RBR-type E3 ubiquitin transferase

Overview
NameRBR-type E3 ubiquitin transferase
Smed IDSMED30023111
Length (bp)2717
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RBR-type E3 ubiquitin transferase (SMED30023111) t-SNE clustered cells

Violin plots show distribution of expression levels for RBR-type E3 ubiquitin transferase (SMED30023111) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RBR-type E3 ubiquitin transferase (SMED30023111) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RBR-type E3 ubiquitin transferase (SMED30023111) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023111

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023111SMESG000054560.1 PL08005A1B11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023111SMESG000054560.1 Contig41590newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023111SMESG000054560.1 Contig41590uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30023111SMESG000054560.1 dd_Smed_v6_4845_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023111SMESG000054560.1 dd_Smed_v4_4845_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A2C9LXM8 (RBR-type E3 ubiquitin transferase OS=Biomphalaria glabrata OX=6526 GN=106077435 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.216e-10
Identity = 82/315 (26.03%), Postives = 134/315 (42.54%), Query Frame = 1
Query: 1477 KKISVCEICV-----DHFDSEEVFILKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIPFEE----YQKIVECLENLVITTRGCSQCFSCKSVLVKSDVPLESIKKGFNYXXXXXXXXXXXXXNRQHWPASCDDMVQHGNQLVKLNDKYN----IQLP----KP-----VKIEGRFCYNCHKFHVEKPSGTYIWCSCGVVFCYNCGKKDCTSSFGSICTNDNNRVVFKVDIVKQGSFPEPDSFRSKLYCESFNARFWLQQSNVTFLKRRLMQIDHQFKNAEDLHFDRDKVISQYQQILKV 2355
            +K+  CEIC       H++S     L  C H  C  C+  H    +K+  F   CP  +C+  V   ++LSL+   +     Q+  E      + T+ C      +++ V S   +  I   F+  C CG  +C  C  + HWPA+C    ++   L  L         I LP    KP     ++IEGR C +CH+F  +     ++ C CG+ FC+ C K    S+ G+I   +N +++    + +       D   SK  C + +     +QS     K  L Q   Q ++       RD+V S +++I  V
Sbjct:  566 EKVLFCEICYADVTSSHYESSPGTKLNKCGHVFCDSCWRTHFNTKMKTGAFKLTCPGYDCNVPVGPATLLSLVHVNDLNLYLQRQCEAEIETSLDTKWCPNPSCGRAIRVTSGKKV--IGCTFDITCVCGQSVCFACLGKPHWPANCVQAEEYSQALPSLKPYQESDDVIDLPSIPSKPSTYAVIEIEGRLCPSCHRFMEKNGGCPHMNCRCGLQFCWTCMKP--ISAHGNIPCIENVKLI--KSLTRHVKVRHVDIESSK--CTNHSPAKVTRQSKPRGHKASLYQKALQQRHESTKSSTRDQVKSLFKRIQHV 872          
