Filamin

Overview
NameFilamin
Smed IDSMED30023110
Length (bp)7711
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Filamin (SMED30023110) t-SNE clustered cells

Violin plots show distribution of expression levels for Filamin (SMED30023110) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Filamin (SMED30023110) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Filamin (SMED30023110) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023110

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023110SMESG000011386.1 dd_Smed_v4_810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023110SMESG000011386.1 dd_Smed_v4_810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023110SMESG000011386.1 dd_Smed_v4_810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023110SMESG000011386.1 dd_Smed_v4_810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023110SMESG000011386.1 dd_Smed_v4_810_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023110SMESG000011386.1 Contig34476uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023110SMESG000011386.1 Contig34476newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023110SMESG000011386.1 Contig37412uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023110SMESG000011386.1 Contig37412newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
musculature systemSMED30023110SMESG000011386.1 dd_Smed_v6_810_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30023110SMESG000011386.1 dd_Smed_v6_810_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 859/2302 (37.32%), Postives = 1250/2302 (54.30%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP----YKESKIKAFGPGL--TGGIVSKPAFFEVETN--GETGALGFSIKGPSEA-KIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPST-----VKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS----VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQET--NNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVV-----------DFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX---------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGST-----QKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G++ + V +P+G K   E+         Y C Y P   G + + I FA   IP SPF V V  A  +P+   ASG G++P G  +   T F V T  AG G +   +   KG ++ VK K     +  +  EY     G +S+ + + G  I  SPF V V  +   +  ++  A G G+   G  V   A+F V +  +    LG  + GP ++  +   +    C  +  Y P+ PG Y V I   +  I  SP+   + P    Y    ++A+GPGL  +G IV+  A F V+    G+     F+  G  +   I   +  DG+   +Y P    ++ + ++    NIP SPY   I   +    P KV  +GPG+  SG+  N+P  F V+   AG           A       + +   I  N + T++ +Y P   G++T+ V + +  IP SPF+V V  + +A+ +K  GPG+ +A  +    T+F V  K AG   + +     +  + ++D+ ++  DN D + T+KYTP   G    + + +    IP+SPF V + +  D  K K+N L N   +G+  EF + T   G + + ++ + SP+   VP  +          A F P   G + V V   G+P+  SPY V A+   D    K + P  E  L+   A++ ID K      + +      P E + ++   N +   S ++ P +   Y V    E         KA++  P     V A G GL  G         +D +E  P  LG+    +   +A++   +N DGT +V Y+P   G Y + + Y  E +   P  V + P         D +++  +GPG+    VF+++ + FTV+++P+   G   +KA I NP    + C V +N DGTY   Y+P   G H +++TYD VP+  SP+ V V +G  PSR++A GPGL+E  T +P  FTV   GAG GGLG+++EGP++++I C DNKDG+CS +Y+P  PG YDV+I +   HIPGSPF VP+ D+VD SKVK  GPGL  +G R      FTVD+SKAG APL+V V+      V+P  ++     G   VTY P   G   + V Y + ++P SPF   VL + +  KV  +G G+  +    +   +P  F I+ RDAGE  L + +T    +     V ++ DGT+   Y  D  G Y + V YG  ++P SP+ +         +C   GP I + V  G+ V   V+ + AG G ++   + P G      +     G   + Y   K G Y + + F   +IPN             +++  T    T  +  P+    Y  V           D   P       +   V+ PS +   P +++N DGT+TV+Y P+E GLHE+ + Y G  I  SP +FYV+    SG V+AYGPGL YG  +  A FTIVT+DAG GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY I +K+ DKHI GSPFTAKI  + ++ SQ+ +G+ +D  L ISETD+++L A + +P+GR+E C LKRL N ++GISF P+EVGEHLV++ ++G H+ NSP  I V ++EIG+A R K+YG GL++G   E   F+VDTR+AGYGG+SL++EGPSKV+I+  D  DGTC V+Y PT PG YI++ K+AD +VPGSPF V I G     + E I R   A  V+ +G++C+LNL IP  N  + +A V SPSG     EI+ +  N   +RF+P+E+GVHTVSVK   +HVTGSPFQFTVGPL +GG HKV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F D+K+GSCGV+Y   EPG+Y  SIKFNDEH+P SP+++            PV   +   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +S+++ ++Y+V F+P ENG+H + V  N S + GSPF+V V           V+  G G+  G TG  +EFF++T+ AG G L+VTI+GPSKV+++CQE   GY   Y P APG+Y IS+KYGG NHI+GSPF   ++G    S  S  ET S L ++V   S  T      K  S    V  +G GL  A +G+++ F+VD   AG ++L +GV GP  PCEEV++KH+GN ++ V Y V+E+G ++L V+WG   +PGSPF + VP
Sbjct:  353 DASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC-NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQK--DFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPE---AGMQKVRAWGPGLH--GGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSC--DVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSH---PQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDII--DNYDYSHTVKYTPTQQGNMQVL-VTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEG--PCE-AKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAV-------DTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL-GSGVRARVLQSFTVDSSKAGLAPLEVRVLG-PRGLVEPVNVVDNGD-GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG---VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPN-----------SPFTVMATDGEVTAVEEAPVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYP-NSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISG--EGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLV------------PVIAPS---DDARRLTVMSLQESGLKVNQPASFAIRLNG-AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP 2591          

HSP 2 Score: 1066.99 bits (2758), Expect = 0.000e+0
Identity = 848/2595 (32.68%), Postives = 1244/2595 (47.94%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK-ESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNT---TPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE--EGITKQPQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFT--PSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE--YSVVDFKFPVGPVFDY-------VRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVD----STIPSGQVT--AYGP-----GLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVG---------TTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAV-----NIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDAN--QFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRX---XXXXXXXXXXXIHHGHTG-RINE--FFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWG--NHDVPGSPFEIVV 7621
            + E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    +R  H+RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGL+WTLILHYSI+MP+WE    ++ D   K  +PKQRLLGWI +K+P+ P+ NF  +W DG A+GALVD+CAPGLCP+W  WDP++ + NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +  PA FTVDT +AG+G++ + V +P+G KE  ++    +K   YS  Y+P + G +++ + FA   I  SPF+V+V  A GD SKVTA GPG+E VGN   + T+F+++TA AG G +   + D +G K++V+  +  +    +   Y   + G H V +FFAG  I  SPF V V  +  N +A +  A+GRG+QP+GVR+R+  +F+V T+ AG  +LGV + GP    E  + K     +Y   Y P  PG Y + I +G + I  SPF V V P     K++A+GPGL GGIV + A F VE+ G E G+LGF+I+GPS+AKI+  D  DGS +V YWP  PGEYAVHI+CDDE+I  SPYMA I   T  ++P  V AYGPGL  SG   N  A+F V+ K+AG  + +K    D  GQ I +Q+++  DGTY+C YTP    KHT+ V +G VNIP SP++VN+ +  +   +KV+GPG+ER+  K N  T+F VDC  AG GD+ +       VL E   DV      N + TF            YTI++ F+  EIP SPF+V ++  +D  K K      +      G+   F + T   G K    +   SP        L   +N        +TPT  G   V V   G+PI  SP+ V     ++  +      E    +    ++ +D +        +    L+P  R  V     P   R N    F P EE +Y V  T +           E   P     V A+G GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP +PG Y VN+L+ + HI  SPF   I           D +KV A GPGL    V +        +       G G +     +    ++  ++ NN DGTY+ +Y P   G + + + Y G  V   P  V V    D SRI+ +GPG+E  +   +    FTVD   L   G   +   I  P+ A  +CF  DN DGT  V+Y P + G + V + +++  IP SPF V + +    S+V+  GPGL+      FT  P+ FTV    AG   L + V   +   +        +  G     YIP   G+ ++ + Y    +PGSPF   V +  +P KV + G G+    G  +  +V   FT+++  AG + LE+ V GP      ++V ++GDGT T  Y     G Y V V Y ++ +P SPF V V       +    GP L+   VP    V   ++ ++AG+G+L+ +     G      + + + G   V+Y+P K G Y + + +  ++IP    R  A Q              T + SK +       S V     VG V D        V   V  P   +    +I N DGT  + Y  ++ G + + V + G  I  SPF         + +    VT  AY P     GL +   D+   F +       G ++  V  PS   A  + +DNK+GT  V Y P   G + + IK+M  HI  SP    +   P   S    G          T+   +   +     L+  +  P+  E SC   +  +G   +++ P   G++ + V  + +HIP SPF   + ++     S+VKL               F++D        L+ SI+ PS  +  C      +NH G   +++ P E G +++++K   ++V  SP ++      IG    + +  R L      E+S       ++    GY     + +V  PS      E   L D    + + P   GV+ VS K  + HV GSPF   +      G  K  I  +     +A   +     +   E  +  +S  +  PS    +AEI     K+  C V +   E G +  S+K+  +HV GSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     N    V ++  E G + V +  N+  IP SP+ V      +       +    +G ++N+   F    N   G +   +  PS     C  +E     Y   ++P+  G +TI +K+ G +H++GSPF V +       N                          P  V   G GL+    G ++EF ++   AG   L V + GP +    C+E          ++V Y     G +L+ V++G  NH V GSPF+  V
Sbjct:    3 VTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQV-GEACNPNACR--ASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGK-APLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTF-TVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAG-KAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQG-KLDVTILSP-SRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADI-------EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEA-----GPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLK----EAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKIN----CRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL----GSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQ--------------TGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVTEEAYVPVSDMNGLGFKPFDLVIPFAVRK-----GEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYV-NYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNK--DGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDS-RRCSQVKL----------GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIG---ISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDF----IVDTRDAGYG--GISLAVEGPSKVDIQTE--DLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKIS---GEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEI-VPMGKNSHC-VRFVPQEMGVHTVSVKYRGQHVTGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNG-SHVVGSPFKVRVGEPGQAGN--------------------------PALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQET------PEGYKVMYTPMAPGNYLISVKYGGPNHIV-GSPFKAKV 2460          
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1339.32 bits (3465), Expect = 0.000e+0
Identity = 860/2303 (37.34%), Postives = 1251/2303 (54.32%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP----YKESKIKAFGPGL--TGGIVSKPAFFEVETN--GETGALGFSIKGPSEA-KIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPST-----VKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS----VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQET--NNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSV------------VDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX---------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGST-----QKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G++ + V +P+G K   E+         Y C Y P   G + + I FA   IP SPF V V  A  +P+   ASG G++P G  +   T F V T  AG G +   +   KG ++ VK K     +  +  EY     G +S+ + + G  I  SPF V V  +   +  ++  A G G+   G  V   A+F V +  +    LG  + GP ++  +   +    C  +  Y P+ PG Y V I   +  I  SP+   + P    Y    ++A+GPGL  +G IV+  A F V+    G+     F+  G  +   I   +  DG+   +Y P    ++ + ++    NIP SPY   I   +    P KV  +GPG+  SG+  N+P  F V+   AG           A       + +   I  N + T++ +Y P   G++T+ V + +  IP SPF+V V  + +A+ +K  GPG+ +A  +    T+F V  K AG   + +     +  + ++D+ ++  DN D + T+KYTP   G    + + +    IP+SPF V + +  D  K K+N L N   +G+  EF + T   G + + ++ + SP+   VP  +          A F P   G + V V   G+P+  SPY V A+   D    K + P  E  L+   A++ ID K      + +      P E + ++   N +   S ++ P +   Y V    E         KA++  P     V A G GL  G         +D +E  P  LG+    +   +A++   +N DGT +V Y+P   G Y + + Y  E +   P  V + P         D +++  +GPG+    VF+++ + FTV+++P+   G   +KA I NP    + C V +N DGTY   Y+P   G H +++TYD VP+  SP+ V V +G  PSR++A GPGL+E  T +P  FTV   GAG GGLG+++EGP++++I C DNKDG+CS +Y+P  PG YDV+I +   HIPGSPF VP+ D+VD SKVK  GPGL  +G R      FTVD+SKAG APL+V V+      V+P  ++     G   VTY P   G   + V Y + ++P SPF   VL + +  KV  +G G+  +    +   +P  F I+ RDAGE  L + +T    +     V ++ DGT+   Y  D  G Y + V YG  ++P SP+ +         +C   GP I + V  G+ V   V+ + AG G ++   + P G      +     G   + Y   K G Y + + F   +IPN      A    E  ++E    +      +P +  E  V             D   P       +   V+ PS +   P +++N DGT+TV+Y P+E GLHE+ + Y G  I  SP +FYV+    SG V+AYGPGL YG  +  A FTIVT+DAG GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY I +K+ DKHI GSPFTAKI  + ++ SQ+ +G+ +D  L ISETD+++L A + +P+GR+E C LKRL N ++GISF P+EVGEHLV++ ++G H+ NSP  I V ++EIG+A R K+YG GL++G   E   F+VDTR+AGYGG+SL++EGPSKV+I+  D  DGTC V+Y PT PG YI++ K+AD +VPGSPF V I G     + E I R   A  V+ +G++C+LNL IP  N  + +A V SPSG     EI+ +  N   +RF+P+E+GVHTVSVK   +HVTGSPFQFTVGPL +GG HKV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F D+K+GSCGV+Y   EPG+Y  SIKFNDEH+P SP+++            PV   +   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +S+++ ++Y+V F+P ENG+H + V  N S + GSPF+V V           V+  G G+  G TG  +EFF++T+ AG G L+VTI+GPSKV+++CQE   GY   Y P APG+Y IS+KYGG NHI+GSPF   ++G    S  S  ET S L ++V   S  T      K  S    V  +G GL  A +G+++ F+VD   AG ++L +GV GP  PCEEV++KH+GN ++ V Y V+E+G ++L V+WG   +PGSPF + VP
Sbjct:  353 DASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC-NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQK--DFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPE---AGMQKVRAWGPGLH--GGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSC--DVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSH---PQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDII--DNYDYSHTVKYTPTQQGNMQVL-VTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEG--PCE-AKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAV-------DTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL-GSGVRARVLQSFTVDSSKAGLAPLEVRVLG-PRGLVEPVNVVDNGD-GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG---VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATD-GEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYP-NSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISG--EGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLV------------PVIAPS---DDARRLTVMSLQESGLKVNQPASFAIRLNG-AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP 2602          

