPMLNLLQEDENAEGRF-SFAAYGMGPACLQAKDGISMKGNNNNNPASSAQPVSKSPDEMRKLFISRAK----------KIDKVSRIGFPLVFLIFNTFYWIIYKI-VRSEDVH 449          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 243.817 bits (621), Expect = 3.568e-74
Identity = 157/475 (33.05%), Postives = 255/475 (53.68%), Query Frame = 3
Query:  177 MIKCFSICFFFMSTTSLGTSMNSDREQIQNHIF--------KGYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIE 1571
            +I   S   F  ++  +G S  S  + +    F         GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    STG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K EL +   +   H+E           +   +F   + MG          A + + D  + +  +      +AQ +  SP+E  +  IS+ +          +ID  S+  FP  F+++N FYW+ Y I VR  ++ 
Sbjct:   11 IIPIVSAMIFLAASKEVGASARSSAKLMSPSDFLDKLMGKISGYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFILKEEKDLRYCTK--HYSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK-ELLRFRRRRRHHKE-------DENAEGRFSF-AAYGMGP---------ACLQAKDGISMKGNNNNNPASSAQPVSKSPDEMRKLFISRAK----------KIDKVSRIGFPLVFLIFNTFYWIIYKI-VRSEDVH 449          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 242.276 bits (617), Expect = 1.231e-73
Identity = 150/433 (34.64%), Postives = 242/433 (55.89%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIE 1571
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    STG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K EL +   +   H+E           +   +F   + MG          A + + D  + +  +      +AQ +  SP+E  +  IS+ +          +ID  S+  FP  F+++N FYW+ Y I VR  ++ 
Sbjct:   51 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFILKEEKDLRYCTK--HYSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK-ELLRFRRRRRHHKE-------DENAEGRFSF-AAYGMGP---------ACLQAKDGISMKGNNNNNPASSAQPVSKSPDEMRKLFISRAK----------KIDKVSRIGFPLVFLIFNTFYWIIYKI-VRSEDVH 447          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 241.506 bits (615), Expect = 1.325e-73
Identity = 150/433 (34.64%), Postives = 242/433 (55.89%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIE 1571
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    STG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K EL +   +   H+E           +   +F   + MG          A + + D  + +  +      +AQ +  SP+E  +  IS+ +          +ID  S+  FP  F+++N FYW+ Y I VR  ++ 
Sbjct:   34 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFILKEEKDLRYCTK--HYSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK-ELLRFRRRRRHHKE-------DENAEGRFSF-AAYGMGP---------ACLQAKDGISMKGNNNNNPASSAQPVSKSPDEMRKLFISRAK----------KIDKVSRIGFPLVFLIFNTFYWIIYKI-VRSEDVH 430          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:100498379])

HSP 1 Score: 241.891 bits (616), Expect = 1.701e-73
Identity = 150/433 (34.64%), Postives = 242/433 (55.89%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIE 1571
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    STG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K EL +   +   H+E           +   +F   + MG          A + + D  + +  +      +AQ +  SP+E  +  IS+ +          +ID  S+  FP  F+++N FYW+ Y I VR  ++ 
Sbjct:   52 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRLNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEITTDNKLLRIFKNGNVLYSIRLTLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWEEVGAVQVAEGLTLPQFILKEEKDLRYCTK--HYSTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK-ELLRFRRRRRHHKE-------DENAEGRFSF-AAYGMGP---------ACLQAKDGISMKGNNNNNPASSAQPVSKSPDEMRKLFISRAK----------KIDKVSRIGFPLVFLIFNTFYWIIYKI-VRSEDVH 448          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra3 (glycine receptor, alpha 3 subunit [Source:MGI Symbol;Acc:MGI:95749])

HSP 1 Score: 246.128 bits (627), Expect = 5.817e-75
Identity = 145/434 (33.41%), Postives = 237/434 (54.61%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEA-------SPNEKLRKSISKP-QVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W+   P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              H+EL ++ +    K ++    + +              + + TD+   E       +     L+A        PN  ++     P ++ +  +    +ID  S+  FP  F+++N FYW+ Y IL
Sbjct:   72 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQ--------------HKELLRFRRKRKNKTEAFALEKFY--------------RFSDTDDEVRESRFSFTAYGMGPCLQAKDGVVPKGPNHAVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKIL 470          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 241.891 bits (616), Expect = 1.424e-73
Identity = 147/429 (34.27%), Postives = 238/429 (55.48%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA++        +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W+    + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  +      +    +     +   NF   + MG          A + + D  + +  +             SP E++RK           +Q   +ID  S+  FP  F+++N FYW+ Y I+ R+
Sbjct:   51 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKSPMLNLFQDDEGGEGRFNF-SAYGMGP---------ACLQAKDGISVKGANNNNTTNPPPAPSKSP-EEMRKLF---------IQRAKKIDKISRIGFPMAFLIFNMFYWIIYKIVRRE 452          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra2 (glycine receptor, alpha 2 subunit [Source:MGI Symbol;Acc:MGI:95748])

HSP 1 Score: 241.506 bits (615), Expect = 1.905e-73
Identity = 155/436 (35.55%), Postives = 240/436 (55.05%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDS----------EIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  SV    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG+VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W S  P+ +   + +P+F      +   C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  Q   ++E        + ++   NF   + MG        +  QM   D +A               ++A+P   L      PQ   PP   D+           ID  S+  FP  F+++N FYW+ Y I+
Sbjct:   57 GYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKE------EDVTRESRFNF-SGYGMG--------HCLQMK--DGTA---------------VKATPANPL------PQ---PPKDADAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKII 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 238.424 bits (607), Expect = 2.613e-72
Identity = 147/429 (34.27%), Postives = 237/429 (55.24%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA++        +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W+    + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  +     +           +   NF   + MG          A + + D  + +  +             SP E++RK           +Q   +ID  S+  FP  F+++N FYW+ Y I+ R+
Sbjct:   51 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKDD--------EGGEGRFNF-SAYGMGP---------ACLQAKDGISVKGANNNNTTNPPPAPSKSP-EEMRKLF---------IQRAKKIDKISRIGFPMAFLIFNMFYWIIYKIVRRE 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 234.187 bits (596), Expect = 1.142e-71
Identity = 141/396 (35.61%), Postives = 223/396 (56.31%), Query Frame = 3
Query:  375 MEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            M+Y  +++LRQ+W D RLA++        +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W+    + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  +     +           +   NF   + MG          A + + D  + +  +             SP E++RK           +Q   +ID  S+  FP  F+++N FYW+ Y I+ R+
Sbjct:    1 MDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKDD--------EGGEGRFNF-SAYGMGP---------ACLQAKDGISVKGANNNNTTNPPPAPSKSP-EEMRKLF---------IQRAKKIDKISRIGFPMAFLIFNMFYWIIYKIVRRE 361          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|O75311|GLRA3_HUMAN (Glycine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GLRA3 PE=1 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 7.519e-75
Identity = 150/431 (34.80%), Postives = 242/431 (56.15%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSEL-WQRDVQNIVH----QELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W+   P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L ++R  +N       ++ +++S M  + ++S      + MG          A+   T    N            Q++  SP+E  +  I + +          +ID  S+  FP  F+++N FYW+ Y IL
Sbjct:   56 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEAFALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQ------AKDGMTPKGPNH---------PVQVMPKSPDEMRKVFIDRAK----------KIDTISRACFPLAFLIFNIFYWVIYKIL 454          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|Q91XP5|GLRA3_MOUSE (Glycine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Glra3 PE=1 SV=2)