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A397ZE29 (RBR-type E3 ubiquitin transferase OS=Brassica campestris OX=3711 GN=BRARA_E02693 PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.179e-8
Identity = 64/217 (29.49%), Postives = 103/217 (47.47%), Query Frame = 1
Query: 1444 INLQNLPSNLEKKISVCEICVDHFDSEEVFILK-ACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIP---FEEYQKIVECLENLVITTRGCSQCF-SCKSVLVKSDVPLESIKKGFNYXXXXXXXXXXXXXNRQHWPASCDDMVQHGNQLVKLNDKYNIQLPKPVK-IEGRFCYNCHKFHVEKPSG-TYIWCSCGVVFCYNCG 2073
            I +++ P  LE  I +C IC+D   S ++F     C H  C +C   ++   +K N     CP + C  +++      LIP   FE ++KI+   E+L+ +       F  C SV++  DV   ++ +       C  + C  C    H    C++  ++GN   K +D+ +  L +  K  + R C +C KF+VEK  G  +I C CG  FCY CG
Sbjct:   84 IKIESEP--LEPSIRLCMICMDEKPSSDMFRGSVTCTHAYCTQCTIRYVASKIKENSARIKCPDVECTRSIEPYMCRDLIPKDVFERWEKIL--CESLISSWDKLYCPFKDCSSVMILDDVNNANVAQ--TECPSCHRMFCAQCKVAWHVGVGCEEFQRYGNTKKKSSDEEDALLVQMAKNKQWRRCPSC-KFYVEKADGCMHITCRCGFQFCYGCG 293          
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A3P6FH26 (RBR-type E3 ubiquitin transferase OS=Brassica oleracea OX=3712 GN=BOLC5T33988H PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.050e-7
Identity = 62/217 (28.57%), Postives = 101/217 (46.54%), Query Frame = 1
Query: 1444 INLQNLPSNLEKKISVCEICVDHFDSEEVFILK-ACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIP---FEEYQKIVECLENLVITTRGCSQCF-SCKSVLVKSDVPLESIKKGFNYXXXXXXXXXXXXXNRQHWPASCDDMVQHGNQLVKLNDKYNIQLPK-PVKIEGRFCYNCHKFHVEKPSG-TYIWCSCGVVFCYNCG 2073
            + ++N P  LE    +C IC+D   S ++F     C H  C +C   ++ + +K N     CP ++C  +++      LIP   FE ++KI+   E+L+ +       F  C SV++  DV   +          C  + C  C    H    C++  ++GN   K +D+ +  L +     + R C +C KF+VEK  G  +I C CG  FCY CG
Sbjct:   83 VKIENEP--LEPSRRLCMICMDEKPSSDMFRGSVTCTHAYCTQCTIRYVANKIKENSAKIKCPDVDCTRSIEPYMCRDLIPKDVFERWEKIL--CESLISSWDKLYCPFKDCSSVMILDDVGGNNANVTQTECPSCHRMFCAQCKVAWHVGVGCEEFQRNGNTKKKSSDEEDALLVQMATNKQWRRCSSC-KFYVEKVDGCMHIKCRCGFQFCYGCG 294          
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A0D3CKA6 (RBR-type E3 ubiquitin transferase OS=Brassica oleracea var. oleracea OX=109376 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.342e-7
Identity = 62/217 (28.57%), Postives = 101/217 (46.54%), Query Frame = 1