HSP 2 Score: 1066.22 bits (2756), Expect = 0.000e+0
Identity = 850/2604 (32.64%), Postives = 1244/2604 (47.77%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK-ESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPI---GQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE--EGITKQPQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFT--PSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE--YSVVDFKFPVGPVFDY-------VRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVD----STIPSGQVTAYGPGLSYGRP-----------DMHAH----FTIVTKDA-GAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVG---------TTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAV-----NIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDAN--QFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRX---XXXXXXXXXXXIHHGHTG-RINE--FFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWG--NHDVPGSPFEIVV 7621
            + E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    +R  H+RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGL+WTLILHYSI+MP+WE    ++ D   K  +PKQRLLGWI +K+P+ P+ NF  +W DG A+GALVD+CAPGLCP+W  WDP++ + NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +  PA FTVDT +AG+G++ + V +P+G KE  ++    +K   YS  Y+P + G +++ + FA   I  SPF+V+V  A GD SKVTA GPG+E VGN   + T+F+++TA AG G +   + D +G K++V+  +  +    +   Y   + G H V +FFAG  I  SPF V V  +  N +A    A+GRG+QP+GVR+R+  +F+V T+ AG  +LGV + GP    E  + K     +Y   Y P  PG Y + I +G + I  SPF V V P     K++A+GPGL GGIV + A F VE+ G E G+LGF+I+GPS+AKI+  D  DGS +V YWP  PGEYAVHI+CDDE+I  SPYMA I   T  ++P  V AYGPGL  SG   N  A+F V+ K+AG  + +K    D  GQ I +Q+++  DGTY+C YTP    KHT+ V +G VNIP SP++VN+ +  +   +KV+GPG+ER+  K N  T+F VDC  AG GD+ +       VL E   DV      N + TF            YTI++ F+  EIP SPF+V ++  +D  K K      +      G+   F + T   G K    +   SP        L   +N        +TPT  G   V V   G+PI  SP+ V     ++  +      E    +    ++ +D +        +    L+P  R  V     P   R N    F P EE +Y V  T +           E   P     V A+G GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP +PG Y VN+L+ + HI  SPF   I           D +KV A GPGL    V +        +       G G +     +    ++  ++ NN DGTY+ +Y P   G + + + Y G  V   P  V V    D SRI+ +GPG+E  +   +    FTVD   L   G   +   I  P+ A  +CF  DN DGT  V+Y P + G + V + +++  IP SPF V + +    S+V+  GPGL+      FT  P+ FTV    AG   L + V   +   +        +  G     YIP   G+ ++ + Y    +PGSPF   V +  +P KV + G G+    G  +  +V   FT+++  AG + LE+ V GP      ++V ++GDGT T  Y     G Y V V Y ++ +P SPF V V       +    GP L+   VP    V   ++ ++AG+G+L+ +     G      + + + G   V+Y+P K G Y + + +  ++IP    R  A Q              T + SK +       S V     VG V D        V   V  P   +    +I N DGT  + Y  ++ G + + V + G  I  SPF         + +    V A  PG    RP           DM+      F +V   A   G ++  V  PS   A  + +DNK+GT  V Y P   G + + IK+M  HI  SP    +   P   S    G          T+   +   +     L+  +  P+  E SC   +  +G   +++ P   G++ + V  + +HIP SPF   + ++     S+VKL               F++D        L+ SI+ PS  +  C      +NH G   +++ P E G +++++K   ++V  SP ++      IG    + +  R L      E+S       ++    GY     + +V  PS      E   L D    + + P   GV+ VS K  + HV GSPF   +      G  K  I  +     +A   +     +   E  +  +S  +  PS    +AEI     K+  C V +   E G +  S+K+  +HV GSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     N    V ++  E G + V +  N+  IP SP+ V      +       +    +G ++N+   F    N   G +   +  PS     C  +E     Y   ++P+  G +TI +K+ G +H++GSPF V +       N                          P  V   G GL+    G ++EF ++   AG   L V + GP +    C+E          ++V Y     G +L+ V++G  NH V GSPF+  V
Sbjct:    3 VTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQV-GEACNPNA--CRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGK-APLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTF-TVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAG-KAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQG-KLDVTILSP-SRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADI-------EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEA-----GPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLK----EAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKIN----CRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL----GSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQ--------------TGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGF---RPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYV-NYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNK--DGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDS-RRCSQVKL----------GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIG---ISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDF----IVDTRDAGYG--GISLAVEGPSKVDIQTE--DLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKIS---GEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEI-VPMGKNSHC-VRFVPQEMGVHTVSVKYRGQHVTGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNG-SHVVGSPFKVRVGEPGQAGN--------------------------PALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQET------PEGYKVMYTPMAPGNYLISVKYGGPNHIV-GSPFKAKV 2471          
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1337.01 bits (3459), Expect = 0.000e+0
Identity = 858/2294 (37.40%), Postives = 1246/2294 (54.32%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP----YKESKIKAFGPGL--TGGIVSKPAFFEVETN--GETGALGFSIKGPSEA-KIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPST-----VKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS----VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQET--NNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE---YSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX---------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGST-----QKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G++ + V +P+G K   E+         Y C Y P   G + + I FA   IP SPF V V  A  +P+   ASG G++P G  +   T F V T  AG G +   +   KG ++ VK K     +  +  EY     G +S+ + + G  I  SPF V V  +   +  ++  A G G+   G  V   A+F V +  +    LG  + GP ++  +   +    C  +  Y P+ PG Y V I   +  I  SP+   + P    Y    ++A+GPGL  +G IV+  A F V+    G+     F+  G  +   I   +  DG+   +Y P    ++ + ++    NIP SPY   I   +    P KV  +GPG+  SG+  N+P  F V+   AG           A       + +   I  N + T++ +Y P   G++T+ V + +  IP SPF+V V  + +A+ +K  GPG+ +A  +    T+F V  K AG   + +     +  + ++D+ ++  DN D + T+KYTP   G    + + +    IP+SPF V + +  D  K K+N L N   +G+  EF + T   G + + ++ + SP+   VP  +          A F P   G + V V   G+P+  SPY V A+   D    K + P  E  L+   A++ ID K      + +      P E + ++   N +   S ++ P +   Y V    E         KA++  P     V A G GL  G         +D +E  P  LG+    +   +A++   +N DGT +V Y+P   G Y + + Y  E +   P  V + P         D +++  +GPG+    VF+++ + FTV+++P+   G   +KA I NP    + C V +N DGTY   Y+P   G H +++TYD VP+  SP+ V V +G  PSR++A GPGL+E  T +P  FTV   GAG GGLG+++EGP++++I C DNKDG+CS +Y+P  PG YDV+I +   HIPGSPF VP+ D+VD SKVK  GPGL  +G R      FTVD+SKAG APL+V V+      V+P  ++     G   VTY P   G   + V Y + ++P SPF   VL + +  KV  +G G+  +    +   +P  F I+ RDAGE  L + +T    +     V ++ DGT+   Y  D  G Y + V YG  ++P SP+ +         +C   GP I + V  G+ V   V+ + AG G ++   + P G      +     G   + Y   K G Y + + F   +IPN                   T   T E   P+       +   D   P       +   V+ PS +   P +++N DGT+TV+Y P+E GLHE+ + Y G  I  SP +FYV+    SG V+AYGPGL YG  +  A FTIVT+DAG GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY I +K+ DKHI GSPFTAKI  + ++ SQ+ +G+ +D  L ISETD+++L A + +P+GR+E C LKRL N ++GISF P+EVGEHLV++ ++G H+ NSP  I V ++EIG+A R K+YG GL++G   E   F+VDTR+AGYGG+SL++EGPSKV+I+  D  DGTC V+Y PT PG YI++ K+AD +VPGSPF V I G     + E I R   A  V+ +G++C+LNL IP  N  + +A V SPSG     EI+ +  N   +RF+P+E+GVHTVSVK   +HVTGSPFQFTVGPL +GG HKV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F D+K+GSCGV+Y   EPG+Y  SIKFNDEH+P SP+++            PV   +   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +S+++ ++Y+V F+P ENG+H + V  N S + GSPF+V V           V+  G G+  G TG  +EFF++T+ AG G L+VTI+GPSKV+++CQE   GY   Y P APG+Y IS+KYGG NHI+GSPF   ++G    S  S  ET S L ++V   S  T      K  S    V  +G GL  A +G+++ F+VD   AG ++L +GV GP  PCEEV++KH+GN ++ V Y V+E+G ++L V+WG   +PGSPF + VP
Sbjct:  353 DASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC-NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQK--DFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPE---AGMQKVRAWGPGLH--GGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSC--DVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSH---PQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDII--DNYDYSHTVKYTPTQQGNMQVL-VTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEG--PCE-AKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAV-------DTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL-GSGVRARVLQSFTVDSSKAGLAPLEVRVLG-PRGLVEPVNVVDNGD-GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG---VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPF----------------TVMVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYP-NSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISG--EGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLV------------PVIAPS---DDARRLTVMSLQESGLKVNQPASFAIRLNG-AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP 2578          