HSP 1 Score: 246.514 bits (628), Expect = 1.910e-74
Identity = 145/434 (33.41%), Postives = 237/434 (54.61%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEA-------SPNEKLRKSISKP-QVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W+   P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              H+EL ++ +    K ++    + +              + + TD+   E       +     L+A        PN  ++     P ++ +  +    +ID  S+  FP  F+++N FYW+ Y IL
Sbjct:   56 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQ--------------HKELLRFRRKRKNKTEAFALEKFY--------------RFSDTDDEVRESRFSFTAYGMGPCLQAKDGVVPKGPNHAVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKIL 454          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P24524|GLRA3_RAT (Glycine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Glra3 PE=1 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 6.056e-74
Identity = 148/435 (34.02%), Postives = 236/435 (54.25%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEA-------SPNEKLRKSISKPQVSEPPVQID--SEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W+   P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              H+EL ++ +    K ++               +     + + TD+   E       +     L+A        PN  + + + K       V ID   +ID  S+  FP  F+++N FYW+ Y IL
Sbjct:   56 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQ--------------HKELLRFRRKRKNKTEAF--------------ALEKFYRFSDTDDEVRESRLSFTAYGMGPCLQAKDGVVPKGPNHAV-QVMPKSADEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKIL 454          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|Q64018|GLRA1_MOUSE (Glycine receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Glra1 PE=1 SV=2)

HSP 1 Score: 241.891 bits (616), Expect = 9.959e-73
Identity = 147/429 (34.27%), Postives = 238/429 (55.48%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA++        +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W+    + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  +      +    +     +   NF   + MG          A + + D  + +  +             SP E++RK           +Q   +ID  S+  FP  F+++N FYW+ Y I+ R+
Sbjct:   51 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKSPMLNLFQDDEGGEGRFNF-SAYGMGP---------ACLQAKDGISVKGANNNNTTNPPPAPSKSP-EEMRKLF---------IQRAKKIDKISRIGFPMAFLIFNMFYWIIYKIVRRE 452          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P07727|GLRA1_RAT (Glycine receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Glra1 PE=1 SV=4)