Query: 1444 INLQNLPSNLEKKISVCEICVDHFDSEEVFILK-ACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIP---FEEYQKIVECLENLVITTRGCSQCF-SCKSVLVKSDVPLESIKKGFNYXXXXXXXXXXXXXNRQHWPASCDDMVQHGNQLVKLNDKYNIQLPK-PVKIEGRFCYNCHKFHVEKPSG-TYIWCSCGVVFCYNCG 2073
            + ++N P  LE    +C IC+D   S ++F     C H  C +C   ++ + +K N     CP ++C  +++      LIP   FE ++KI+   E+L+ +       F  C SV++  DV   +          C  + C  C    H    C++  ++GN   K +D+ +  L +     + R C +C KF+VEK  G  +I C CG  FCY CG
Sbjct:   70 VKIENEP--LEPSRRLCMICMDEKPSSDMFRGSVTCTHAYCTQCTIRYVANKIKENSAKIKCPDVDCTRSIEPYMCRDLIPKDVFERWEKIL--CESLISSWDKLYCPFKDCSSVMILDDVGGNNANVTQTECPSCHRMFCAQCKVAWHVGVGCEESQRYGNTKKKSSDEEDALLVQMATNKQWRRCPSC-KFYVEKVDGCMHIKCRCGFQFCYGCG 281          
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Match: A0A2J6KJW3 (RBR-type E3 ubiquitin transferase OS=Lactuca sativa OX=4236 GN=LSAT_6X107960 PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.626e-7
Identity = 65/234 (27.78%), Postives = 109/234 (46.58%), Query Frame = 1
Query: 1432 HQSEINLQNLPSNLEKKISVCEICVDHFDSEEVFILKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIPFEEYQKIVECL-ENLVITTRGCSQCFS-CKSVLVKSDVPLESI-----KKGFNYXXXXXXXXXXXXXNRQHWPA--SCDDMVQ-HGNQLVKLNDKYNIQLPKPVKIEGRFCYNCHKFHVEKPSGT-YIWCSCGVVFCYNCGKKDCTSSFG 2100
            H++   L +L  N E K  +C+IC+++ +S ++F    C H  C  C   H T  +  ++ +  CP +NC ST+D  ++  +IP E   K  E L E++++ ++     F+ C  +L+  D+ + +I     ++ F                R  W +  SC +  +    +  K +D   I L    K + + C  C +F VEK  G  +I C C   FCYNCG K  +S  G
Sbjct:  124 HKTRSTLSSLLKNTEFKEIICKICLENQESWQMFTNSTCSHSFCYTCTRKHATTKIHESKNTITCPELNCKSTLDPNTLRQIIPKETLIKWDEHLCESMILESQKLYCPFADCSVLLINDDISITNIDCPVCRRAF------------CAVCRVPWHSEFSCKEFGKLKSKRKGKRDDDMAIAL--AKKKKWKKCPMC-RFFVEKSEGCLHITCRCEYEFCYNCGGKWSSSHGG 342          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Nematostella
Match: EDO37844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEN1])

HSP 1 Score: 56.9954 bits (136), Expect = 2.949e-8
Identity = 63/249 (25.30%), Postives = 114/249 (45.78%), Query Frame = 1
Query: 1402 FNDEWKKLELHQSEINLQN-LPSN-----LEKKISVCEICVDHFDSEEVFI-LKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIPFEEYQKIVECLENLVITT----RGCSQC-FSCKSVLV-----KSDVPLESIKKGFNYXXXXXXXXXXXXXNRQHWPASCDDM----VQHGNQLVKLNDK---YNIQLPKPVKIEGRFCYNCHKFHVEKPSG-TYIWCS-CGVVFCYNC 2070
            F+    KLE+ ++     + LPS+     L  ++  C IC   F+ E+    L  C HK C  C+  +LT  ++S      CP   C + +D  +V+SL+P E  ++ +    N+ + +    + C +C F  K VL       ++VP+  + +  N         C  C +  HWPASC       +++ +QL +   K   Y++ + +        C +C ++ +EK  G  +++C  C   FC++C