HSP 2 Score: 1071.23 bits (2769), Expect = 0.000e+0
Identity = 845/2586 (32.68%), Postives = 1242/2586 (48.03%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK-ESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNT---TPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE--EGITKQPQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFT--PSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE--YSVVDFKFPVGPVFDY-------VRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYV--DSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVG---------TTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAV-----NIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDAN--QFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRX---XXXXXXXXXXXIHHGHTG-RINE--FFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWG--NHDVPGSPFEIVV 7621
            + E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    +R  H+RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGL+WTLILHYSI+MP+WE    ++ D   K  +PKQRLLGWI +K+P+ P+ NF  +W DG A+GALVD+CAPGLCP+W  WDP++ + NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +  PA FTVDT +AG+G++ + V +P+G KE  ++    +K   YS  Y+P + G +++ + FA   I  SPF+V+V  A GD SKVTA GPG+E VGN   + T+F+++TA AG G +   + D +G K++V+  +  +    +   Y   + G H V +FFAG  I  SPF V V  +  N +A    A+GRG+QP+GVR+R+  +F+V T+ AG  +LGV + GP    E  + K     +Y   Y P  PG Y + I +G + I  SPF V V P     K++A+GPGL GGIV + A F VE+ G E G+LGF+I+GPS+AKI+  D  DGS +V YWP  PGEYAVHI+CDDE+I  SPYMA I   T  ++P  V AYGPGL  SG   N  A+F V+ K+AG  + +K    D  GQ I +Q+++  DGTY+C YTP    KHT+ V +G VNIP SP++VN+ +  +   +KV+GPG+ER+  K N  T+F VDC  AG GD+ +       VL E   DV      N + TF            YTI++ F+  EIP SPF+V ++  +D  K K      +      G+   F + T   G K    +   SP        L   +N        +TPT  G   V V   G+PI  SP+ V     ++  +      E    +    ++ +D +        +    L+P  R  V     P   R N    F P EE +Y V  T +           E   P     V A+G GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP +PG Y VN+L+ + HI  SPF   I           D +KV A GPGL    V +        +       G G +     +    ++  ++ NN DGTY+ +Y P   G + + + Y G  V   P  V V    D SRI+ +GPG+E  +   +    FTVD   L   G   +   I  P+ A  +CF  DN DGT  V+Y P + G + V + +++  IP SPF V + +    S+V+  GPGL+      FT  P+ FTV    AG   L + V   +   +        +  G     YIP   G+ ++ + Y    +PGSPF   V +  +P KV + G G+    G  +  +V   FT+++  AG + LE+ V GP      ++V ++GDGT T  Y     G Y V V Y ++ +P SPF V V       +    GP L+   VP    V   ++ ++AG+G+L+ +     G      + + + G   V+Y+P K G Y + + +  ++IP    R  A Q              T + SK +       S V     VG V D        V   V  P   +    +I N DGT  + Y  ++ G + + V + G  I  SPF   V  ++ +P   +     GL +   D+   F +       G ++  V  PS   A  + +DNK+GT  V Y P   G + + IK+M  HI  SP    +   P   S    G          T+   +   +     L+  +  P+  E SC   +  +G   +++ P   G++ + V  + +HIP SPF   + ++     S+VKL               F++D        L+ SI+ PS  +  C      +NH G   +++ P E G +++++K   ++V  SP ++      IG    + +  R L      E+S       ++    GY     + +V  PS      E   L D    + + P   GV+ VS K  + HV GSPF   +      G  K  I  +     +A   +     +   E  +  +S  +  PS    +AEI     K+  C V +   E G +  S+K+  +HV GSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     N    V ++  E G + V +  N+  IP SP+ V      +       +    +G ++N+   F    N   G +   +  PS     C  +E     Y   ++P+  G +TI +K+ G +H++GSPF V +       N                          P  V   G GL+    G ++EF ++   AG   L V + GP +    C+E          ++V Y     G +L+ V++G  NH V GSPF+  V
Sbjct:    3 VTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQV-GEACNPNA--CRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGK-APLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTF-TVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAG-KAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQG-KLDVTILSP-SRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADI-------EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEA-----GPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLK----EAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKIN----CRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL----GSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQ--------------TGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPVSDMN----GLGFKPFDLVIPFAVRK-----GEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYV-NYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNK--DGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDS-RRCSQVKL----------GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIG---ISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDF----IVDTRDAGYG--GISLAVEGPSKVDIQTE--DLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKIS---GEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEI-VPMGKNSHC-VRFVPQEMGVHTVSVKYRGQHVTGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNG-SHVVGSPFKVRVGEPGQAGN--------------------------PALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQET------PEGYKVMYTPMAPGNYLISVKYGGPNHIV-GSPFKAKV 2447          
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1333.16 bits (3449), Expect = 0.000e+0
Identity = 858/2294 (37.40%), Postives = 1246/2294 (54.32%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP----YKESKIKAFGPGL--TGGIVSKPAFFEVETN--GETGALGFSIKGPSEA-KIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPST-----VKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS----VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQET--NNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE---YSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX---------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGST-----QKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G++ + V +P+G K   E+         Y C Y P   G + + I FA   IP SPF V V  A  +P+   ASG G++P G  +   T F V T  AG G +   +   KG ++ VK K     +  +  EY     G +S+ + + G  I  SPF V V  +   +  ++  A G G+   G  V   A+F V +  +    LG  + GP ++  +   +    C  +  Y P+ PG Y V I   +  I  SP+   + P    Y    ++A+GPGL  +G IV+  A F V+    G+     F+  G  +   I   +  DG+   +Y P    ++ + ++    NIP SPY   I   +    P KV  +GPG+  SG+  N+P  F V+   AG           A       + +   I  N + T++ +Y P   G++T+ V + +  IP SPF+V V  + +A+ +K  GPG+ +A  +    T+F V  K AG   + +     +  + ++D+ ++  DN D + T+KYTP   G    + + +    IP+SPF V + +  D  K K+N L N   +G+  EF + T   G + + ++ + SP+   VP  +          A F P   G + V V   G+P+  SPY V A+   D    K + P  E  L+   A++ ID K      + +      P E + ++   N +   S ++ P +   Y V    E         KA++  P     V A G GL  G         +D +E  P  LG+    +   +A++   +N DGT +V Y+P   G Y + + Y  E +   P  V + P         D +++  +GPG+    VF+++ + FTV+++P+   G   +KA I NP    + C V +N DGTY   Y+P   G H +++TYD VP+  SP+ V V +G  PSR++A GPGL+E  T +P  FTV   GAG GGLG+++EGP++++I C DNKDG+CS +Y+P  PG YDV+I +   HIPGSPF VP+ D+VD SKVK  GPGL  +G R      FTVD+SKAG APL+V V+      V+P  ++     G   VTY P   G   + V Y + ++P SPF   VL + +  KV  +G G+  +    +   +P  F I+ RDAGE  L + +T    +     V ++ DGT+   Y  D  G Y + V YG  ++P SP+ +         +C   GP I + V  G+ V   V+ + AG G ++   + P G      +     G   + Y   K G Y + + F   +IPN                   T   T E   P+       +   D   P       +   V+ PS +   P +++N DGT+TV+Y P+E GLHE+ + Y G  I  SP +FYV+    SG V+AYGPGL YG  +  A FTIVT+DAG GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY I +K+ DKHI GSPFTAKI  + ++ SQ+ +G+ +D  L ISETD+++L A + +P+GR+E C LKRL N ++GISF P+EVGEHLV++ ++G H+ NSP  I V ++EIG+A R K+YG GL++G   E   F+VDTR+AGYGG+SL++EGPSKV+I+  D  DGTC V+Y PT PG YI++ K+AD +VPGSPF V I G     + E I R   A  V+ +G++C+LNL IP  N  + +A V SPSG     EI+ +  N   +RF+P+E+GVHTVSVK   +HVTGSPFQFTVGPL +GG HKV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F D+K+GSCGV+Y   EPG+Y  SIKFNDEH+P SP+++            PV   +   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +S+++ ++Y+V F+P ENG+H + V  N S + GSPF+V V           V+  G G+  G TG  +EFF++T+ AG G L+VTI+GPSKV+++CQE   GY   Y P APG+Y IS+KYGG NHI+GSPF   ++G    S  S  ET S L ++V   S  T      K  S    V  +G GL  A +G+++ F+VD   AG ++L +GV GP  PCEEV++KH+GN ++ V Y V+E+G ++L V+WG   +PGSPF + VP
Sbjct:  184 DASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC-NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQK--DFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPE---AGMQKVRAWGPGLH--GGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSC--DVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSH---PQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDII--DNYDYSHTVKYTPTQQGNMQVL-VTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEG--PCE-AKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAV-------DTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL-GSGVRARVLQSFTVDSSKAGLAPLEVRVLG-PRGLVEPVNVVDNGD-GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG---VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPF----------------TVMVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYP-NSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISG--EGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLV------------PVIAPS---DDARRLTVMSLQESGLKVNQPASFAIRLNG-AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP 2409          