HSP 1 Score: 241.891 bits (616), Expect = 1.205e-72
Identity = 148/429 (34.50%), Postives = 239/429 (55.71%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA++        +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W+    + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  +      +    +     +   NF   + MG          A + + D  + +  +       A     SP E++RK           +Q   +ID  S+  FP  F+++N FYW+ Y I+ R+
Sbjct:   51 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKSPMLNLFQDDEGGEGRFNF-SAYGMGP---------ACLQAKDGISVKGANNNNTTNPAPAPSKSP-EEMRKLF---------IQRAKKIDKISRIGFPMAFLIFNMFYWIIYKIVRRE 452          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A183SPC0 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS6068 PE=3 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 3.290e-158
Identity = 238/439 (54.21%), Postives = 314/439 (71.53%), Query Frame = 3
Query:  249 REQIQNHIFKGYKSNERPSE--NKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            R+++   +F  YK++ERP+E  +  T+V V MKVLAI SVDV  M+Y  D  LRQ W D RLAWD  ++F ++   LVSP  KE +WLPDLFFRNGKDGY+H MT PNYLLR+ PNG VLYSQKITM+FSCQMDLQTFPMDTQ C+M+IGSYGYTL++LKF WR   P+ LP  +QI EFN P+N  TIDC+ +SSTSTG+YTC+ A F L+RQLGSYL +TYIPN+LI+MVSWL+F+VS+DA PAR+ LGLL+LLG+LTQA+ ++ANLPRVSYIKAID+W+I  I+FVI  L+E+AIA  + R+ + E W+ DV++IV +EL +W     + Q +   L+   +G   +  F               FY+ L++FLT  ++E S  +  +  I        P   +SEID YS+FLFP  +++YN FYWLYYL++V++
Sbjct:   82 RDRLVGMLFSNYKTHERPTELLDMATVVEVNMKVLAIFSVDVRTMDYYIDALLRQTWTDPRLAWDTSKEFENFTQALVSPTLKESLWLPDLFFRNGKDGYLHKMTLPNYLLRVYPNGNVLYSQKITMRFSCQMDLQTFPMDTQHCHMNIGSYGYTLNELKFAWRPENPVELPDKLQISEFNTPSNFTTIDCTAMSSTSTGNYTCLMAKFALKRQLGSYLVTTYIPNILIIMVSWLSFYVSVDAAPARVPLGLLSLLGLLTQASSVTANLPRVSYIKAIDLWLIFSIIFVISVLVEYAIAITLLRRKRRENWRNDVESIVKEELARWCAACQQTQLANMQLKSGAVGHELSQQFA--------------FYNDLDLFLTRTVIEESQKKSRKTKI--------PEATESEIDAYSRFLFPTCYIMYNVFYWLYYLVIVKQ 498          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A3P7LGN4 (Ig-like domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS11906 PE=3 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.463e-157
Identity = 238/439 (54.21%), Postives = 310/439 (70.62%), Query Frame = 3
Query:  249 REQIQNHIFKGYKSNERPSE--NKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            R+++   +F  YK++ERP+E  +  T+V V MKVLAI SVDV  M+Y  D  LRQ W D RLAWD  ++F ++   LVSP  KE +WLPDLFFRNGKDGY+H MT PNYLLR+ PNG VLYSQKITM+FSCQMDLQTFPMDTQ C+M+IGSYGYTL++LKF WR   P+ LP  +QI EFN P+N  TIDC+ +SSTSTG+YTC+ A F L+RQLGSYL +TYIPN+LI+MVSWL+F+VS+DA PAR+ LGLL+LLG+LTQA+ ++ANLPRVSYIKAID+W+I  I+FVI  L+E+AIA  + R+ + E W+ DV+ IV +EL +W        Q      M L      + F+              FY+ L++FLT  ++E S  +  +  I        P   +SEID YS+FLFP  +++YN FYWLYYL++V++
Sbjct:   85 RDRLVGMLFSNYKTHERPTELLDVATVVEVNMKVLAIFSVDVRTMDYYIDALLRQTWTDPRLAWDTSKEFENFTQALVSPTLKESLWLPDLFFRNGKDGYLHKMTLPNYLLRVYPNGHVLYSQKITMRFSCQMDLQTFPMDTQHCHMNIGSYGYTLNELKFTWRPESPVELPDKLQISEFNTPSNFTTIDCTAMSSTSTGNYTCLMAKFALKRQLGSYLVTTYIPNILIIMVSWLSFYVSVDAAPARVPLGLLSLLGLLTQASSVTANLPRVSYIKAIDLWLIFSIIFVISVLVEYAIAITLLRRKRRENWRNDVETIVKEELARWCAAC----QQTQLANMQLNSGAVAHEFSQ----------QFAFYNDLDLFLTRTVIEESQKKSRKTKI--------PEATESEIDAYSRFLFPTCYIMYNVFYWLYYLVIVKQ 501          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A068YF69 (Glycine receptor subunit alpha 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001119800 PE=3 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 2.800e-156
Identity = 239/441 (54.20%), Postives = 314/441 (71.20%), Query Frame = 3
Query:  243 SDREQIQNHIFKGYKSNERPSE--NKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            + R+++   +F  YK++ERP+E  +  T+V + MKVLAI SVDV  M+Y  D  LRQ W D RLAW+H E F++Y   LVSP  KE +WLPDLFFRNGKDGY+H MT PNYLLR+ PNGEVLYSQKITM+FSCQMDL TFPMDTQ C+M+IGSYGYTL +LKF WR  EP+ L   +Q+ EFN PTN  T+DC+  SSTSTG+YTC+ A F L+RQLGSYL +TYIPN+LI+MVSWL+F+VS+DA PAR+ LGLL+LLG+LTQA+ ++ NLPRVSYIKAID+W+I  I+FVIG L+E+AIA  + R+ + E W+ DV+ IV +EL +W  +A  +Q  +  +Q    G+          Q          +++ L+ FLT  ++E +  +K  K       S  PV ++SEID YS+FLFP  +++YN FYW YYL +V+K
Sbjct:   56 TQRDRLVGMLFANYKTHERPTEKLDIPTVVEINMKVLAIFSVDVRTMDYYIDALLRQTWTDPRLAWNHREGFKNYTQPLVSPTLKENLWLPDLFFRNGKDGYLHKMTLPNYLLRVHPNGEVLYSQKITMRFSCQMDLATFPMDTQYCHMNIGSYGYTLSELKFVWREKEPVELQNNLQLSEFNTPTNFTTLDCTAQSSTSTGNYTCLMAQFSLKRQLGSYLVTTYIPNILIIMVSWLSFYVSVDAAPARVPLGLLSLLGLLTQASSITGNLPRVSYIKAIDLWLIFSIIFVIGVLVEYAIAITMLRQKRKETWRGDVELIVKEELTRW--LAACEQGQMASIQ----GSGGVRGDQGFIQQQLA------YFNDLDAFLTKSVIEETRAKKGDKK------SRVPVAVESEIDAYSRFLFPTCYIMYNIFYWTYYLAIVKK 478          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A0R3X4J8 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8324 PE=3 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 7.274e-156
Identity = 239/441 (54.20%), Postives = 314/441 (71.20%), Query Frame = 3
Query:  243 SDREQIQNHIFKGYKSNERPSE--NKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            + R+++   +F  YK++ERP+E  +  T+V + MKVLAI SVDV  M+Y  D  LRQ WID RLAW+H E F++Y   LVSP  KE +WLPDLFFRNGKDGY+H MT PNYLLR+ PNGEVLYSQKITM+FSCQMDL TFPMDTQ C+M+IGSYGYTL +LKF WR  EP+ L   +Q+ EFN PTN  T+DC+  SSTSTG+YTC+ A F L+RQLGSYL +TYIPN+LI+MVSWL+F+VS+DA PAR+ LGLL+LLG+LTQA+ ++ NLPRVSYIKAID+W+I  I+FVIG L+E+AIA  + R+ + E W+ DV+ IV +EL +W     + Q +     M   G  + +      Q+         +++ L+ FLT  ++E +  +K  K       S  PV ++SEID YS+FLFP  +++YN FYW YYL +V+K
Sbjct:   76 TQRDRLVGMLFANYKTHERPTEKLDIPTVVEINMKVLAIFSVDVRTMDYYIDALLRQTWIDPRLAWNHREDFQNYTQPLVSPTLKENLWLPDLFFRNGKDGYLHKMTLPNYLLRVHPNGEVLYSQKITMRFSCQMDLATFPMDTQYCHMNIGSYGYTLSELKFIWREKEPVELQNNLQLSEFNTPTNFTTLDCTAQSSTSTGNYTCLMAQFSLKRQLGSYLVTTYIPNILIIMVSWLSFYVSVDAAPARVPLGLLSLLGLLTQASSITGNLPRVSYIKAIDLWLIFSIIFVIGVLVEYAIAITMLRQKRKETWRGDVELIVKEELTRWLAACEQSQMA----SMQGSGCVRGDQGFIQQQL--------AYFNDLDAFLTKSVIEETRAKKGGKK------SRIPVAVESEIDAYSRFLFPTCYIMYNIFYWTYYLAIVKK 498          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: U6J8V0 (Glycine receptor subunit alpha 1 OS=Echinococcus granulosus OX=6210 GN=EGR_05559 PE=3 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 1.055e-155
Identity = 238/441 (53.97%), Postives = 314/441 (71.20%), Query Frame = 3
Query:  243 SDREQIQNHIFKGYKSNERPSE--NKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRK 1559
            + R+++   +F  YK++ERP+E  +  T+V + MKVLAI SVDV  M+Y  D  LRQ W D RLAW+H E F++Y   LVSP  KE +WLPDLFFRNGKDGY+H MT PNYLLR+ PNGEVLYSQKITM+FSCQMDL TFPMDTQ C+M+IGSYGYTL +L+F WR  EP+ L   +Q+ EFN PTN  T+DC+  SSTSTG+YTC+ A F L+RQLGSYL +TYIPN+LI+MVSWL+F+VS+DA PAR+ LGLL+LLG+LTQA+ ++ NLPRVSYIKAID+W+I  I+FVIG L+E+AIA  + R+ + E W+ DV+ IV +EL +W  +A  +Q  +  +Q    G+          Q          +++ L+ FLT  ++E +  +K  K       S  PV ++SEID YS+FLFP  +++YN FYW YYL +V+K
Sbjct:   56 TQRDRLVGMLFANYKTHERPTEKLDIPTVVEINMKVLAIFSVDVRTMDYYIDALLRQTWTDPRLAWNHREGFKNYTQPLVSPTLKENLWLPDLFFRNGKDGYLHKMTLPNYLLRVHPNGEVLYSQKITMRFSCQMDLATFPMDTQYCHMNIGSYGYTLSELQFVWREKEPVELQNNLQLSEFNTPTNFTTLDCTAQSSTSTGNYTCLMAKFSLKRQLGSYLVTTYIPNILIIMVSWLSFYVSVDAAPARVPLGLLSLLGLLTQASSITGNLPRVSYIKAIDLWLIFSIIFVIGVLVEYAIAITMLRQKRKETWRGDVELIVKEELTRW--LAACEQGQMASIQ----GSGGVRGDQGFIQQQLA------YFNDLDAFLTKSVIEEARAKKGDKK------SRVPVAVESEIDAYSRFLFPTCYIMYNIFYWTYYLAIVKK 478          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 241.506 bits (615), Expect = 1.457e-73
Identity = 147/427 (34.43%), Postives = 235/427 (55.04%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSEL-WQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + I+R+ K  L +QR  +++   E           +   +F   + MG     +   +A   + +N+                  + P EK  + + K  +S         ID  S+  FP  F+++N FYW+ Y I+
Sbjct:   50 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDE---------AGEGRFSF-AAYGMGPACLQAKDGMAIKGNNNNAPT---------------SSIPPEKTVEEMRKLFISRA-----KRIDTVSRVAFPLVFLIFNIFYWIIYKII 439          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 239.965 bits (611), Expect = 7.300e-73
Identity = 146/427 (34.19%), Postives = 234/427 (54.80%), Query Frame = 3
Query:  276 KGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSEL-WQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            +G KS+    +     VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + I+R+ K  L +QR  +++   E           +   +F   + MG     +   +A   + +N+                  + P EK  + + K  +S         ID  S+  FP  F+++N FYW+ Y I+
Sbjct:   63 QGSKSDGTHKKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDE---------AGEGRFSF-AAYGMGPACLQAKDGMAIKGNNNNAPT---------------SSIPPEKTVEEMRKLFISRA-----KRIDTVSRVAFPLVFLIFNIFYWIIYKII 452          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 240.35 bits (612), Expect = 1.007e-72
Identity = 148/445 (33.26%), Postives = 243/445 (54.61%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKS---ELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPP--------------VQID--SEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W++  P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G   +LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K       +R     +H   F+  +   +  QS+N L+           + ++ QM+ +++   E       F      + +  +    + S P+    P              + ID   +ID  S+  FP  F+ +N FYW+ Y IL
Sbjct:   55 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRRRKKSTKLHDRSFE--EELSESLQSVNGLR------SADPVYGSMDQMSESNDREEEVRESCLSFTANAGKDGTMTKPTNNAASTPKGQPTPTVPQAGKSTEEMRKIFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKIL 484          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 238.039 bits (606), Expect = 2.196e-72
Identity = 147/428 (34.35%), Postives = 234/428 (54.67%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKS--ELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  SV    M+Y  +++LRQ+W D RLA+         + +L + P   + IW PDLFF N K    H +TT N LLR+  +G VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W    P+ +   + +P+F      +   C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K    L +R  +N+  +EL         ++   +F    +    K  +    A  N+                 + L +A  N K  K + + +           ID  S+  FP  F+++N FYW+ Y I+
Sbjct:   45 GYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQKWNDPRLAYSEYP-----DPSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDEGPVQVAEGLTLPQFIMREEKELGYCTK--HYNTGKFTCIEVKFKLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQKEFLRLKRRQKRNL-KEEL---------REGRFHFSGYSMAPCMKDGTVVKSATANAIQQP-------------SALRDAEHNRK--KFVDRAK----------RIDTISRAAFPLAFLIFNIFYWITYKII 430          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 238.039 bits (606), Expect = 3.264e-72
Identity = 148/433 (34.18%), Postives = 237/433 (54.73%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQ-----ID--SEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W++  P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G   +LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              H+EL ++ +   K  +     +  L       SFT  A  + T              +T     A+   K + + + PQ  +   +     ID   +ID  S+  FP  F+ +N FYW+ Y IL
Sbjct:   55 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQ--------------HKELLRFRRRRKKSTKEEEVRESCL-------SFTANAGKDGT--------------MTKPTNNAASTPKGQPTPTVPQAGKSTEEMRKIFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKIL 445          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008467.1 (pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 gene:ENSPMAG00000007648.1 transcript:ENSPMAT00000008467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.136 bits (640), Expect = 7.964e-78
Identity = 149/443 (33.63%), Postives = 240/443 (54.18%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDH--IEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKS-----KSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIEMGLI 1583
            GY    RP+     + V+  + + +  S+     +Y   VYLRQ W D RLA+ H  +       +N+      + IW PDLFF N K  + H +TT N +LR+  NG V Y+ ++T+  SC MDL  FPMDTQ C+M + S+GYT   + F W    P+ L   + +P+F     + T  C++  + STG +TCI A F L R++G YL   Y+P++LIV++SW++FW++++A PAR+ LG+ T+L + TQ+TG  A+LP+VSYIKA+D+W+  C+LFV  AL+E+A  ++ SR+S     K    Q+ +  +VH+++F W  +  +    + +  + +           L  +    +S       ++  L+ Q       EK+RK           V     ID  S+  FP  F+++N  YW  + +++ KRN+ +G I
Sbjct:   55 GYNHRVRPNFGGPAVNVSCGVFIRSFGSIQEATSDYRMTVYLRQRWTDPRLAYSHYPVPLLHLDQSNI------KHIWKPDLFFDNEKSAHFHEITTDNKMLRIANNGVVDYAMRLTLTLSCPMDLHNFPMDTQMCSMYLESFGYTTADIVFHWNGPTPVSLFEGLTLPQFVLSNKISTGSCTK--TYSTGSFTCIFAKFTLHREMGFYLIQLYVPSILIVILSWVSFWINMEAAPARVALGITTVLTLTTQSTGARASLPKVSYIKAMDIWMATCLLFVFAALLEYAAVNVTSRQSQGFMKKGRGNQKPIDLLVHKKMF-WKFLVAENDNDLLYFTITIF---------TLNGLLPVSDSKKPVIVCIKPLLSLQ----ETKEKMRKKY---------VACAQTIDNISRLFFPISFLIFNVVYWFAFKVML-KRNVHVGPI 465          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 227.254 bits (578), Expect = 1.637e-69
Identity = 140/407 (34.40%), Postives = 224/407 (55.04%), Query Frame = 3
Query:  324 VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYY 1541
            VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  +G VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W+    + +   + +P+F        + C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K  L  R  +     +L   + + L       F+   +   P  N F  + + N    + +    K      A    A   + ++K           V     ID  S+  FP  F+++N FYW+ Y
Sbjct:    8 VTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWKQEGAVQVAEGLTLPQFVLKDEKDLVYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKELLRIRRRRQRNQIDL---TSLILICNIFTYFINSSV---PIFNMFKRV-EGNERALTKDSVSVKGVNATNAAPAPAPTQDAIKKKF---------VDRAKRIDTISRAAFPLAFLIFNIFYWIIY 391          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 208.764 bits (530), Expect = 5.896e-64
Identity = 107/265 (40.38%), Postives = 167/265 (63.02%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI---VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHI-EKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVS 1061
            GY    RP+    T+    +VY+K  +  S++   M+Y   ++LRQ+WID RL + H  E +   + + +     + IW PDLFF N K  Y H +TT N +LR+  NG VL++ ++T+  SC MDL+ FPMDTQ C M + S+GYT+  L F W   EP+I+   + +P+F   + + T  C +L S+ TG ++CI A F L R++G YL   Y+P+ LIV++SW++FW++++A PAR+ LG+ T+L + TQ+TG  A+LP+V+
Sbjct:   16 GYDHRIRPNFGGPTVNVNCSVYIK--SFGSIEETTMDYQVTIFLRQKWIDPRLTYSHYPEPYLDLDQSNI-----QYIWRPDLFFDNEKSAYFHEVTTDNKMLRIFKNGLVLFTVRLTLTLSCPMDLRNFPMDTQMCYMFLESFGYTMADLSFHWDEEEPVIISKELVLPQFVLSSKIDTDSCDKLYSSGTGHFSCISARFVLHREMGFYLIQLYVPSALIVIISWVSFWINMEAAPARVALGITTVLTMTTQSTGARASLPKVT 273          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 206.453 bits (524), Expect = 6.893e-61
Identity = 136/428 (31.78%), Postives = 213/428 (49.77%), Query Frame = 3
Query:  279 GYKSNERPS-ENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLV--SPLFKEKIWLPDLFFRNGKDGYVHS---MTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQEL-FKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYY 1541
            GY S  RP+ +    +V   + V     V+   M+YS +++LRQ W D R+   ++ K   YN + +     F + +W PDLFF N K         +T   Y+             ++++  +C M L+ +PMD Q C++ + SYGYT + L F+W   EP+     +  P+F         +C++    + G ++C+KATFFL R +G YL   YIP+ L+V++SWL+FW++++A PAR+ LG+ T+L + TQ T  +A LP+VSYIKAIDVW+ AC +FV  AL+EFA  +M +R+        D  +    EL  +W +       S+   Q H    P+ +  +                 K  VF T        N   R  +S  +     +     ID  S+ +FP  FM++N FYW+ Y
Sbjct:   55 GYDSRMRPNVDGPPVVVNCSILVKGFGPVEEATMDYSINIFLRQTWNDPRIL--NVLKSIEYNTDFLDLGNSFVDSVWKPDLFFENEKSAAFQMYQLVTGFKYMYTFAMWITCFLCFRLSLVLACPMSLEVYPMDAQYCSIYLESYGYTTNDLIFQWNDTEPVSFGAGVSTPKFTLSNETFLGECTK--EYTYGTFSCVKATFFLDRDMGYYLIQVYIPSCLLVIISWLSFWLNVEAAPARVGLGITTILTVTTQMTSANAALPKVSYIKAIDVWMGACQVFVFSALLEFAAVNMATRRHGISPSHHDGDHGTKGELPIEWKRHRHANVSSVRRPQRH---RPERDCRSQ---------------GKPGVFHTNS--RRDENNATRVHVSDEEWRYQSLLHARRIDYISRVIFPTVFMIFNIFYWVIY 458          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002305.1 (pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 gene:ENSPMAG00000002075.1 transcript:ENSPMAT00000002305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 6.685e-56
Identity = 129/438 (29.45%), Postives = 219/438 (50.00%), Query Frame = 3
Query:  282 YKSNERPS-ENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERL-----AWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRK---SKSELWQRDVQNIVHQELF---KWSKMALKKQQSINFLQMHLMGTPKTNSFTN------LAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYY 1541
            Y    RP+      +V   + V +   ++   M+Y   +YL+Q WID R+     A  + + F    NN +     + +W PDLFF N K    H +     ++    N +  +S  +++  +C M+L+ +P+DTQEC +++ S+GYT   L F+W   EP+++   +  P+F    + +  DCS+     TG ++CI ATF+L R +G YL   Y P+ L+V++SWL+FW+S+++ PAR++LG+ T+L + TQ T  +A LP++SYIKA+DVW+ AC +FV  AL+E  + S+  +     K+E   RD +N    +LF    +  +   + +S+           +T S  N      ++Q   +D  A E                       +S+ + +          +ID  S+ LFP  F+++   YW  Y
Sbjct:   44 YDGRLRPNMYGSPVLVNCSVLVKSFGPIEENTMDYMMLIYLQQSWIDSRIESIYSAGHYQKDFLDLANNYI-----DTVWTPDLFFENEKSAAFHEIHCRFSIIVHATNNKTCFSLVLSLTLACPMNLEYYPLDTQECRINLESFGYTTQDLIFQWDENEPLVVATNLYTPKFKLSNHTELGDCSK--EYLTGTHSCINATFYLHRDMGYYLIQVYFPSCLLVIISWLSFWLSVESTPARVSLGITTILTVTTQMTSANAALPKMSYIKAMDVWMAACQVFVFAALLESTVVSVTKQHVVSGKAE--TRDQKNNNVWDLFFNPLYDVVGYNRSRSLG------RAAKRTTSVVNQPHGWFISQPTDSDGMARE-----------------------RSLVRSR----------QIDYISRVLFPLAFVIFLTIYWFSY 433          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 197.593 bits (501), Expect = 1.209e-57
Identity = 132/439 (30.07%), Postives = 233/439 (53.08%), Query Frame = 3
Query:  243 SDREQIQNHIFKGYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCS-ELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSE-IDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            S+   + +++ +GY    RP      + VTV   VL+I++++VI M+Y  D +LRQ W D RL      K R  +   +S    +KIW+PD +F N K    HS+TT N +L + P+G V Y+ ++T+K SC M+L+ FP D Q CN+DI SYGY+ D ++++W +     +    +I +  Q  N+  I+ S   +    G+++ + ATF  +R+ G ++   Y P  LIV++SW++F +  ++  ARI LG+ ++L I T    ++ ++P+VSY+KA+D ++I C LFV   L+E+     I  +  +E +++D+ N        +S  ++K +        H M     N ++            +  +H     +  +    S  E+L     +P++  P V ID+E ID +++ LFP  F+ +N  Y++ +  +
Sbjct:    4 SEMTSLLDNLIQGYDPRLRPDFGGDPVTVTVGFWVLSIDAINVIDMDYRMDFFLRQLWRDPRL------KHRFDDTLALSNTMLDKIWVPDTYFVNSKMSKFHSVTTINKMLSISPDGLVHYNSRVTVKASCAMNLRMFPKDVQNCNIDIESYGYSADNVQYQWENRSDNGIAVNKKIRDMPQ-YNLSDINVSRHFTMYVAGNWSGLTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSYVKAVDWYLIGCFLFVFAVLLEYTFVLYIDNEEVTE-YKKDLVN--------YSSESVKHRSP-----AHAMNGSIPNGYSPAVFSEHGKKCGHNCHHAHHDVVLKREKHKSSYEQLGG--CRPRLKFPAV-IDTECIDEFARVLFPFIFIAFNVIYFIVFFFI 418          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 186.037 bits (471), Expect = 1.587e-54
Identity = 104/324 (32.10%), Postives = 189/324 (58.33%), Query Frame = 3
Query:  195 ICFFF---MSTTSLGTSMNSDREQIQNHIFKGYKSNERP-SENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWR----SWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIAS 1142
            +CF F    ST S       +   +  ++ +GY    RP S+ +  +V V M V  I ++  + M+++ D+YLRQ W DERL     E         +S    ++IW+P  +F   K  Y H +TT NYLL+++P+G + YS ++T+  SC++DL+ FP DTQ C++ + SYGY    + + W     +   + +   +++P+F     +     ++++  + G+++ + A F ++R++G +L  TYIP+ +IV++SW++FW+  +  PAR+ LG+ T+L + T  +   ANLP+VSY+KAID +++ C++FV G+++E+   +
Sbjct:    1 MCFHFSGQFSTKSTPAGKYWNSTLVLKNLLEGYDRRIRPGSKGEPVVVYVDMYVSNIWAMQEMNMDFTIDIYLRQYWRDERL---QFETQTPGAMLTLSSDINKQIWVPSTYFLATKKAYFHDVTTDNYLLQVKPDGSLFYSIRLTITTSCRLDLRDFPHDTQSCSLSLESYGYQSTDVLYVWNERLDNTSAIYIHDDLELPQFEV---LGVSRSAKMNKYNIGNHSSLVANFRMKRRIGYFLIDTYIPSTIIVIISWISFWIDPETAPARVALGITTVLTMTTLISSARANLPKVSYVKAIDWYLLLCLIFVFGSILEYTCVT 318          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO47783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL25])