Sbjct:  494 FSHRLAKLEVRKAMTKCGSQLPSSKPNGMLRDEVKFCGICCLKFEHEDFSTGLLLCSHKFCNSCWHQYLTVQIRSGHSPLKCPGHMCDAIIDDTTVMSLVP-ELLEQFIRNKVNMKLCSGQQWQQCEKCAFYVKLVLPTCIANSTEVPVHVVCRCGN-------TWCSRCKDEPHWPASCSQAERFWLKYADQLSEYQRKDLFYSVYIKR--------CPHC-RYPIEKNGGCPHMYCILCKATFCWHC 725          
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Nematostella
Match: EDO47093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN86])

HSP 1 Score: 50.8322 bits (120), Expect = 2.617e-6
Identity = 86/357 (24.09%), Postives = 161/357 (45.10%), Query Frame = 1
Query: 1492 CEICVDHFDSEEVFILKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIP--FEEY--QKIVECLENLVITTRGCSQCFSCKSVLVKSDVPLESIKKGFNYXXXXXXXXXXXXXNRQHWPASCDDMVQHGNQLVKLNDKYNIQLPKPVK-----IEGRFCYNCHKFHVEKPSG-TYIWC-SCGVVFCYNC-----GKKDC--TSSFGSI-CTNDNN---RVVFKVDIVKQGSFPE-PDSFRSKLYCESFNARFWLQQSNVTFLKRRLMQIDHQFKNAEDLHFDRDKVISQYQQILKVIELIFVFQYQSN---EKSSTKSQILKKALQNLMLFVNEFRAIIDQL 2484
            C IC   F   ++  L +C H  C +C+  +L   +   +    CP  NC  T+D V+++SL P  + ++  +K+   LE +  + R C    +C+ V+  +++   S    ++ +CKCG I C  CG++ HWPASC +      +  ++   Y   L    K     +  + C +CH + +EK  G  ++ C  C   FC+ C         C    S   +  TN+     R    ++IV++ +F   P +   K+       R  L  + V   K     I+   +N  ++    +K+I+    +LKV+E    F YQ++   E ++ K+ + K    +++  +++   I D++
Sbjct:  546 CGICFGDFRENKMTALMSCGHSFCTECWEFYLKSQISRGEGDIGCPGYNCDVTLDNVTIMSLTPSWYPKFLKRKLNRALE-MTSSWRWCPG-KNCRQVVNGTELSPNS--SAWSVLCKCGGIWCFKCGSQAHWPASCVE----ARKFYRIAGNYEKLLINERKELINSVMVKNCPSCH-YPIEKHLGCNFMTCVMCKTNFCWICLIDFKDHDRCLKEQSLKEVELTNEGTTTARFEGFLEIVRRNTFYRLPKNIGGKV------KRLKLLAAGVNSYKHIAPIINPPCRNPIEIEKLMEKIIA--NNVLKVMEEGLQFSYQAHLAVEGAAKKAAVCKNKGASVVHSMSQLEFIADRI 885          
BLAST of RBR-type E3 ubiquitin transferase vs. Planmine SMEST
Match: SMESG000054560.1 (SMESG000054560.1)

HSP 1 Score: 1677.14 bits (4342), Expect = 0.000e+0
Identity = 857/864 (99.19%), Postives = 861/864 (99.65%), Query Frame = 1