HSP 2 Score: 847.81 bits (2189), Expect = 0.000e+0
Identity = 741/2402 (30.85%), Postives = 1107/2402 (46.09%), Query Frame = 2
Query:  719 LCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK-ESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPI---GQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE--EGITKQPQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFT--PSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE--YSVVDFKFPVGPVFDY-------VRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYV--DSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVG---------TTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAV-----NIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDAN--QFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRX---XXXXXXXXXXXIHHGHTG-RINE--FFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWG--NHDVPGSPFEIVV 7621
            LCP+W  WDP++ + NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +  PA FTVDT +AG+G++ + V +P+G KE  ++    +K   YS  Y+P + G +++ + FA   I  SPF+V+V  A GD SKVTA GPG+E VGN   + T+F+++TA AG G +   + D +G K++V+  +  +    +   Y   + G H V +FFAG  I  SPF V V  +  N +A +  A+GRG+QP+GVR+R+  +F+V T+ AG  +LGV + GP    E  + K     +Y   Y P  PG Y + I +G + I  SPF V V P     K++A+GPGL GGIV + A F VE+ G E G+LGF+I+GPS+AKI+  D  DGS +V YWP  PGEYAVHI+CDDE+I  SPYMA I   T  ++P  V AYGPGL  SG   N  A+F V+ K+AG  + +K    D  GQ I +Q+++  DGTY+C YTP    KHT+ V +G VNIP SP++VN+ +  +   +KV+GPG+ER+  K N  T+F VDC  AG GD+ +       VL E   DV      N + TF            YTI++ F+  EIP SPF+V ++  +D  K K      +      G+   F + T   G K    +   SP        L   +N        +TPT  G   V V   G+PI  SP+ V     ++  +      E    +    ++ +D +        +    L+P  R  V     P   R N    F P EE +Y V  T +           E   P     V A+G GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP +PG Y VN+L+ + HI  SPF   I           D +KV A GPGL    V +        +       G G +     +    ++  ++ NN DGTY+ +Y P   G + + + Y G  V   P  V V    D SRI+ +GPG+E  +   +    FTVD   L   G   +   I  P+ A  +CF  DN DGT  V+Y P + G + V + +++  IP SPF V + +    S+V+  GPGL+      FT  P+ FTV    AG   L + V   +   +        +  G     YIP   G+ ++ + Y    +PGSPF   V +  +P KV + G G+    G  +  +V   FT+++  AG + LE+ V GP      ++V ++GDGT T  Y     G Y V V Y ++ +P SPF V V       +    GP L+   VP    V   ++ ++AG+G+L+ +     G      + + + G   V+Y+P K G Y + + +  ++IP    R  A Q              T + SK +       S V     VG V D        V   V  P   +    +I N DGT  + Y  ++ G + + V + G  I  SPF   V  ++ +P   +     GL +   D+   F +       G ++  V  PS   A  + +DNK+GT  V Y P   G + + IK+M  HI  SP    +   P   S    G          T+   +   +     L+  +  P+  E SC   +  +G   +++ P   G++ + V  + +HIP SPF   + ++     S+VKL               F++D        L+ SI+ PS  +  C      +NH G   +++ P E G +++++K   ++V  SP ++      IG    + +  R L      E+S       ++    GY     + +V  PS      E   L D    + + P   GV+ VS K  + HV GSPF   +      G  K  I  +     +A   +     +   E  +  +S  +  PS    +AEI     K+  C V +   E G +  S+K+  +HV GSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     N    V ++  E G + V +  N+  IP SP+ V      +       +    +G ++N+   F    N   G +   +  PS     C  +E     Y   ++P+  G +TI +K+ G +H++GSPF V +       N                          P  V   G GL+    G ++EF ++   AG   L V + GP +    C+E          ++V Y     G +L+ V++G  NH V GSPF+  V
Sbjct:   13 LCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQV-GEACNPNACR--ASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGK-APLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTF-TVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAG-KAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQG-KLDVTILSP-SRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADI-------EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEA-----GPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLK----EAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKIN----CRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL----GSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQ--------------TGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPVSDMN----GLGFKPFDLVIPFAVRK-----GEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYV-NYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNK--DGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSR-RCSQVKL----------GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIG---ISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDF----IVDTRDAGYG--GISLAVEGPSKVDIQTE--DLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKIS---GEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEI-VPMGKNSHC-VRFVPQEMGVHTVSVKYRGQHVTGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNG-SHVVGSPFKVRVGEPGQAGN--------------------------PALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQET------PEGYKVMYTPMAPGNYLISVKYGGPNHIV-GSPFKAKV 2278          
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1331.62 bits (3445), Expect = 0.000e+0
Identity = 865/2332 (37.09%), Postives = 1257/2332 (53.90%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP----YKESKIKAFGPGL--TGGIVSKPAFFEVETN--GETGALGFSIKGPSEA-KIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPST-----VKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS----VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQET--NNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVI-----DTATKSVK-PAQILP---KSTP--------------------GLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSV------------VDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX---------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGST-----QKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G++ + V +P+G K   E+         Y C Y P   G + + I FA   IP SPF V V  A  +P+   ASG G++P G  +   T F V T  AG G +   +   KG ++ VK K     +  +  EY     G +S+ + + G  I  SPF V V  +   +  ++  A G G+   G  V   A+F V +  +    LG  + GP ++  +   +    C  +  Y P+ PG Y V I   +  I  SP+   + P    Y    ++A+GPGL  +G IV+  A F V+    G+     F+  G  +   I   +  DG+   +Y P    ++ + ++    NIP SPY   I   +    P KV  +GPG+  SG+  N+P  F V+   AG           A       + +   I  N + T++ +Y P   G++T+ V + +  IP SPF+V V  + +A+ +K  GPG+ +A  +    T+F V  K AG   + +     +  + ++D+ ++  DN D + T+KYTP   G    + + +    IP+SPF V + +  D  K K+N L N   +G+  EF + T   G + + ++ + SP+   VP  +          A F P   G + V V   G+P+  SPY V A+   D    K + P  E  L+   A++ ID K      + +      P E + ++   N +   S ++ P +   Y V    E         KA++  P     V A G GL  G         +D +E  P  LG+    +   +A++   +N DGT +V Y+P   G Y + + Y  E +   P  V + P         D +++  +GPG+    VF+++ + FTV+++P+   G   +KA I NP    + C V +N DGTY   Y+P   G H +++TYD VP+  SP+ V V +G  PSR++A GPGL+E  T +P  FTV   GAG GGLG+++EGP++++I C DNKDG+CS +Y+P  PG YDV+I +   HIPGSPF VP+ D+VD SKVK  GPGL  +G R      FTVD+SKAG APL+V V+     DT ++S + P + L    K  P                    G   VTY P   G   + V Y + ++P SPF   VL + +  KV  +G G+  +    +   +P  F I+ RDAGE  L + +T    +     V ++ DGT+   Y  D  G Y + V YG  ++P SP+ +         +C   GP I + V  G+ V   V+ + AG G ++   + P G      +     G   + Y   K G Y + + F   +IPN      A    E  ++E    +      +P +  E  V             D   P       +   V+ PS +   P +++N DGT+TV+Y P+E GLHE+ + Y G  I  SP +FYV+    SG V+AYGPGL YG  +  A FTIVT+DAG GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY I +K+ DKHI GSPFTAKI  + ++ SQ+ +G+ +D  L ISETD+++L A + +P+GR+E C LKRL N ++GISF P+EVGEHLV++ ++G H+ NSP  I V ++EIG+A R K+YG GL++G   E   F+VDTR+AGYGG+SL++EGPSKV+I+  D  DGTC V+Y PT PG YI++ K+AD +VPGSPF V I G     + E I R   A  V+ +G++C+LNL IP  N  + +A V SPSG     EI+ +  N   +RF+P+E+GVHTVSVK   +HVTGSPFQFTVGPL +GG HKV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F D+K+GSCGV+Y   EPG+Y  SIKFNDEH+P SP+++            PV   +   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +S+++ ++Y+V F+P ENG+H + V  N S + GSPF+V V           V+  G G+  G TG  +EFF++T+ AG G L+VTI+GPSKV+++CQE   GY   Y P APG+Y IS+KYGG NHI+GSPF   ++G    S  S  ET S L ++V   S  T      K  S    V  +G GL  A +G+++ F+VD   AG ++L +GV GP  PCEEV++KH+GN ++ V Y V+E+G ++L V+WG   +PGSPF + VP
Sbjct:  353 DASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC-NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQK--DFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPE---AGMQKVRAWGPGLH--GGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSC--DVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSH---PQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDII--DNYDYSHTVKYTPTQQGNMQVL-VTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEG--PCE-AKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAV-------DTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL-GSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRADDTDSQSWRSPLKALSEFFKGDPKGDFNKTGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG---VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATD-GEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYP-NSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISG--EGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLV------------PVIAPS---DDARRLTVMSLQESGLKVNQPASFAIRLNG-AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP 2633          

HSP 2 Score: 1052.74 bits (2721), Expect = 0.000e+0
Identity = 850/2635 (32.26%), Postives = 1247/2635 (47.32%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK-ESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPI---GQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE--EGITKQPQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFT--PSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVN-------------------------------LDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE--YSVVDFKFPVGPVFDY-------VRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVD----STIPSGQVTAYGPGLSYGRP-----------DMHAH----FTIVTKDA-GAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVG---------TTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAV-----NIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDAN--QFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRX---XXXXXXXXXXXIHHGHTG-RINE--FFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWG--NHDVPGSPFEIVV 7621
            + E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    +R  H+RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGL+WTLILHYSI+MP+WE    ++ D   K  +PKQRLLGWI +K+P+ P+ NF  +W DG A+GALVD+CAPGLCP+W  WDP++ + NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +  PA FTVDT +AG+G++ + V +P+G KE  ++    +K   YS  Y+P + G +++ + FA   I  SPF+V+V  A GD SKVTA GPG+E VGN   + T+F+++TA AG G +   + D +G K++V+  +  +    +   Y   + G H V +FFAG  I  SPF V V  +  N +A +  A+GRG+QP+GVR+R+  +F+V T+ AG  +LGV + GP    E  + K     +Y   Y P  PG Y + I +G + I  SPF V V P     K++A+GPGL GGIV + A F VE+ G E G+LGF+I+GPS+AKI+  D  DGS +V YWP  PGEYAVHI+CDDE+I  SPYMA I   T  ++P  V AYGPGL  SG   N  A+F V+ K+AG  + +K    D  GQ I +Q+++  DGTY+C YTP    KHT+ V +G VNIP SP++VN+ +  +   +KV+GPG+ER+  K N  T+F VDC  AG GD+ +       VL E   DV      N + TF            YTI++ F+  EIP SPF+V ++  +D  K K      +      G+   F + T   G K    +   SP        L   +N        +TPT  G   V V   G+PI  SP+ V     ++  +      E    +    ++ +D +        +    L+P  R  V     P   R N    F P EE +Y V  T +           E   P     V A+G GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP +PG Y VN+L+ + HI  SPF   I           D +KV A GPGL    V +        +       G G +     +    ++  ++ NN DGTY+ +Y P   G + + + Y G  V   P  V V    D SRI+ +GPG+E  +   +    FTVD   L   G   +   I  P+ A  +CF  DN DGT  V+Y P + G + V + +++  IP SPF V + +    S+V+  GPGL+      FT  P+ FTV    AG   L + V   +   +        +  G     YIP   G+ ++ + Y    +PGSPF   V +  +P KV + G G+    G  +  +V   FT+++  AG + LE+ V GP  +  +                               ++V ++GDGT T  Y     G Y V V Y ++ +P SPF V V       +    GP L+   VP    V   ++ ++AG+G+L+ +     G      + + + G   V+Y+P K G Y + + +  ++IP    R  A Q              T + SK +       S V     VG V D        V   V  P   +    +I N DGT  + Y  ++ G + + V + G  I  SPF         + +    V A  PG    RP           DM+      F +V   A   G ++  V  PS   A  + +DNK+GT  V Y P   G + + IK+M  HI  SP    +   P   S    G          T+   +   +     L+  +  P+  E SC   +  +G   +++ P   G++ + V  + +HIP SPF   + ++     S+VKL               F++D        L+ SI+ PS  +  C      +NH G   +++ P E G +++++K   ++V  SP ++      IG    + +  R L      E+S       ++    GY     + +V  PS      E   L D    + + P   GV+ VS K  + HV GSPF   +      G  K  I  +     +A   +     +   E  +  +S  +  PS    +AEI     K+  C V +   E G +  S+K+  +HV GSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     N    V ++  E G + V +  N+  IP SP+ V      +       +    +G ++N+   F    N   G +   +  PS     C  +E     Y   ++P+  G +TI +K+ G +H++GSPF V +       N                          P  V   G GL+    G ++EF ++   AG   L V + GP +    C+E          ++V Y     G +L+ V++G  NH V GSPF+  V
Sbjct:    3 VTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQV-GEACNPNACR--ASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGK-APLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTF-TVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAG-KAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQG-KLDVTILSP-SRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADI-------EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEA-----GPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLK----EAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKIN----CRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL----GSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRADDTDSQSWRSPLKALSEFFKGDPKGDFNKTGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQ--------------TGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGF---RPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYV-NYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNK--DGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDS-RRCSQVKL----------GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIG---ISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDF----IVDTRDAGYG--GISLAVEGPSKVDIQTE--DLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKIS---GEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEI-VPMGKNSHC-VRFVPQEMGVHTVSVKYRGQHVTGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNG-SHVVGSPFKVRVGEPGQAGN--------------------------PALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQET------PEGYKVMYTPMAPGNYLISVKYGGPNHIV-GSPFKAKV 2502          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 489/1511 (32.36%), Postives = 764/1511 (50.56%), Query Frame = 2
Query: 3251 ANTPASFIIDSTEEPPAPLGVTIEGPM--EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKF----NEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEI--EVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVR------------PHRGHLIANKVPSLFTINTRDAGE-SDLELMVTGPN-NESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSE-------AKPEQCYIEGPILNEVPVGKTVTIPVNTQNA----GDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPV---GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKI-DNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX--------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSN----------DSIRET-KSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +  P  F ID+T+  P  + V +         +D +DN DG+ +V Y  + PG+Y +NV++  E I  SP  + + P+        DV+ +     GL    +   S  + T+N   ++   KG+   +I     +R    +  N DGTYS        G+HK+ + +D +PV ++   V V +G+D ++ +AYGPGLE+ +  +   F +DL+GAG+G L + + GPA A+ +  D  +G CSV+Y+ + PG Y+++IKF     ++H+ GSPF   +    D S++     GL++   R+  P  F +D SK  + P+K  V  +    ++P      S P   +V ++P    N  I  E++Y+ +++     +  VL   EP+ + +  +  +             H GH     VP     + RD G    +E  V GP+  E +N       +G +   +  D+ G Y V      + V      VPV +E          E+      I    P   T   P++ +         +L+AK        +   ++N       + +   K+G   + + +  E++ +           E+   ER       E        +Y    F+F V   G     + A+V  P+ +K+V  +I+N DGTI V+Y P   G HEL +  NG  + G+P KFYVD+    G  T YGPGL        A FT+  K + A  LS+++EGP+K++I+  DNK+GTC  +++P  PG+Y + +K   K +  SPF   + GE +KRS + VG+TS+V L I++ ++  ++A + SP G EE C ++ L  G LG+SFTP+E GEHL+ V R G+ +P +PFKI V + ++G+AS+V++ G G   G+  +  + +VDT  AGYGGLS+S++GPSK E+ C +   G   V Y PTEPG Y I +K+AD +V  SP  V   G  +  + + I +  +   +        L L +   +  + TA ++ P G  +  E+  L    + ++F PK  G+HT+SV   + HV GSPFQFTVG   +GG HKV   G GV RG     N F IY REAG G++++ IEGPSKA ++F+D+ DG+C V Y+V  PG+YV ++KFND+H+P SPF +         Y  P   E       R + +A    QG   G    F +  H    G + A V++P+N+     I  I D   Y++ FVP E G H +HV ++ +P+  SPFR+ V          ++ SG+G+  G TG+  EF ++T+NAG G LTV +DGPSK  L+  E E GY   Y P APG Y  S+KY G  H  GSPF + + G     N          D++ +T K     V    G   K       V  +G GL     G+   F +D GLAG ++L VGV     PCEEV ++H G+  +  +Y + ++ +  + +++G+ ++PGSPF I
Sbjct:  754 SKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNV-------DVSGIRV--EGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITI--SGLDQPNYRLNQPINFVIDTSKTKDLPVKATV-PSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGH-----VP----FDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAAR---VPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYK---FQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA-YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKV---------YIAPATGE------VRKLELAQFHGQGIPAGKAFTFTVLTH-RAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAK-------VTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2204          