HSP 1 Score: 185.652 bits (470), Expect = 2.682e-54
Identity = 108/312 (34.62%), Postives = 182/312 (58.33%), Query Frame = 3
Query:  255 QIQNHIFKGYKSNERP--SENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSST-STGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQR 1181
             + N +F GY    RP   +    +VTV   +L+I++++VI M++S D++LRQEW D+RL  DH    ++     +S    +KIWLPD +F N KD   H++TT N ++ L P G V Y+ +++++  C M+L+ FPMDTQ C +   SYGY+   + F W      I   +  +P++    N+K +  S   +    G+++ +KATF  +R    ++   Y P+ +IV++SW+ F +  D  PARITLG+ ++L I+T    +S  + +V+Y+K ID ++I C LFV  +LIE++   +++ + K   +QR
Sbjct:    3 DVLNDLFSGYDRRVRPHYEDGHPVVVTVGFTLLSIDTINVIDMDFSMDMFLRQEWYDQRL--DH----KTNETVFLSNHVMDKIWLPDSYFVNAKDAKFHTVTTDNKMIMLSPGGRVQYNARVSVRLYCDMELRDFPMDTQYCPVVFESYGYSDRHITFVWELGMNTIPERLKILPQY----NLKEVALSTTYNVYVVGNWSGVKATFAFERTYSYFIYHVYAPSAIIVVISWIGFVLPRDKPPARITLGVTSVLTIVTVLNMLSNTVAKVNYVKRIDEYLIGCFLFVFCSLIEYSFVLLLAYRMKK--YQR 302          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO30047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1W8])