Query:   22 LSETKMDTVCGKTYRRVSNFFHKEGEIIIYSNPQLEIFGNEYSHDVSYSLKKRKRWELIPSISKKINLKGEKEYYEDVSVRCCIRQDYGGRGSTRAHYIIDSDFQKEIGSMDLSNKKFNKGSFNLGSVIKNWEQLARHSEKKVYSNEINWINIADKLLEKSFISEDSFVSMFNDELSKKDECSNGNKDQIWIEQIVPVNAPYSTKVRRWHPGRWKKRPYKKWDFEDFSVNDGELGAYDLTDDEKNDIVTAESFDDTTNTLPLVVQEQYFINTSKTSQSXXXXXXXXXXXXCPKAIDMNLGNIQTLSSTKSSECFASNKLPRIFITLSRELFLEELKTISGFCHLWKSLTSLEMFLIDVDYLSILLHKNYIVVKPISVHSDNLITFGVIFNLFNYDFSRIIGKDFVSVVELVTFVQSTIDQVENFERADKAENILSLSNPIEDLSNTWNXXXXXXXXPLFCFNDEWKKLELHQSEINLQNLPSNLEKKISVCEICVDHFDSEEVFILKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIPFEEYQKIVECLENLVITTRGCSQCFSCKSVLVKSDVPLESIKKGFNYXXXXXXXXXXXXXNRQHWPASCDDMVQHGNQLVKLNDKYNIQLPKPVKIEGRFCYNCHKFHVEKPSGTYIWCSCGVVFCYNCGKKDCTSSFGSICTNDNNRVVFKVDIVKQGSFPEPDSFRSKLYCESFNARFWLQQSNVTFLKRRLMQIDHQFKNAEDLHFDRDKVISQYQQILKVIELIFVFQYQSNEKSSTKSQILKKALQNLMLFVNEFRAIIDQLHLIAHKKRKSQISSLEMLKRREKVDVCMNNAIDIVKKCHTFIH 2613
            LSETKMDTVCGKTYRRVSNFFHKEGEIIIYSNPQLEIFGNEYSHDVSYSLKKRKRWELIPSISKKINLKGEKEYYEDVSVRCCIRQDYGGRGST+AHYIIDSDFQKEIGSMDLSNKKFNKGSFNLGSVIKNWEQLA HSEKKVYS EINWINIADKLLEKSFISEDSFVSMFNDELSKKDECSNGNKDQIWIEQIVPVNAPYSTKVRRWHPGRWKKRP KKWDFEDFSVNDGELGAYDLTDDEKNDIVTAESFDDTTNTLPLVVQEQYFINTSKTSQSKKRRRKIRKNRKCPKAIDMNLGNIQTLSSTKSSECFASNKLPRIFITLSRELFLEELKTISGFCHLWKSLTSLEMFLIDVDYLSILLHKNYIVVKPISVHSDNLITFGVIFNLFNYDFSRIIGKDFVSVVELVTFVQSTIDQVENFERADKAENILSLSNP+EDLSNTWNIKTIITTKPLFCFNDEWKKLELHQSEINLQNLPSNLEKKISVCEICVDHFDSEEVFILKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIPFEEYQKIVECLENLVITTRGCSQCFSCKSVLVKSDVPLESIKKGFNYICKCGIIICGFCGNRQHWPASCDDMVQHGNQLVKLNDKYNIQLPKPVKIEGRFCYNCHKFHVEKPSGTYIWCSCGVVFCYNCGKKDCTSSFGSICTNDNNRVVFKVDIVKQGSFPEPDSFRSKLYCESFNARFWLQQSNVTFLKRRLMQIDHQFKNAEDLHFDRDKVISQYQQILKVIELIFVFQYQSNEKSSTKSQILKKALQNLMLFVNEFRAIIDQLHLIAHKKRKSQISSLEMLK+REKVDVCMNNA+DIVKKCHTFIH
Sbjct:    7 LSETKMDTVCGKTYRRVSNFFHKEGEIIIYSNPQLEIFGNEYSHDVSYSLKKRKRWELIPSISKKINLKGEKEYYEDVSVRCCIRQDYGGRGSTKAHYIIDSDFQKEIGSMDLSNKKFNKGSFNLGSVIKNWEQLAGHSEKKVYSYEINWINIADKLLEKSFISEDSFVSMFNDELSKKDECSNGNKDQIWIEQIVPVNAPYSTKVRRWHPGRWKKRPCKKWDFEDFSVNDGELGAYDLTDDEKNDIVTAESFDDTTNTLPLVVQEQYFINTSKTSQSKKRRRKIRKNRKCPKAIDMNLGNIQTLSSTKSSECFASNKLPRIFITLSRELFLEELKTISGFCHLWKSLTSLEMFLIDVDYLSILLHKNYIVVKPISVHSDNLITFGVIFNLFNYDFSRIIGKDFVSVVELVTFVQSTIDQVENFERADKAENILSLSNPMEDLSNTWNIKTIITTKPLFCFNDEWKKLELHQSEINLQNLPSNLEKKISVCEICVDHFDSEEVFILKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIPFEEYQKIVECLENLVITTRGCSQCFSCKSVLVKSDVPLESIKKGFNYICKCGIIICGFCGNRQHWPASCDDMVQHGNQLVKLNDKYNIQLPKPVKIEGRFCYNCHKFHVEKPSGTYIWCSCGVVFCYNCGKKDCTSSFGSICTNDNNRVVFKVDIVKQGSFPEPDSFRSKLYCESFNARFWLQQSNVTFLKRRLMQIDHQFKNAEDLHFDRDKVISQYQQILKVIELIFVFQYQSNEKSSTKSQILKKALQNLMLFVNEFRAIIDQLHLIAHKKRKSQISSLEMLKKREKVDVCMNNAMDIVKKCHTFIH 870          
BLAST of RBR-type E3 ubiquitin transferase vs. Planmine SMEST