HSP 2 Score: 456.062 bits (1172), Expect = 2.458e-129
Identity = 357/1116 (31.99%), Postives = 535/1116 (47.94%), Query Frame = 2
Query:  191 EDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIK------FANSEIPNSPFKVNVKNAAG--DPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDS-VKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHT----EDAGFADLGVNVYGP--GRSLEKCQIKKVSPCLYECSYIP-QRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDP--LKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE-TYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLY----NDEHIKDSPFNVTI 3469
            +DA+WK+IQ+NTFTRW   HL+ +   I+ L+ D +DGLKLI L Q LS  N    +K+  FR+QKLENV++ L F +  E ++++NIDS+ I D   KLILGL+WTLILHYSI+M  W  E   ++DG  K  +PKQ+LL WI +++P  P+ NFT+DWNDG A+GALV++ APG   +W  W P  AL+N ++A+ +A++ L VAPLI P EMI+P++DE ++MTYLSQFP  +     P +  T S   +            + +P  F +     G     + + +  GQ     +    +KE AY   + PT  G   + +       F    IP +     V   A   D +K             +VG    F V  A  GP  V+ +++D  G++   V    T   E+ F  EY     GLHSVNVF   + +  SPF +    K S          GRGI PEG+R  DV    V +    E+   A++ + V  P  G  L             +  Y P Q P    V +K     I      + VAP   SKI+AFG GL GGIV++P  F+VE NGE+  L F+++GPS+A+I C +  DGSA ++Y PTV G Y V +L D ++I  SP++ ++    +   P   +VT      +  +    P  F V+T+  G     K E  D     I    R+   G +     P  P KH + VS   V++P +PF V V E  +A+ +K++GPG++    + E T F +D   AG G + +++ D++  +V +   DN DG+FT+KYT +  G      +F  E EI  SP ++ ++ + D    ++  L         NE  ++    GS +RP I +         ++L +  NG                V  K NP G                   T+TPL+   ++ +    +++  IPV+ A +  ++ ++V      NK +                            AYG GL + V    A F +D        L + + GP +A+    D G+G CSV Y+ K PG Y + + +      EH+K SPF   +
Sbjct:   20 DDAEWKIIQQNTFTRWVKNHLQKAGETIESLETDFSDGLKLIALAQVLSHKNVGKFNKKVAFRSQKLENVSLALNFFQNEENIKIINIDSTHIVDHNKKLILGLVWTLILHYSISMG-WIQE--KREDGDNKEETPKQKLLNWIRNRLPGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATKPIIMKPKVQATISNLDKIL---------QVNDPREFDLKLSRDG-FKPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGFIHVDVAANDVHTFETQTIPEASVICQVVPIARLLDYNKTA-----------KVGDDVKFAVVDAIEGP--VEAIVVDPTGKEHRMVILDGTSPGEHSF--EYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK------VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVI--ESHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIP--FRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGE-EI--SPIEINVKPNVDVSGIRVEGLE--------NENLLI----GSHLRPTINIGKLEPKSKGLQLIDEVNG------------KRYNVPMKINPDGTY----------------STDTPLMEVGEHKL-QLLFDE--IPVKEAVVEVIKGTDV------NKCK----------------------------AYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVV 1017          

HSP 3 Score: 275.789 bits (704), Expect = 9.063e-74
Identity = 327/1356 (24.12%), Postives = 578/1356 (42.63%), Query Frame = 2
Query: 3809 SRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA---GEA-PLKVNVIDTATKSVKPAQIL-----PKS------TPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNT---QNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHY-TTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFY----NGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSK-AEIQCIDNKNGT----CDVSYLPLAPGDYHIGIKF------MDKHIIG-----SPFTAKIFGEPKKRSQICVGTTSD------VPLRISET-DINNLNAIVISPTGREESCTLKRL-QNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGD--GLNDGMVNETCQF-----------------VVDTRNAGYGGLSLSIEGPSKVEIE-----CHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSL-TER---ILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPF-MLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX--------XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            S+IRA+G GLE GI  +P  F V++ G  +  L  ++EGP+ A+I C +  DG+  + Y P   G Y V +  + KHI  SPF + + + ++         GL+ + +RV       +D SK    GE  P +V+        V   +IL     P S      TPGLF+ T IP+     +I+V    + VPG+PF   V    +  K+ + G GV       + +K P+ FTI+   AG   +E+ +     E+V+LDV ++ DG+FT +Y    PG Y + V++  + +  SP  + V          +EG     + +G  +   +N    +    G+     V      VP  I  +  G  +      ++G +++QL+F++  IP   +++   +  +   + +   +    EQ+   +  E +V +     G     +   +  P+  +   R+ + G+G  +V+Y     G +E+ + +      + + GSPFK  VD      Q+T  G      R +   +F I T  +    L +    PS  A++Q + +++ +     +V ++P    +  I I+       +D+ ++       P   KI  + KK S      T++      VP  + +  ++  + + V  P G+E    ++   QNG   +SF     GE+ V    +G+ +                A+RV +  +  G  + ++ E   F                 +   +   +  + +    P  V +E       + H     + +  T+ GT  ++V Y   +V    +   IG      +  ER   ++  +D  +  +     + N+   GY  ++  A V+ P+   E+ EII   D    +++ PK  G H +S+  +   + G+P +F V    DG      + G G++  +  +   FT+  + + A  LS++IEGP+K++I   DNKDG+C   +    PG+Y   +K   + V  SPF +L + E    S+                           ++GS +   +         ISA + SP   E+   +  +D  +  V F P E G H + V  +   +P +PF++           +V VSG G   G T + NE  VDTS AG G L+V++ GPSK +L C+E +SG     Y P  PG Y I+IK+  ++H+  SP  V  +G            KS  + +  I    QK      +V+  G  L   E    + F+     +  D+    +  P    +++ ++ LG   +Q+ +  + +G H L V + +  V GSPF+  V
Sbjct:  547 SKIRAFGAGLEGGIVNEPCVFDVEMNGESKD-LSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIE---------GLKPSATRVTG-----IDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV----DGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPD--GTYSTDTPLMEVGEHKLQLLFDE--IP---VKEAVVEVIKGTDVNKCKAYGPGLEQA---VVGEKAVFELDLD-GAGEGALSMEMRGPAKAES--RIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDT--SKTKDLPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV----------------AARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEA-IGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGW---ATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSH--------------------------LSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG------------KSAGRVIQTI----QK------DVEQHGICLPDQE---SHLFLKLLNTSPMDIT-ARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTV 1793          

HSP 4 Score: 210.69 bits (535), Expect = 6.120e-54
Identity = 223/883 (25.25%), Postives = 379/883 (42.92%), Query Frame = 2
Query: 1964 DCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTG-QTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNG-----------DGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDN--DFKKYKINNLNNTTPIG-QLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPY----------KVIATDRVNTKEY----PETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQ--RSNFEPNEEIIYPVQRTNEKAELR---------------KPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDG-TYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIH-----------------DIV----------------DVSKVKCYGPGLERNGSRVF--TPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTY-IPENIGNCEIEVLYNNMQVPGSPF 4354
            + +DN DG+  V Y P V G + + IL +   +  +P    I+     +     T YGPGL + +   +PA F V  K     S  K     + G     ++I DN DGT S  + P +PG++ V V  G   + +SPF+V V+           G G +R+  ++            + ++ + +  ++++ +       G           DG              + I +      +P++PFK+ ++     D  K +++       I  Q NE  + T   G      + V+ P  S+  +  +E  +G +   +TPT  G + + ++   + + +SP           +VI T + + +++    P+ E+ L +        K  N   + + +  + P   ++     +  +Q  +  F P  E I+ +    + A +                   V A G+G+V+G   T  +F I   E     + VTIEGP +A +++ D+ DG C V+Y    PG Y+V V +ND+HI DSPF V I P T     +  +     +G G+ P G    +F+ FTV    +    KG ++A +  P N+  T  +    DG +Y+  + P   G H I +T DG P+ +SP+ + V      DP+ I A G GL +G T Q  +F ++   AG G L + ++GP+ A +  ++ + G   V+Y P  PGSY  S+K+N  H PGSPF +P+                  D V                D +KV   G GL    ++ F   P+ F +D   AG   L V V+   TK      ++     G +  +Y IP+ +    + + Y + ++PGSPF
Sbjct: 1381 EIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTP----IKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKG----SQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVM-----------GEGQKRSHLSV----------GSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGL-SVSVQGP--SKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFL--------KLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPAT---GEVRKLELAQFHGQGI-PAG---KAFT-FTV----LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGL----NKFFPGRPAAFQIDTGLAGTNLLMVGVV--TTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGF-VFIKYGDKEIPGSPF 2202          