HSP 1 Score: 184.111 bits (466), Expect = 5.060e-54
Identity = 107/308 (34.74%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  255 QIQNHIFKGYKSNERPSEN---KQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRW--RSWEPMILPP--VMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISR 1154
            +I + I    K ++R   N      IVTV   VL+I++++V+ M+Y+ D++LRQ W+DERL+ D        N  + +S    +KIWLPD +F N K G  H +T  N ++ +QP+G+V Y+ ++T++ SC M+L+ FPMDTQ C + + SYGY+ D + F+W     + +   P  +  +P++    N      SEL     G+++ IKA F  +R    ++   Y P  LIV+VSW++F +  +  PARITLG+ ++L ++T    ++ ++P+V+Y+K ID ++I C LFV   L+E+++   +++
Sbjct:    3 RILDSILTAEKYDKRLRPNYGAGPVIVTVGFWVLSIDTINVVDMDYTLDIFLRQSWVDERLSHD-------LNTTMFLSNTVMDKIWLPDSYFVNAKQGSFHKVTKDNMMVMIQPDGQVQYNARVTIRASCPMNLRKFPMDTQHCPLTLESYGYSSDHIVFKWEIEDGDGLGFVPESLKMLPQYKLAPNEPR---SELCFVIPGNWSGIKALFTFERMYSYFVIHVYGPCALIVVVSWVSFLLPKEQAPARITLGVTSVLTVVTILNMLNNSMPKVNYVKTIDKYLIGCFLFVFATLVEYSLVLWLTK 300          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO34692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNK5])

HSP 1 Score: 180.644 bits (457), Expect = 6.050e-53
Identity = 102/266 (38.35%), Postives = 165/266 (62.03%), Query Frame = 3
Query:  381 YSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFK---EKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRS----WEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRK 1157
            ++ D+YLRQ W D RL +D +       N  V  L +   ++IW+P  +F N K  Y H +TT NYLL ++PNG+V YS ++T+  +C++ LQ FP D Q C M + SYGY    + +RW S     + + +   +++P+F + TNVK  + + +   + G ++ + A F   R+LG Y+  TYIP++L V +SW +FW+S D+ PAR+ LG+ T+L ++T +    A LP+VSY KAID +++ C+++V GAL+E+AI +  + K
Sbjct:    2 FTIDMYLRQYWRDPRLIFDPVPV-----NTDVLTLNRQTIDEIWIPSTYFFNAKKAYFHDVTTENYLLMIKPNGDVFYSVRLTITMACKLTLQMFPHDVQVCEMMLESYGYQATDVYYRWNSRNSTGDVVYISEDLEMPQF-KITNVKLEERTNIY--NIGPHSALIAKFTFHRRLGYYMIQTYIPSMLTVTISWFSFWISPDSPPARVGLGITTVLTMITISNSARAPLPKVSYTKAIDWFLLMCLVYVFGALMEYAIVNFYACK 259          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: ENSORLT00000025211.2 (glycine receptor subunit alpha-3 [Source:NCBI gene;Acc:101174559])