Match: SMESG000062644.1 (SMESG000062644.1)

HSP 1 Score: 174.481 bits (441), Expect = 1.151e-44
Identity = 137/486 (28.19%), Postives = 236/486 (48.56%), Query Frame = 1
Query:  976 LPRIFITLSRELFLEELKTISGFCHLWKSLTSLEMFLIDVDYLSILLHKNYIVVKPISVHSDNLITFGVIFNLFNYDFSRIIGKDFVSVVELVTFVQSTIDQVENFERADKAENILSLSNPIEDLSNTWNXXXXXXXXPLFCFNDEWKKLELHQSEIN--LQNLPSNLEKKISVCEICVDHFDSEEVFILKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIPFEEYQKIVECLENLVITTRGCSQCFSCKSVLVKSDVPLESIKKGFNYXXXXXXXXXXXXXNRQHWPASCDDMVQHGNQLVKLND-KYNIQLPKPVKIEGRFCYNCHKFHVEKPSGTYIWCSCGVVFCYNCGKKD-----CTSSFGSICTNDNNRVVFKVDIVKQGSFPEPDSFRSKLYCESFNARFWLQQSNVTFLKRRLM-QIDHQFKNA---EDLHFDRDKVISQYQQILKVIELIFVFQYQSNEK 2397
            LP I I L   +F+++L+ I   C+ W S T     LI +  +     ++Y+V+KP        I+  ++FN+FN ++ +++ K F +V E++  +Q T D++E  E+      ++ +  P + L+  W+ K I   K  F ++DEW+K      +I   L  +  +  + I  CEIC      E++  L  C HKIC +C ++HL   L++      CP + C +  DC ++L  + F+ Y+K ++ LE  VI  +G +QC  C ++ +  ++  E   K   Y C CG I+C  CG  QHWP+SC +  +H  +L  L D +   +  +P+   G  C  C  F ++     ++ C+CG  FC+ CG  +         F      ++  + F +  +  GS       R KLY  S + R     +N    +R+L   I+  F N    E   F+  ++  Q++ +L V E IFV  YQ +++
Sbjct:  335 LPFISIHLPYHVFVDDLEAILNICNCWFSNTFPVSILIGLSNVLATSTESYLVLKPTFSEDSENISLKILFNMFNLNYGKLLDKFFPNVREVLKALQET-DKLEE-EKISINSKVMIVEKPFDGLNGIWSTKPIENEKDFFKYHDEWRKNVFSSKDIETVLNKIFKHETEIIETCEICYTEVCFEDLITLNECNHKICEECLSSHLIYRLETGMKILSCPGVQCKTEFDCAAILQSVSFKRYRKRLKLLETNVIQKKG-AQCIECGTITMMKEIESEEPHKRLEYKCLCGKILCNLCGKTQHWPSSCYEYRKHDQKLKMLKDIEIFTERRQPLIFNGINCPKCMFFVIKITGCDHMSCNCGADFCWLCGDANDEGIHVIDGFPCYTIPEDKHLTFDLTYITPGS----SEIRPKLYIRSLSQRL----NNFEDKRRKLFYHINLMFGNKWKFEMPDFNVKQLEDQFKNLLIVTENIFVKAYQLDKR 809          
The following BLAST results are available for this feature:
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9LXM81.216e-1026.03RBR-type E3 ubiquitin transferase OS=Biomphalaria ... [more]
A0A397ZE294.179e-829.49RBR-type E3 ubiquitin transferase OS=Brassica camp... [more]
A0A3P6FH261.050e-728.57RBR-type E3 ubiquitin transferase OS=Brassica oler... [more]
A0A0D3CKA61.342e-728.57RBR-type E3 ubiquitin transferase OS=Brassica oler... [more]
A0A2J6KJW31.626e-727.78RBR-type E3 ubiquitin transferase OS=Lactuca sativ... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO378442.949e-825.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470932.617e-624.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RBR-type E3 ubiquitin transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000054560.10.000e+099.19SMESG000054560.1[more]