HSP 5 Score: 203.371 bits (516), Expect = 8.983e-52
Identity = 234/854 (27.40%), Postives = 345/854 (40.40%), Query Frame = 2
Query: 3218 TAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----GEAPLKVNVIDTATKSVKPAQILPKSTPG----------LFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCE--PEKVIVTGEG-VRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPF---IVPVHSEA-KPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGP-----VGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQ-PSESGL--HELE------------------VFYNGQPITGSPFKFYVD----------------------------STIP-----SGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAV---EGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT 5524
            T YG GL   V   PA+F + +       L V+IEGP +++I   DN DGTCS  ++P  PG Y V+V    + +KDSPF V +  + +  S++                     S    +  A PI       + A I +P      C V     G    S++P   G+H I +  DG  V K+P+ + V   Q  D S++   G G  +GIT Q  +  VD   AG GGL +S++GP+ A++ C + K G   V Y P +PG Y ++IKF + H+  SP T           V+C G    ++  RV    Q  V+         E+ L + +++T+   +    + PK               + + + P+  G   + V+Y +  V GSPF   V +  E    KV   G+G VR   G   A      F I  R+AG   + + + GP+  +  L+  +H DG     YK   PG Y V V + ++++P SPF   I P   E  K E     G     +P GK  T  V T  A  G L AK V P       +IVP   + E Y    + +VP++ G + + +  +        +R+  F+ +              +   P   T  S        G        V+N            N G G +TVQ   PS++ L  +ELE                  V YNG    GSPFK  V+                            + +P     + +VTA G GL+   P   A F I T  AG   L + V   +GP + E+      +G    SY         + IK+ DK I GSPF 
Sbjct: 1431 TVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHL---------------------SVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLT-----------VQCTG----KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNA------FNIYHREAGVGAVAVTIEGPSKAT--LEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIE-DGESYA---MRFVPKETGNHFIHVTLD-----GAPMRESPFRLRVG----------GKDLCDP---TAISASGDGLVKGTTGQKCEFVINTA----------NAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFA 2203          

HSP 6 Score: 169.474 bits (428), Expect = 2.211e-41
Identity = 331/1505 (21.99%), Postives = 569/1505 (37.81%), Query Frame = 2
Query: 3350 IDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPF-NQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP----QKFTVD-LEGAGQGGLGLSIEGPADAQ----IQCFDNKDGTCSVQYLP-QKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNV---LNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDL--ELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYI-----EGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENI--------PNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKF----MDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISE-----TDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNA----------SRVKLYGDGLNDGM--------VNETCQFVVDTRNAG-YGGLSLSIEGPSKVEIECH---DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGS-PFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTA--SVISPSGSFEMCEIIALSDNQF----SIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPL----IDGGPHKVHIMGS-GVERGLANDANQFTIYTREAGAGSLSIAIEGPS-KAEI-DFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQ---YSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNC-----QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +++ +    V + P + G   V+V  ND H     F     P+      +  +A++  Y    N T    D      V+A       +G V+AI+ +P   +     +D    G +S  Y     G H +++ +  +P+  SP+ +   +G   +  + +G G+  EGI K         ++D  E      + L +  P+D         ++++  +   +Y P Q P   +V +K   + I      V        SK++ +G GLE  G  V  P  F V+ +  GE+      ++  +K+    Q  P  +  L   +Y P   G  ++ VL +   +  SPFV  V   +   +P    VT  G+   + + +  K+P  F ++TR  G  DL  ++ +  P    ++        G F      D P  + + V     +VPG+PF V V       +  I     +GP+ ++ P   T    ++   AG G +        G  V   + + + G  TV Y  Q+ GAY++ ++F  E I        PN  +     +  E  ++   +H          +R   ++   +    P    ++ +      R +VP  IN  DGT +      E G H+L++ ++  P+  +  +    + +   +  AYGPGL        A F +    AG G LS+ + GP+KAE +  D  NG C V Y+  APGDY + IKF      +H+ GSPF A +    K  SQI +        R+++      D +    + +  T   +   L+ +      +S +P     H V  + SG+   + P +I     +I               +K+  D   D +         +       D R+ G    +   + GP   E   H      +G   V++     G Y +        V    P      G     + E I+ H + AE S    V   N  I    ++   A   + +   +  +  I  L DN       I F   +LG +T+ V     HV    ++  +G L    I     KV +     V++       QF +         L   +  P+ K E+ +  DN DG+  V Y     G +  SI  N   + G+P    +D                 + D  + ++     Q   +G  A F +   G     +S  +  P+ K Q+    KI +N+    S  +VP   G + VHV +    +  SPFRV+V           H   G  +E  +  +      ++ +I  P  ++  C          G +FT  P   G++ I++K  G   +  +PF + +                           TQ G +    V+  G G       + NE +VD   AG   L V V GP +   E+  K + +   +V Y   E G + + +++ +H V  SP  +
Sbjct:  309 VEDKENAYKVKFTPTKIGFIHVDVAANDVHT----FETQTIPEASVICQVVPIARLLDY----NKTAKVGDDVKFAVVDAI------EGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPL---RGKPKNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLE--GGIVNEPCVFDVEMN--GESKDLSFAVEGPSKAEIGCQERPDGSAIL---SYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVT--GIDESKVYNVGEKIP--FRVDTRLCG-VDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFT----IDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEISPIEINVKPNVDVSGIRVEGLENENLLIGSH----------LRPTINIGKLE----PKSKGLQLIDEVNGKRYNVPMKINP-DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDV--NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLPVKATVPSDFAQLQPV------VSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSP--TVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE-AIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA----------------YGDG-WATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPA-KSQI----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRS---HLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFT--PREAGEHLITVKRDG-KLVPKAPFKIKVD-------------------------KTQVGDAS--KVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKA--ELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTV 1693          

HSP 7 Score: 135.961 bits (341), Expect = 2.834e-31
Identity = 130/546 (23.81%), Postives = 238/546 (43.59%), Query Frame = 2
Query:  926 KTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNV-KNAAGDPSKVTASG----PGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIE--YTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDV-AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES---KIKAFGPGLTGGIVSKPAFFEV-ETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDG-TYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            K +  RV   G G +    ++G+ +   +         +   + +P G +EPC +       L    S+ P   GE+ I +K     +P +PFK+ V K   GD SKV  SG     GI    NE        V T++AG G +   +      +   K ++T +     LI+  YT  E G++++ + FA   ++ SP  V  + K++    +      + ++  G+ + D  +   +   +    D+   +  P    +  +++ +    Y+  + P+  G + + + Y +  ++ SPF   V  + E    K++A G G+  G       F +       GA+  +I+GPS+A ++  D+ DG+ +V Y    PGEY V +  +D++IP SP+   I   T     L++  +      GI   K   F V T  A     ++A+      +   + I    DG +Y+ R+ PK  G H + V+     + ESPF++ V   +  +   I   G G+ +  T  +  FV++   AG+G + + +
Sbjct: 1506 KDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLG--VSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE------LLVDTSKAGYGGLSVSV------QGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSA---GRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA--KGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQM 2029          

HSP 8 Score: 132.88 bits (333), Expect = 2.244e-30
Identity = 196/870 (22.53%), Postives = 328/870 (37.70%), Query Frame = 2
Query: 1304 FNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVE---TNGETGALGFSIKGPSEAKIDCVDN--GDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLD-TKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAG---------SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI---ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPYKVI---ATDRVNTKEYPE------------TETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNF--------EPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTI---------YPDTKSSSNID------------------DVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSY 3706
            FNV      P  ++ +++    +K+  +  I    +   L++YT K  G H +++   G Q+Q +P    V +          +AT  G   +   V + A F V  + +   +L V++ GP +S  K    K   C    +++P  PG Y V +K G   +  SPF V V           G G     +S  +  EV    T  E   +  SIK P   +  C       G   V++ P   GE+ + +  D + +PK+P+  +I++D T++ D  KV   G G   GI T +  + +V+T  AG          PS  +  C +V              G     YTP  PG + + + + + ++ +SP  V          I+     +E+    +   E++  +        DI   ++D K     +   D G   +            +T+ + + +A +  SPF+  + S ++   +K+         G+   F     +        + V     S+  ++ ++ N+G     +     G + V V+     I +SP+KV    AT  V   E  +            T T L   A   ++ K    P+  V +  + P+E           K+  N          P  E  + + R   K       ++A G+GLVKG       F+I++       L V ++GP +A +D  +   G   V Y P  PGSY  +V YN  H   SPF + +         Y +T S   ID                  D AKVTA G GLN    F    + F ++       G  ++   +           V +   G Y CSY
Sbjct: 1354 FNVRDLGYQPKDLEAIVMPPTQKKEVAE--IIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD------GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTC--SAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----------MGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPF--KIKVDKTQVGDASKVEVSGSGKAKGI-TLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEV------------KSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQ-QYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVT-PNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRL-RVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNET-SHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNK--FFPGRPAAFQIDT---GLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSY 2178          

HSP 9 Score: 123.25 bits (308), Expect = 2.038e-27
Identity = 201/876 (22.95%), Postives = 346/876 (39.50%), Query Frame = 2
Query:  953 YGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVD--CVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG--------------------ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFD---PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTG-QTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA-GNAANIKV---YGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINN-----LNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLG---VTIEGPM-EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNV 3463
            YGPGL+     +G PA FTV    +    L + +  P   K   +I D  NK+   S +++P + GEY++ +K     + +SPF+V V       S ++        V   + ++    +  +   PG ++  C +    G               +  + +T +E G H + V   G  +  +PF + V  KT   DA +   +G G + +G+ ++   E  V T  AG+  L V+V GP ++   C  K+V   L +  Y P  PG Y + IK+ ++ +  SP  V               G + G V +    +VE +G                    +  A     KG ++  I+  D G     + + P + G + + ++  D ++  SP+    Q     F      KV A G G++ G  T     F +  + AG    V A    + G     ++ +D+NDG     Y    PG++ V V + + +IP+SPFKV +  A G    +++   +G GI   K    T+ V+  +  G  +  +   + ++  + +V  +  DG              + I +    A + +SPF++ +   +      I+      +  TT  GQ  EF I T   G+ +   + V+    S+  +   E   G+   +TP   G +  +V+  G     SP+K+     V  KE               +    YN+ S      K+  V +++  T +               + P  + +         VTA G GL K     PA+F ID+       L    VT +GP  E  + +  +G   CS     +  G   V + Y D+ I  SPF +
Sbjct: 1433 YGPGLQ--NAVVGEPATFTVCAKGSQAKELSVSIEGP--AKSQIKIHD--NKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG--STSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDG--------------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKV-DKTQVGDASKVEVSGSG-KAKGITLQ-ANELLVDTSKAGYGGLSVSVQGPSKAELTC--KEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCT------------GKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTD-DIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPF----QFTVGSFSEGGAHKVRAAGQGVVRG-ETGTFNAFNIYHREAG----VGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAF--TFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIE--DGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTT--GQKCEFVINTANAGAGI---LTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKI----PVEGKE---------------LGGNGYNETS----HVKIDAVAKTSKGTVA---------------VVPEYQGD------AAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKG--FVFIKYGDKEIPGSPFAI 2204          