HSP 1 Score: 244.202 bits (622), Expect = 1.248e-74
Identity = 144/430 (33.49%), Postives = 238/430 (55.35%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMH----LMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + V+  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K  + H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F+W+   P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G   +LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              H+EL ++ +   K ++ +   ++     +  TP  +  +  +  N+   +AN   +       A        E++RK           +    +ID  S+  FP  F+ +N FYW+ Y IL
Sbjct:   48 GYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYAEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFQWQENGPVQVAEGLTLPQFILKDESDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQ--------------HKELLRFRRHKSKTKEEVGESKLTSTAVMTSTPSISKDSKASVNNAVAPAANTTQNA-----PAAGGGGRSTEEMRKLF---------IDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKIL 442          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra4a (glycine receptor subunit alpha-4-like [Source:NCBI gene;Acc:101156095])

HSP 1 Score: 243.047 bits (619), Expect = 4.333e-74
Identity = 154/440 (35.00%), Postives = 236/440 (53.64%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKS--ELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNS--FTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIEMGL 1580
            GY +  RP+     + VT  + + +  S+    M+Y  +V+LRQ W D RLA+         +N+L + P   + IW PDLFF N K    H +TT N LLR+  +G VLYS ++T+  SC MDL+ FPMD Q C M + S+GYT++ L F W S  P+ +   + +P+F          C++    +TG +TCI+  F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+ K    L ++  Q  + +EL + S+    +   +        G P   +  F+    M   D          EVF                       S+  V     ID  S+ +FP  F+++N FYWL Y +L R  +I   L
Sbjct:   56 GYDARIRPNFKGPPVNVTCNIFINSFGSITETTMDYRLNVFLRQNWNDPRLAYSEYP-----DNSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQDGSVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQFVLKEEKDLGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFIRLRKKQRQQRIEEELVRESRGFYFRGYGLGHCLQTKDGAPLEGATVFSPPPPMTMYDG---------EVF-----------------------SKRFVDRAKRIDTISRAVFPLSFLIFNIFYWLTYKVL-RHEDIHANL 455          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra4b (glycine receptor subunit alpha-2 [Source:NCBI gene;Acc:101174852])

HSP 1 Score: 241.891 bits (616), Expect = 2.140e-73
Identity = 151/443 (34.09%), Postives = 240/443 (54.18%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVS--PLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLE----ASPNEKLRKSISKPQVSEPP------------VQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +V+LRQ+W D RLA      ++ Y ++ +   P   + IW PDLFF N K    H +TT N LLR+  NG VLYS ++T+  SC MDL+ FPMD+Q C M + S+GYT++ L F W     + +   + +P+F          C++  +T  G +TCI+  F+L+RQ+G YL   YIP++L V++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + +SR+              H+E F+  K  LK+QQ +             N+  N A   + +   +    + E+     LL+    A   E+  +  + P  ++ P            V+    ID  S+ LFP  F+++N  YWL Y +L
Sbjct:   52 GYDARIRPNFKGPPVNVTCNIFINSFGSITETTMDYRLNVFLRQQWNDPRLA------YKEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNVLYSIRLTLILSCPMDLKNFPMDSQMCTMQLESFGYTMNDLIFEWLDVGAVQVADDLMLPQFVLKEEKGLGYCTKYYNT--GKFTCIEVKFYLERQMGYYLIQMYIPSLLTVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQ--------------HKEFFRMRK-KLKEQQRLRTGSAD-SKVKGNNTPGNSAAQGNVNQRCSACAREEELAQQGYLLQSFGLALSTERGPEMDATPVFADLPPGLGFYEIRRRFVERAKRIDTISRALFPMTFLVFNVLYWLTYKVL 470          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 234.958 bits (598), Expect = 2.762e-71
Identity = 144/426 (33.80%), Postives = 231/426 (54.23%), Query Frame = 3
Query:  279 GYKSNERPSENKQTI-VTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            GY +  RP+     + VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + I+R+ K  L  R  +  + ++     +              + MG     +   +A   + +N+            T+   E S  E  +  I + +           ID  S+  FP  F+++N FYW+ Y I+
Sbjct:   40 GYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFRRRRRHMKEDETGDGRFGFPG---------YGMGPACLQAKDGMAIKGNNNNAP-----------TSAAPEKSIEEMKKLFIGRAK----------RIDTVSRVAFPLVFLIFNIFYWITYKII 428          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 233.802 bits (595), Expect = 9.850e-71
Identity = 143/426 (33.57%), Postives = 229/426 (53.76%), Query Frame = 3
Query:  276 KGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNL-VSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLIL 1550
            KG K+     +     VT  + + +  S+    M+Y  +++LRQ+W D RLA+         +++L + P   + IW PDLFF N K    H +TT N LLR+  NG VLYS +IT+  +C MDL+ FPMD Q C M + S+GYT++ L F W     + +   + +P+F          C++    +TG +TCI+A F L+RQ+G YL   YIP++LIV++SW++FW+++DA PAR+ LG+ T+L + TQ++G  A+LP+VSY+KAID+W+  C+LFV  AL+E+A  + I+R+ K  L  R  +  + ++     +              + MG     +   +A   + +N+            T+   E S  E  +  I + +           ID  S+  FP  F+++N FYW+ Y I+
Sbjct:   53 KGSKNEATHKKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYP-----DDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFRRRRRHMKEDETGDGRFGFPG---------YGMGPACLQAKDGMAIKGNNNNAP-----------TSAAPEKSIEEMKKLFIGRAK----------RIDTVSRVAFPLVFLIFNIFYWITYKII 441          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000037124.1 (SMESG000037124.1)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 459/460 (99.78%), Postives = 459/460 (99.78%), Query Frame = 3
Query:  210 MSTTSLGTSMNSDREQIQNHIFKGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIEMGLINN 1589
            MSTT LGTSMNSDREQIQNHIFKGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARITLGLLTLLGILTQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIEMGLINN
Sbjct:    1 MSTTFLGTSMNSDREQIQNHIFKGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARITLGLLTLLGILTQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVRKRNIEMGLINN 460          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000041885.1 (SMESG000041885.1)

HSP 1 Score: 524.628 bits (1350), Expect = 0.000e+0
Identity = 267/441 (60.54%), Postives = 333/441 (75.51%), Query Frame = 3
Query:  237 MNSDREQIQNHIF--KGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILV 1553
            M   R+ I   I   K YK +ERPSE  QT V VYMKVLAINSV V KMEYSTDVYLRQEW D RL W+++E+FRS+NNN+VSP  K+ +WLPDLFFRNGK+GYVH MT PNYL+RL+PNG +LYSQKITM+FSC+M+LQTFPMD+QEC MDIGSYGYTLD+LKF WR  +P+++   +QI EFN P  V TIDC+  SSTSTG YTC+KA F LQRQLGSYL ST++P++LIVMVSWLNFW+++D+VPAR+TLGL+TLLG+LTQATG+S+ LPRVSYIKAIDVW+IACI+FVIGAL+E+ +AS+++RK KS  W++DV+ IV  EL +W   A ++QQ                 F +L + N+ D +  EF  +LE  L    L+A   +K  K+         P + DS+ID YS+FLFPA F+LYNCFYWLYYL+LV
Sbjct:   28 MAQQRDLIMERIVDKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARVTLGLVTLLGMLTQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCS-ACQRQQ-----------------FFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTT--------PTE-DSDIDSYSRFLFPACFLLYNCFYWLYYLVLV 441          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000061905.1 (SMESG000061905.1)