SMESG000062644.11.151e-4428.19SMESG000062644.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023111 ID=SMED30023111|Name=RBR-type E3 ubiquitin transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2717bp
CTTGATTTTATTGTTAGCTAGCTTTCTGAAACAAAAATGGATACCGTATG
TGGTAAAACGTATAGAAGAGTTTCAAATTTTTTTCACAAGGAAGGAGAAA
TTATTATTTATTCAAATCCACAGTTGGAGATTTTCGGAAATGAATACTCT
CACGATGTTTCATATTCATTGAAGAAGAGAAAAAGATGGGAGCTTATACC
GTCCATTTCCAAAAAAATAAATTTGAAAGGTGAAAAAGAATATTACGAAG
ATGTATCAGTCAGATGTTGTATTAGACAAGATTATGGAGGTAGAGGTTCT
ACAAGAGCACATTATATCATTGATTCGGACTTTCAAAAAGAAATAGGCTC
AATGGATTTGTCTAATAAAAAATTTAATAAAGGATCCTTCAATTTAGGTA
GTGTTATAAAAAATTGGGAACAACTTGCTAGACATTCAGAAAAAAAAGTT
TATTCTAATGAAATTAATTGGATAAATATAGCCGATAAGCTATTGGAAAA
GAGTTTTATATCAGAAGATTCATTTGTTTCGATGTTTAATGATGAATTAT
CAAAGAAAGACGAATGTTCTAATGGAAATAAAGACCAGATTTGGATAGAA
CAAATTGTTCCAGTTAATGCGCCTTATTCAACAAAAGTGCGCAGATGGCA
TCCGGGGCGCTGGAAAAAAAGGCCCTATAAGAAATGGGATTTTGAGGACT
TTTCGGTTAATGATGGAGAACTTGGTGCATATGATCTTACTGATGACGAG
AAAAACGACATAGTTACGGCCGAATCATTTGATGACACGACCAATACTTT
ACCTTTGGTTGTCCAAGAACAATATTTCATTAATACTTCGAAAACTTCTC
AATCAAAAAAAAGAAGACGAAAAATTCGAAAAAATCGCAAATGTCCAAAA
GCTATTGATATGAATTTAGGAAATATTCAGACGTTATCTTCTACAAAATC
ATCTGAATGTTTTGCTAGTAATAAACTTCCTAGGATCTTTATCACATTGT
CAAGAGAATTATTTTTGGAAGAATTGAAAACCATTTCTGGATTCTGTCAT
TTATGGAAGAGTTTAACTTCACTGGAAATGTTTTTGATAGACGTGGATTA
TCTCTCGATTCTCCTTCATAAAAATTATATCGTAGTGAAACCAATTTCTG
TTCATTCTGACAATTTAATCACTTTCGGTGTCATCTTTAACCTATTTAAT
TACGATTTCTCTAGAATTATTGGAAAGGATTTTGTCAGTGTTGTCGAACT
GGTCACCTTCGTTCAGTCAACAATTGATCAAGTTGAAAATTTTGAAAGAG
CGGATAAAGCAGAAAATATTTTGTCCTTGAGCAATCCGATTGAAGATTTA
TCCAACACATGGAACATCAAGACTATCATTACGACAAAACCACTTTTTTG
TTTTAATGACGAATGGAAAAAATTAGAACTTCATCAAAGTGAAATAAACC
TTCAAAATTTACCATCGAATCTGGAAAAGAAAATATCCGTTTGTGAAATT
TGCGTTGATCATTTCGACTCAGAAGAAGTTTTCATTTTAAAAGCATGTCA
ACATAAAATTTGTGGTAAATGTTTTACCAATCATTTGACGGATCTTTTGA
AAAGCAATCAGTTTTCTTTTGACTGTCCAATTATTAACTGTCATTCAACG
GTCGACTGCGTTTCGGTTCTTTCATTGATTCCATTTGAAGAGTATCAGAA
AATAGTTGAATGCTTAGAAAACTTGGTCATAACAACGAGAGGCTGTTCTC
AATGTTTTTCTTGTAAATCGGTGCTGGTGAAATCGGATGTTCCATTGGAG
TCTATAAAGAAAGGGTTTAATTATATATGCAAATGTGGCATCATTATTTG
TGGATTTTGTGGTAATAGACAACATTGGCCAGCATCTTGTGATGATATGG