HSP 10 Score: 106.301 bits (264), Expect = 3.335e-22
Identity = 90/370 (24.32%), Postives = 162/370 (43.78%), Query Frame = 2
Query: 1424 IEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGF--ADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            I +T  + G ++++VF+ G  +    +  +   +     A++A       + +  +     +FQ +  D G+   DL   V  P +  E  +I           Y P+  G + + I      +  +P    V  Y +     +GPGL   +V +PA F V   G +   L  SI+GP++++I   DN DG+ +  + P VPGEY VH+    + +  SP+   +  + +    L V           ST++ A  I   +  G  +++K+      G   P  +R  + G     +TP+  G+H + V      +P++PFK+ V   + G+A+ ++V G G  +  T      +VD   AG G + +SV
Sbjct: 1291 IVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEK-EDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG----------STSEVALPITQQELKGISASIKSPG----GIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSV 1645          

HSP 11 Score: 103.605 bits (257), Expect = 1.932e-21
Identity = 125/476 (26.26%), Postives = 198/476 (41.60%), Query Frame = 2
Query:  986 IGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSC----------SYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIE-PVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES-----------KIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILC----DDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGIST-----NKPADFIVNT-KNAGSPSTVKAECFDVTGQTIPVQIRD-NNDGTYSCRYTP 2311
            +G   PF VDT   G      + L PK      EI D     ++Y            + IP    +++I +  A   +P +PF V VK    D SK+   GPG++ PV ++    T F +   +AGPG+V+  + D +G  ++V   +    +  F ++YT +  G + +NV FAG +I  SP  + V      S               G+RV  +    +         + +    P +S     I +V+   Y         G Y  D        H      D  P KE+           K KA+GPGL   +V + A FE++ +G   GAL   ++GP++A+    D G+G  +V Y    PG+Y + I        E++  SP+ A +       DP ++T      ISG+       N+P +F+++T K    P  VKA       Q  PV  R  +N   ++ R+ P
Sbjct:  657 VGEKIPFRVDTRLCG------VDLVPK-----VEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPT-DASKLKIFGPGVDGPVYSK--EPTRFTIDATQAGPGAVEVALRDDQG--ENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVS---------------GIRVEGLENENLLIGSHLRPTINIGKLEP-KSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK---DPSQIT------ISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRSPSNPRHHNVRFVP 1087          

HSP 12 Score: 73.9442 bits (180), Expect = 1.947e-12
Identity = 111/492 (22.56%), Postives = 215/492 (43.70%), Query Frame = 2
Query:  929 TNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNE---VGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNP----IHLSPFNVDVAPYKE--SKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSE-AKIDCVDNGDGS----ANVTYWP------TVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDN-NDGTYSCRYTPKIPGKHTVI 2338
            T++ +++ +GPG++    +   P  FT+D   AG G +++ + + +G+    ++ D  N++ +++  Y     G Y++ + FA  EI  SP ++NVK        V  SG  +E + NE   +G      +   +  P S    ++D   G++ +V  KI    +  +  +    E G H + + F  + ++ +   V+       +D  +  A G G+  E   V + A F++  + AG   L + + GP ++  + Q +    C  E  Y+ + PG Y + IK+G +     +  SPF   V  YK+  S+I   G       +++P  F ++T+ +T  L      PS+ A++  V +   S     NV + P      ++P E     L  DE + K     + QL   L D  K +     + +  S      F  + ++ G+   +++  F   G+     +R    +G Y   +   + G++ V+
Sbjct:  736 TDASKLKIFGPGVDGPVYS-KEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLD--NQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK------PNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKIN--PDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVI-----KGTDVNKCKAYGPGL--EQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVE--YVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTS-KTKDLPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPF--DVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVV 1201          

HSP 13 Score: 65.855 bits (159), Expect = 5.601e-10
Identity = 83/312 (26.60%), Postives = 132/312 (42.31%), Query Frame = 2
Query:  974 EGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA-AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILD--TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSK---------TSNSDAKQAYATGRGI-------QPEGVRVRDV------------AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSY-IPQRPGPYVVDIKYGNNPIHLSPFNVD 1813
            +G   G    FTV T  A KG+L+  V+ P  + +  +I    + E +Y+  ++P   G + I +    + +  SPF++ V      DP+ ++ASG G+  V    G++  F + TA AG G +  V +D  +K   D+       + E  + + YT    G +  +V + G+    SPF + V  K         TS+        T +G        Q +  +V               A FQ+ T  AG   L V V       E+  ++      Y CSY IP R   +V  IKYG+  I  SPF ++
Sbjct: 1906 QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIEDGE-SYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGL--VKGTTGQKCEFVINTANAGAG-ILTVQMDGPSKATLDAY------ELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVF-IKYGDKEIPGSPFAIE 2205          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 489/1511 (32.36%), Postives = 764/1511 (50.56%), Query Frame = 2
Query: 3251 ANTPASFIIDSTEEPPAPLGVTIEGPM--EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKF----NEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEI--EVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVR------------PHRGHLIANKVPSLFTINTRDAGE-SDLELMVTGPN-NESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSE-------AKPEQCYIEGPILNEVPVGKTVTIPVNTQNA----GDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPV---GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKI-DNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX--------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSN----------DSIRET-KSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +  P  F ID+T+  P  + V +         +D +DN DG+ +V Y  + PG+Y +NV++  E I  SP  + + P+        DV+ +     GL    +   S  + T+N   ++   KG+   +I     +R    +  N DGTYS        G+HK+ + +D +PV ++   V V +G+D ++ +AYGPGLE+ +  +   F +DL+GAG+G L + + GPA A+ +  D  +G CSV+Y+ + PG Y+++IKF     ++H+ GSPF   +    D S++     GL++   R+  P  F +D SK  + P+K  V  +    ++P      S P   +V ++P    N  I  E++Y+ +++     +  VL   EP+ + +  +  +             H GH     VP     + RD G    +E  V GP+  E +N       +G +   +  D+ G Y V      + V      VPV +E          E+      I    P   T   P++ +         +L+AK        +   ++N       + +   K+G   + + +  E++ +           E+   ER       E        +Y    F+F V   G     + A+V  P+ +K+V  +I+N DGTI V+Y P   G HEL +  NG  + G+P KFYVD+    G  T YGPGL        A FT+  K + A  LS+++EGP+K++I+  DNK+GTC  +++P  PG+Y + +K   K +  SPF   + GE +KRS + VG+TS+V L I++ ++  ++A + SP G EE C ++ L  G LG+SFTP+E GEHL+ V R G+ +P +PFKI V + ++G+AS+V++ G G   G+  +  + +VDT  AGYGGLS+S++GPSK E+ C +   G   V Y PTEPG Y I +K+AD +V  SP  V   G  +  + + I +  +   +        L L +   +  + TA ++ P G  +  E+  L    + ++F PK  G+HT+SV   + HV GSPFQFTVG   +GG HKV   G GV RG     N F IY REAG G++++ IEGPSKA ++F+D+ DG+C V Y+V  PG+YV ++KFND+H+P SPF +         Y  P   E       R + +A    QG   G    F +  H    G + A V++P+N+     I  I D   Y++ FVP E G H +HV ++ +P+  SPFR+ V          ++ SG+G+  G TG+  EF ++T+NAG G LTV +DGPSK  L+  E E GY   Y P APG Y  S+KY G  H  GSPF + + G     N          D++ +T K     V    G   K       V  +G GL     G+   F +D GLAG ++L VGV     PCEEV ++H G+  +  +Y + ++ +  + +++G+ ++PGSPF I
Sbjct:  756 SKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNV-------DVSGIRV--EGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITI--SGLDQPNYRLNQPINFVIDTSKTKDLPVKATV-PSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGH-----VP----FDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAAR---VPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYK---FQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA-YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKV---------YIAPATGE------VRKLELAQFHGQGIPAGKAFTFTVLTH-RAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAK-------VTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2206          

HSP 2 Score: 450.669 bits (1158), Expect = 1.252e-127
Identity = 357/1118 (31.93%), Postives = 535/1118 (47.85%), Query Frame = 2
Query:  191 EDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMP--HKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIK------FANSEIPNSPFKVNVKNAAG--DPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDS-VKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHT----EDAGFADLGVNVYGP--GRSLEKCQIKKVSPCLYECSYIP-QRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDP--LKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE-TYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLY----NDEHIKDSPFNVTI 3469
            +DA+WK+IQ+NTFTRW   HL+ +   I+ L+ D +DGLKLI L Q LS  N    +K+  FR+QKLENV++ L F +  E ++++NIDS+ I D   KLILGL+WTLILHYSI+M  W  E   ++DG  K  +PKQ+LL WI +++P    P+ NFT+DWNDG A+GALV++ APG   +W  W P  AL+N ++A+ +A++ L VAPLI P EMI+P++DE ++MTYLSQFP  +     P +  T S   +            + +P  F +     G     + + +  GQ     +    +KE AY   + PT  G   + +       F    IP +     V   A   D +K             +VG    F V  A  GP  V+ +++D  G++   V    T   E+ F  EY     GLHSVNVF   + +  SPF +    K S          GRGI PEG+R  DV    V +    E+   A++ + V  P  G  L             +  Y P Q P    V +K     I      + VAP   SKI+AFG GL GGIV++P  F+VE NGE+  L F+++GPS+A+I C +  DGSA ++Y PTV G Y V +L D ++I  SP++ ++    +   P   +VT      +  +    P  F V+T+  G     K E  D     I    R+   G +     P  P KH + VS   V++P +PF V V E  +A+ +K++GPG++    + E T F +D   AG G + +++ D++  +V +   DN DG+FT+KYT +  G      +F  E EI  SP ++ ++ + D    ++  L         NE  ++    GS +RP I +         ++L +  NG                V  K NP G                   T+TPL+   ++ +    +++  IPV+ A +  ++ ++V      NK +                            AYG GL + V    A F +D        L + + GP +A+    D G+G CSV Y+ K PG Y + + +      EH+K SPF   +
Sbjct:   20 DDAEWKIIQQNTFTRWVKNHLQKAGETIESLETDFSDGLKLIALAQVLSHKNVGKFNKKVAFRSQKLENVSLALNFFQNEENIKIINIDSTHIVDHNKKLILGLVWTLILHYSISMG-WIQE--KREDGDNKEETPKQKLLNWIRNRLPVSGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATKPIIMKPKVQATISNLDKIL---------QVNDPREFDLKLSRDG-FKPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGFIHVDVAANDVHTFETQTIPEASVICQVVPIARLLDYNKTA-----------KVGDDVKFAVVDAIEGP--VEAIVVDPTGKEHRMVILDGTSPGEHSF--EYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK------VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVI--ESHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIP--FRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGE-EI--SPIEINVKPNVDVSGIRVEGLE--------NENLLI----GSHLRPTINIGKLEPKSKGLQLIDEVNG------------KRYNVPMKINPDGTY----------------STDTPLMEVGEHKL-QLLFDE--IPVKEAVVEVIKGTDV------NKCK----------------------------AYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVV 1019          