HSP 1 Score: 499.204 bits (1284), Expect = 8.384e-174
Identity = 279/450 (62.00%), Postives = 339/450 (75.33%), Query Frame = 3
Query:  213 STTSLGTSMNSDREQIQNHIFKGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFL---TAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILV 1553
            ++T+  +  N  RE I   +F+ Y  +ERPSE KQT V VYM+VLAINSVDV+KMEYSTDV LRQEW+D+RL W    +  SYN ++ SP  KEK+WLPDLFFRNGK GYVHSMT PNYL+RL  NG +LYSQKITM+FSCQM+L TFPMD+QEC MDIGSYGYTLDQLKF WR  EP+I+   +QIPEFN  T+  T DCS+ + TSTG+YTC+KA+F L+RQLGSYLASTYIPNVLIVMVSWLNFWVS++A+PARITLGLLTLLGILTQATGMS +LPRVSYIKAID+WIIACI+FVIGALIEFA+ASMI+R+ KSE WQ+ V+ IV QEL +W  +  ++Q              + +S  +  Q  +   + +     LE+ L   T Q  +  P +K+ +  SKPQ S     +DSEID YS+FLFPA F+LYNCFYWLYYL+LV
Sbjct:   37 NSTTYFSENNVTREDILKIVFENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARITLGLLTLLGILTQATGMSNSLPRVSYIKAIDIWIIACIIFVIGALIEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCQQQQLV----------QIQNSSLIDRTQFETPIGTED-----LEILLCPDTVQKWKKKPVQKVNR--SKPQKS-----VDSEIDCYSRFLFPACFVLYNCFYWLYYLVLV 464          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000008993.1 (SMESG000008993.1)

HSP 1 Score: 490.345 bits (1261), Expect = 4.112e-170
Identity = 257/475 (54.11%), Postives = 344/475 (72.42%), Query Frame = 3
Query:  189 FSICFFFMSTT-SLGTSMNSDREQIQNHIFKG--YKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQE--LFKWSKMALKKQQSI---------NFLQMHLMGT-----PKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILVR 1556
            F++     STT  + +   S +E+I+N +     YK  ERP EN  T+V +Y+K+LAI+SVDV +M+YSTDVYLRQ WID RL W+H+E+F+ YN+N+VSP  K++IWLPDLFFRNGK GY+H+MTTPNYL+RLQPNGEVLYSQK+TM FSCQM+LQ FPMDTQ C ++IGSYGYTL++LKF WR+++ + +   ++IPEF+ P  ++TIDC++ S+TSTG+YTC+KA   L RQLGSYLASTY+P++LI+MVSW+NFWVSIDAVPARITLGLL+LLGI+  A  MS+ LPRVSYIKAIDVW+IACI+FVI AL+EFAIA+ + +++ S+ WQ DV +++ +E  L   S   +K   SI         N  ++ +MG      P  N    +  + S + S NE        L  +L E   N+  R ++ KP  ++    +DS ID YS+FLFPA F+LYNCFYWLYY++L+R
Sbjct:   16 FTVFILVNSTTCDISSKYLSTQERIRNKLLDKIVYKKQERPDENNTTLVMIYIKILAIDSVDVRQMQYSTDVYLRQAWIDSRLRWEHLEEFKHYNSNIVSPSLKDEIWLPDLFFRNGKKGYIHNMTTPNYLMRLQPNGEVLYSQKLTMVFSCQMELQAFPMDTQNCEINIGSYGYTLEELKFYWRTFDTIAVQKELKIPEFDTPDIIETIDCTQDSATSTGNYTCLKAIITLNRQLGSYLASTYVPSILIIMVSWMNFWVSIDAVPARITLGLLSLLGIVNMAISMSSTLPRVSYIKAIDVWLIACIIFVIAALVEFAIATSVLKRNTSKSWQSDVCSLIREEINLMHTSFSMIKSMNSISKEKKSNNNNSNRVGIMGATGTAKPIPNLPPGIDMLFSNNPSQNE-------VLLKELDER--NKMSRFTMKKPNNTKSKSSVDSTIDNYSRFLFPACFLLYNCFYWLYYIVLIR 481          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000032691.1 (SMESG000032691.1)