TCCAACACGGTAATCAATTAGTAAAACTTAATGACAAATATAATATACAA
TTACCGAAACCGGTGAAAATTGAAGGAAGGTTTTGTTATAATTGCCACAA
ATTTCATGTCGAAAAACCCTCCGGAACATACATTTGGTGTTCATGCGGCG
TTGTATTTTGTTATAATTGTGGTAAAAAAGATTGCACATCCTCCTTTGGA
TCCATATGCACAAATGACAATAACCGTGTAGTATTCAAAGTAGATATTGT
CAAACAGGGAAGCTTTCCAGAGCCAGATTCGTTTCGATCAAAACTCTACT
GCGAGAGTTTCAACGCCAGATTCTGGTTACAACAGTCAAACGTTACGTTT
CTAAAACGAAGATTAATGCAAATAGATCATCAATTCAAGAATGCAGAAGA
TCTACATTTTGATCGAGACAAAGTTATTTCTCAATATCAACAAATTTTAA
AAGTCATTGAATTAATTTTTGTGTTTCAATATCAATCAAACGAAAAATCT
TCTACTAAATCTCAAATTCTGAAGAAAGCTTTACAAAACCTCATGTTGTT
TGTGAATGAATTTCGAGCTATTATTGACCAATTACATTTGATAGCACATA
AAAAGCGGAAATCTCAAATTTCTTCGCTAGAAATGTTGAAGAGGCGCGAA
AAAGTGGACGTTTGCATGAATAACGCAATAGATATTGTAAAGAAATGCCA
CACTTTTATACATTGATGTCTTTAGTGTCTAATATGTTCTCATTAAGTGT
ATTTTGTTATTAAATATTTTCTAATATTTTTGTTAATATATGTATTTAAT
ATTAGATATTTCTTCGT
back to top

protein sequence of SMED30023111-orf-1

>SMED30023111-orf-1 ID=SMED30023111-orf-1|Name=SMED30023111-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=860bp
MDTVCGKTYRRVSNFFHKEGEIIIYSNPQLEIFGNEYSHDVSYSLKKRKR
WELIPSISKKINLKGEKEYYEDVSVRCCIRQDYGGRGSTRAHYIIDSDFQ
KEIGSMDLSNKKFNKGSFNLGSVIKNWEQLARHSEKKVYSNEINWINIAD
KLLEKSFISEDSFVSMFNDELSKKDECSNGNKDQIWIEQIVPVNAPYSTK
VRRWHPGRWKKRPYKKWDFEDFSVNDGELGAYDLTDDEKNDIVTAESFDD
TTNTLPLVVQEQYFINTSKTSQSKKRRRKIRKNRKCPKAIDMNLGNIQTL
SSTKSSECFASNKLPRIFITLSRELFLEELKTISGFCHLWKSLTSLEMFL
IDVDYLSILLHKNYIVVKPISVHSDNLITFGVIFNLFNYDFSRIIGKDFV
SVVELVTFVQSTIDQVENFERADKAENILSLSNPIEDLSNTWNIKTIITT
KPLFCFNDEWKKLELHQSEINLQNLPSNLEKKISVCEICVDHFDSEEVFI
LKACQHKICGKCFTNHLTDLLKSNQFSFDCPIINCHSTVDCVSVLSLIPF
EEYQKIVECLENLVITTRGCSQCFSCKSVLVKSDVPLESIKKGFNYICKC
GIIICGFCGNRQHWPASCDDMVQHGNQLVKLNDKYNIQLPKPVKIEGRFC
YNCHKFHVEKPSGTYIWCSCGVVFCYNCGKKDCTSSFGSICTNDNNRVVF
KVDIVKQGSFPEPDSFRSKLYCESFNARFWLQQSNVTFLKRRLMQIDHQF
KNAEDLHFDRDKVISQYQQILKVIELIFVFQYQSNEKSSTKSQILKKALQ
NLMLFVNEFRAIIDQLHLIAHKKRKSQISSLEMLKRREKVDVCMNNAIDI
VKKCHTFIH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR031127E3_UB_ligase_RBR
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 481..567
e-value: 8.1E-10
score: 40.6
IPR031127E3 ubiquitin ligase RBR familyPANTHERPTHR11685RBR FAMILY RING FINGER AND IBR DOMAIN-CONTAININGcoord: 316..732
NoneNo IPR availablePROSITEPS51873TRIADcoord: 482..695
score: 13.607
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 481..561
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 486..534
score: 9.716