HSP 1 Score: 488.034 bits (1255), Expect = 9.581e-170
Identity = 260/456 (57.02%), Postives = 339/456 (74.34%), Query Frame = 3
Query:  201 FFFMSTTSLGTSMNS----DREQIQNHIFKGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARXXXXXXXXXXXXXQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQI-DSEIDGYSQFLFPAFFMLYNCFYWLYYLILV 1553
            F F+    +G +  S     RE+I + I + Y  NERP E+ QT V V+MKVLAINSV+V  MEYSTD+YLRQ W+D RL WD++ +F+ +N++LVSP  K+++WLPDLFFRNGK+GYVH MT PNYL+RL PNGEVLYSQKITM+FSCQMDLQT+PMDTQ C M+IGSYGYTLDQLKF W    PM L   +QIPEFN PT V+T DC+  S+T TG Y+C+KA F L+RQLGSYL ST+IPN LIV+VSWLNFWVS++AVPARITLGLLTLLGILTQA+G+S NLPRVSYIKAIDVW+IACI+FVIGAL+EFA+AS ++++ K   W+ +V++IV QEL +W+ +A+ +Q++      H M T +  +   L           EF  +L++ LTAQ  + + N   ++S  + +  +   +I +S+ID YS++LFP+ F+ YN  YW+YYLI+V
Sbjct:   11 FIFLLAIHVGCNSCSVAGITRERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDARLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARITLGLLTLLGILTQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWN-LAINRQKT------HHMQTSQILNRNEL-----------EFCEELDILLTAQ--QYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIV 446          
The following BLAST results are available for this feature:
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA31.566e-7534.80glycine receptor alpha 3 [Source:HGNC Symbol;Acc:H... [more]
GLRA34.564e-7434.04glycine receptor alpha 3 [Source:HGNC Symbol;Acc:H... [more]
GLRA23.253e-7335.09glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
GLRA26.009e-7334.86glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
GLRA18.290e-7334.03glycine receptor alpha 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glc-32.486e-7132.93Glutamate-gated ChLoride channel; Glutamate-gated ... [more]
glc-12.645e-6934.11Glutamate-gated chloride channel alpha [Source:Un... [more]
glc-12.645e-6934.11Glutamate-gated chloride channel alpha [Source:Un... [more]
avr-151.504e-6733.78pep chromosome:WBcel235:V:13498786:13502743:-1 gen... [more]
avr-151.504e-6733.78pep chromosome:WBcel235:V:13498786:13502582:-1 gen... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GluClalpha1.649e-7235.21gene:FBgn0024963 transcript:FBtr0335420[more]
GluClalpha2.345e-7235.43gene:FBgn0024963 transcript:FBtr0335418[more]
GluClalpha2.652e-7134.34gene:FBgn0024963 transcript:FBtr0343788[more]
GluClalpha5.909e-7135.53gene:FBgn0024963 transcript:FBtr0343790[more]
GluClalpha1.905e-7034.82gene:FBgn0024963 transcript:FBtr0335416[more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra35.452e-7434.27glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra11.783e-7334.02glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra4b4.971e-7334.10glycine receptor, alpha 4b [Source:ZFIN;Acc:ZDB-GE... [more]
glra15.739e-7333.79glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra4b6.836e-7333.87glycine receptor, alpha 4b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA12.169e-7433.55glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
GLRA13.568e-7433.05glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
GLRA11.231e-7334.64glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
GLRA11.325e-7334.64glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
GLRA11.701e-7334.64glycine receptor alpha 1 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glra35.817e-7533.41glycine receptor, alpha 3 subunit [Source:MGI Symb... [more]
Glra11.424e-7334.27glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
Glra21.905e-7335.55glycine receptor, alpha 2 subunit [Source:MGI Symb... [more]
Glra12.613e-7234.27glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
Glra11.142e-7135.61glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75311|GLRA3_HUMAN7.519e-7534.80Glycine receptor subunit alpha-3 OS=Homo sapiens O... [more]
sp|Q91XP5|GLRA3_MOUSE1.910e-7433.41Glycine receptor subunit alpha-3 OS=Mus musculus O... [more]
sp|P24524|GLRA3_RAT6.056e-7434.02Glycine receptor subunit alpha-3 OS=Rattus norvegi... [more]
sp|Q64018|GLRA1_MOUSE9.959e-7334.27Glycine receptor subunit alpha-1 OS=Mus musculus O... [more]
sp|P07727|GLRA1_RAT1.205e-7234.50Glycine receptor subunit alpha-1 OS=Rattus norvegi... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183SPC03.290e-15854.21Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3P7LGN41.463e-15754.21Ig-like domain-containing protein OS=Dibothrioceph... [more]
A0A068YF692.800e-15654.20Glycine receptor subunit alpha 1 OS=Echinococcus m... [more]
A0A0R3X4J87.274e-15654.20Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
U6J8V01.055e-15553.97Glycine receptor subunit alpha 1 OS=Echinococcus g... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra11.457e-7334.43glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra17.300e-7334.19glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra31.007e-7233.26glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra22.196e-7234.35glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra33.264e-7234.18glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008467.17.964e-7833.63pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 ge... [more]
glra21.637e-6934.40glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra15.896e-6440.38glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra4a6.893e-6131.78glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000002305.16.685e-5629.45pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 g... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375551.209e-5730.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354101.587e-5432.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477832.682e-5434.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300475.060e-5434.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346926.050e-5338.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000025211.21.248e-7433.49glycine receptor subunit alpha-3 [Source:NCBI gene... [more]
glra4a4.333e-7435.00glycine receptor subunit alpha-4-like [Source:NCBI... [more]
glra4b2.140e-7334.09glycine receptor subunit alpha-2 [Source:NCBI gene... [more]
glra12.762e-7133.80glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
glra19.850e-7133.57glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037124.10.000e+099.78SMESG000037124.1[more]
SMESG000041885.10.000e+060.54SMESG000041885.1[more]
SMESG000061905.18.384e-17462.00SMESG000061905.1[more]
SMESG000008993.14.112e-17054.11SMESG000008993.1[more]
SMESG000032691.19.581e-17057.02SMESG000032691.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023116 ID=SMED30023116|Name=Glycine receptor subunit alpha-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1602bp
ATTTTTAAACATTTTCACTGAGCCCAATTGTATAAAAATCGCAATGAAAT
TTCCTCTCAATTGAAATCTTTCAAATGTGTTAACAATAGACTTCCTGGAA
GTGACATCCAAAATATTTTATTTGAGCAGCTTTTTTATTAATTATTCTTG
CCGTTTCTCTAATTCTTTTTCGAAAAATGATAAAATGCTTTTCAATATGT
TTCTTTTTCATGTCAACGACTTCTCTGGGAACTTCAATGAATTCAGACAG
GGAGCAAATCCAGAATCATATATTCAAAGGATATAAAAGCAATGAAAGAC
CATCGGAGAATAAGCAAACTATAGTGACAGTTTATATGAAGGTCTTGGCA
ATTAATTCCGTTGATGTTATCAAGATGGAATATTCCACAGATGTCTATTT
GCGACAAGAATGGATTGATGAAAGGTTGGCTTGGGACCATATTGAAAAAT
TTAGATCTTACAATAATAATCTCGTTTCTCCTCTCTTTAAAGAGAAAATT
TGGCTCCCGGACTTATTTTTTCGCAATGGCAAAGATGGCTATGTTCATTC
AATGACCACTCCAAATTATTTACTTCGATTACAGCCAAATGGAGAAGTTT
TATACAGTCAAAAAATTACAATGAAATTTTCATGTCAAATGGATTTACAA
ACTTTCCCCATGGATACTCAGGAATGCAATATGGACATTGGAAGTTACGG
TTACACATTGGATCAATTGAAATTTAGATGGAGATCTTGGGAGCCGATGA
TCCTGCCCCCGGTAATGCAGATTCCAGAATTTAATCAACCAACTAATGTC
AAAACTATAGACTGTAGTGAACTATCTTCAACATCTACGGGAGATTATAC
TTGTATAAAGGCAACATTTTTTTTACAGCGCCAACTTGGTAGTTATTTAG
CTAGTACTTATATTCCAAATGTTTTAATTGTCATGGTATCCTGGCTCAAT
TTCTGGGTCAGTATTGATGCGGTACCTGCTAGAATTACATTAGGTCTGTT
GACATTGTTAGGTATATTAACACAAGCTACTGGAATGTCAGCTAACCTCC
CAAGAGTCAGTTATATAAAAGCCATCGACGTTTGGATAATTGCTTGCATT
TTATTTGTCATAGGCGCTTTAATAGAGTTTGCAATAGCAAGTATGATTTC
TAGAAAAAGCAAATCTGAACTTTGGCAAAGGGATGTTCAGAATATTGTTC
ACCAAGAATTGTTTAAGTGGTCGAAAATGGCGCTTAAGAAGCAGCAATCA
ATTAATTTCTTACAAATGCATTTAATGGGCACTCCAAAAACCAATTCCTT
TACAAATCTTGCACAGATGAATTCAACTGACAACAGCGCAAATGAGTTTT
ATCACAAGTTGGAAGTGTTTCTCACTGCTCAGCTATTAGAAGCGAGTCCC
AATGAAAAGTTGAGGAAATCTATATCAAAGCCCCAGGTCAGTGAGCCCCC
AGTGCAAATCGACTCAGAAATTGATGGTTATAGTCAGTTTTTATTTCCCG
CTTTTTTCATGCTGTACAATTGTTTTTATTGGCTTTATTATTTAATTCTC
GTGCGAAAGCGCAACATTGAAATGGGACTGATTAATAATTAAAAAAAACC
AG
back to top

protein sequence of SMED30023116-orf-1

>SMED30023116-orf-1 ID=SMED30023116-orf-1|Name=SMED30023116-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=472bp
MIKCFSICFFFMSTTSLGTSMNSDREQIQNHIFKGYKSNERPSENKQTIV
TVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLV
SPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMK
FSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIP
EFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVL
IVMVSWLNFWVSIDAVPARITLGLLTLLGILTQATGMSANLPRVSYIKAI
DVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSK
MALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLT
AQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCF
YWLYYLILVRKRNIEMGLINN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR006028GABAA/Glycine_rcpt
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006028Gamma-aminobutyric acid A receptor/Glycine receptor alphaPRINTSPR00253GABAARECEPTRcoord: 300..321
score: 42.92
coord: 240..260
score: 45.17
coord: 435..455
score: 42.31
coord: 266..287
score: 40.79
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 70..86
score: 44.29
coord: 153..167
score: 50.89
coord: 107..118
score: 50.64
coord: 231..243
score: 27.67
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 20..455
e-value: 1.1E-104
score: 348.7
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 28..454
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 26..236
e-value: 7.8E-47
score: 159.5
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 17..234
e-value: 1.6E-66
score: 225.5
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 24..236
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 244..364
e-value: 2.1E-21
score: 77.1
NoneNo IPR availablePANTHERPTHR18945:SF835GAMMA-AMINOBUTYRIC ACID RECEPTOR ALPHA-LIKEcoord: 28..454
NoneNo IPR availableCDDcd18987LGIC_ECD_anioncoord: 48..236
e-value: 3.13321E-73
score: 227.176
NoneNo IPR availableCDDcd19049LGIC_TM_anioncoord: 240..325
e-value: 3.57057E-30
score: 111.39
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.596
NoneNo IPR availableTMHMMTMhelixcoord: 270..292
NoneNo IPR availableTMHMMTMhelixcoord: 238..260
NoneNo IPR availableTMHMMTMhelixcoord: 299..321
NoneNo IPR availableTMHMMTMhelixcoord: 437..459
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 153..167
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 240..458