HSP 3 Score: 275.018 bits (702), Expect = 1.482e-73
Identity = 327/1356 (24.12%), Postives = 578/1356 (42.63%), Query Frame = 2
Query: 3809 SRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA---GEA-PLKVNVIDTATKSVKPAQIL-----PKS------TPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNT---QNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHY-TTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFY----NGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSK-AEIQCIDNKNGT----CDVSYLPLAPGDYHIGIKF------MDKHIIG-----SPFTAKIFGEPKKRSQICVGTTSD------VPLRISET-DINNLNAIVISPTGREESCTLKRL-QNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGD--GLNDGMVNETCQF-----------------VVDTRNAGYGGLSLSIEGPSKVEIE-----CHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSL-TER---ILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPF-MLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX--------XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            S+IRA+G GLE GI  +P  F V++ G  +  L  ++EGP+ A+I C +  DG+  + Y P   G Y V +  + KHI  SPF + + + ++         GL+ + +RV       +D SK    GE  P +V+        V   +IL     P S      TPGLF+ T IP+     +I+V    + VPG+PF   V    +  K+ + G GV       + +K P+ FTI+   AG   +E+ +     E+V+LDV ++ DG+FT +Y    PG Y + V++  + +  SP  + V          +EG     + +G  +   +N    +    G+     V      VP  I  +  G  +      ++G +++QL+F++  IP   +++   +  +   + +   +    EQ+   +  E +V +     G     +   +  P+  +   R+ + G+G  +V+Y     G +E+ + +      + + GSPFK  VD      Q+T  G      R +   +F I T  +    L +    PS  A++Q + +++ +     +V ++P    +  I I+       +D+ ++       P   KI  + KK S      T++      VP  + +  ++  + + V  P G+E    ++   QNG   +SF     GE+ V    +G+ +                A+RV +  +  G  + ++ E   F                 +   +   +  + +    P  V +E       + H     + +  T+ GT  ++V Y   +V    +   IG      +  ER   ++  +D  +  +     + N+   GY  ++  A V+ P+   E+ EII   D    +++ PK  G H +S+  +   + G+P +F V    DG      + G G++  +  +   FT+  + + A  LS++IEGP+K++I   DNKDG+C   +    PG+Y   +K   + V  SPF +L + E    S+                           ++GS +   +         ISA + SP   E+   +  +D  +  V F P E G H + V  +   +P +PF++           +V VSG G   G T + NE  VDTS AG G L+V++ GPSK +L C+E +SG     Y P  PG Y I+IK+  ++H+  SP  V  +G            KS  + +  I    QK      +V+  G  L   E    + F+     +  D+    +  P    +++ ++ LG   +Q+ +  + +G H L V + +  V GSPF+  V
Sbjct:  549 SKIRAFGAGLEGGIVNEPCVFDVEMNGESKD-LSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIE---------GLKPSATRVTG-----IDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV----DGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPD--GTYSTDTPLMEVGEHKLQLLFDE--IP---VKEAVVEVIKGTDVNKCKAYGPGLEQA---VVGEKAVFELDLD-GAGEGALSMEMRGPAKAES--RIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDT--SKTKDLPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV----------------AARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEA-IGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGW---ATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSH--------------------------LSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG------------KSAGRVIQTI----QK------DVEQHGICLPDQE---SHLFLKLLNTSPMDIT-ARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTV 1795          

HSP 4 Score: 210.305 bits (534), Expect = 8.156e-54
Identity = 223/883 (25.25%), Postives = 379/883 (42.92%), Query Frame = 2
Query: 1964 DCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTG-QTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNG-----------DGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDN--DFKKYKINNLNNTTPIG-QLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPY----------KVIATDRVNTKEY----PETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQ--RSNFEPNEEIIYPVQRTNEKAELR---------------KPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDG-TYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIH-----------------DIV----------------DVSKVKCYGPGLERNGSRVF--TPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTY-IPENIGNCEIEVLYNNMQVPGSPF 4354
            + +DN DG+  V Y P V G + + IL +   +  +P    I+     +     T YGPGL + +   +PA F V  K     S  K     + G     ++I DN DGT S  + P +PG++ V V  G   + +SPF+V V+           G G +R+  ++            + ++ + +  ++++ +       G           DG              + I +      +P++PFK+ ++     D  K +++       I  Q NE  + T   G      + V+ P  S+  +  +E  +G +   +TPT  G + + ++   + + +SP           +VI T + + +++    P+ E+ L +        K  N   + + +  + P   ++     +  +Q  +  F P  E I+ +    + A +                   V A G+G+V+G   T  +F I   E     + VTIEGP +A +++ D+ DG C V+Y    PG Y+V V +ND+HI DSPF V I P T     +  +     +G G+ P G    +F+ FTV    +    KG ++A +  P N+  T  +    DG +Y+  + P   G H I +T DG P+ +SP+ + V      DP+ I A G GL +G T Q  +F ++   AG G L + ++GP+ A +  ++ + G   V+Y P  PGSY  S+K+N  H PGSPF +P+                  D V                D +KV   G GL    ++ F   P+ F +D   AG   L V V+   TK      ++     G +  +Y IP+ +    + + Y + ++PGSPF
Sbjct: 1383 EIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTP----IKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKG----SQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVM-----------GEGQKRSHLSV----------GSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGL-SVSVQGP--SKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFL--------KLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPAT---GEVRKLELAQFHGQGI-PAG---KAFT-FTV----LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGL----NKFFPGRPAAFQIDTGLAGTNLLMVGVV--TTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGF-VFIKYGDKEIPGSPF 2204          

HSP 5 Score: 202.986 bits (515), Expect = 1.218e-51
Identity = 234/854 (27.40%), Postives = 345/854 (40.40%), Query Frame = 2
Query: 3218 TAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----GEAPLKVNVIDTATKSVKPAQILPKSTPG----------LFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCE--PEKVIVTGEG-VRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPF---IVPVHSEA-KPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGP-----VGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQ-PSESGL--HELE------------------VFYNGQPITGSPFKFYVD----------------------------STIP-----SGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAV---EGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT 5524
            T YG GL   V   PA+F + +       L V+IEGP +++I   DN DGTCS  ++P  PG Y V+V    + +KDSPF V +  + +  S++                     S    +  A PI       + A I +P      C V     G    S++P   G+H I +  DG  V K+P+ + V   Q  D S++   G G  +GIT Q  +  VD   AG GGL +S++GP+ A++ C + K G   V Y P +PG Y ++IKF + H+  SP T           V+C G    ++  RV    Q  V+         E+ L + +++T+   +    + PK               + + + P+  G   + V+Y +  V GSPF   V +  E    KV   G+G VR   G   A      F I  R+AG   + + + GP+  +  L+  +H DG     YK   PG Y V V + ++++P SPF   I P   E  K E     G     +P GK  T  V T  A  G L AK V P       +IVP   + E Y    + +VP++ G + + +  +        +R+  F+ +              +   P   T  S        G        V+N            N G G +TVQ   PS++ L  +ELE                  V YNG    GSPFK  V+                            + +P     + +VTA G GL+   P   A F I T  AG   L + V   +GP + E+      +G    SY         + IK+ DK I GSPF 
Sbjct: 1433 TVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHL---------------------SVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLT-----------VQCTG----KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNA------FNIYHREAGVGAVAVTIEGPSKAT--LEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIE-DGESYA---MRFVPKETGNHFIHVTLD-----GAPMRESPFRLRVG----------GKDLCDP---TAISASGDGLVKGTTGQKCEFVINTA----------NAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFA 2205          

HSP 6 Score: 168.318 bits (425), Expect = 3.889e-41
Identity = 331/1505 (21.99%), Postives = 569/1505 (37.81%), Query Frame = 2
Query: 3350 IDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPF-NQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP----QKFTVD-LEGAGQGGLGLSIEGPADAQ----IQCFDNKDGTCSVQYLP-QKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNV---LNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDL--ELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYI-----EGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENI--------PNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKF----MDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISE-----TDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNA----------SRVKLYGDGLNDGM--------VNETCQFVVDTRNAG-YGGLSLSIEGPSKVEIECH---DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGS-PFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTA--SVISPSGSFEMCEIIALSDNQF----SIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPL----IDGGPHKVHIMGS-GVERGLANDANQFTIYTREAGAGSLSIAIEGPS-KAEI-DFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQ---YSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNC-----QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +++ +    V + P + G   V+V  ND H     F     P+      +  +A++  Y    N T    D      V+A       +G V+AI+ +P   +     +D    G +S  Y     G H +++ +  +P+  SP+ +   +G   +  + +G G+  EGI K         ++D  E      + L +  P+D         ++++  +   +Y P Q P   +V +K   + I      V        SK++ +G GLE  G  V  P  F V+ +  GE+      ++  +K+    Q  P  +  L   +Y P   G  ++ VL +   +  SPFV  V   +   +P    VT  G+   + + +  K+P  F ++TR  G  DL  ++ +  P    ++        G F      D P  + + V     +VPG+PF V V       +  I     +GP+ ++ P   T    ++   AG G +        G  V   + + + G  TV Y  Q+ GAY++ ++F  E I        PN  +     +  E  ++   +H          +R   ++   +    P    ++ +      R +VP  IN  DGT +      E G H+L++ ++  P+  +  +    + +   +  AYGPGL        A F +    AG G LS+ + GP+KAE +  D  NG C V Y+  APGDY + IKF      +H+ GSPF A +    K  SQI +        R+++      D +    + +  T   +   L+ +      +S +P     H V  + SG+   + P +I     +I               +K+  D   D +         +       D R+ G    +   + GP   E   H      +G   V++     G Y +        V    P      G     + E I+ H + AE S    V   N  I    ++   A   + +   +  +  I  L DN       I F   +LG +T+ V     HV    ++  +G L    I     KV +     V++       QF +         L   +  P+ K E+ +  DN DG+  V Y     G +  SI  N   + G+P    +D                 + D  + ++     Q   +G  A F +   G     +S  +  P+ K Q+    KI +N+    S  +VP   G + VHV +    +  SPFRV+V           H   G  +E  +  +      ++ +I  P  ++  C          G +FT  P   G++ I++K  G   +  +PF + +                           TQ G +    V+  G G       + NE +VD   AG   L V V GP +   E+  K + +   +V Y   E G + + +++ +H V  SP  +
Sbjct:  311 VEDKENAYKVKFTPTKIGFIHVDVAANDVHT----FETQTIPEASVICQVVPIARLLDY----NKTAKVGDDVKFAVVDAI------EGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPL---RGKPKNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLE--GGIVNEPCVFDVEMN--GESKDLSFAVEGPSKAEIGCQERPDGSAIL---SYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVT--GIDESKVYNVGEKIP--FRVDTRLCG-VDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFT----IDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEISPIEINVKPNVDVSGIRVEGLENENLLIGSH----------LRPTINIGKLE----PKSKGLQLIDEVNGKRYNVPMKINP-DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDV--NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLPVKATVPSDFAQLQPV------VSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSP--TVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE-AIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA----------------YGDG-WATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPA-KSQI----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRS---HLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFT--PREAGEHLITVKRDG-KLVPKAPFKIKVD-------------------------KTQVGDAS--KVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKA--ELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTV 1695          

HSP 7 Score: 135.961 bits (341), Expect = 3.271e-31
Identity = 130/546 (23.81%), Postives = 238/546 (43.59%), Query Frame = 2
Query:  926 KTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNV-KNAAGDPSKVTASG----PGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIE--YTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDV-AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES---KIKAFGPGLTGGIVSKPAFFEV-ETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDG-TYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            K +  RV   G G +    ++G+ +   +         +   + +P G +EPC +       L    S+ P   GE+ I +K     +P +PFK+ V K   GD SKV  SG     GI    NE        V T++AG G +   +      +   K ++T +     LI+  YT  E G++++ + FA   ++ SP  V  + K++    +      + ++  G+ + D  +   +   +    D+   +  P    +  +++ +    Y+  + P+  G + + + Y +  ++ SPF   V  + E    K++A G G+  G       F +       GA+  +I+GPS+A ++  D+ DG+ +V Y    PGEY V +  +D++IP SP+   I   T     L++  +      GI   K   F V T  A     ++A+      +   + I    DG +Y+ R+ PK  G H + V+     + ESPF++ V   +  +   I   G G+ +  T  +  FV++   AG+G + + +
Sbjct: 1508 KDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLG--VSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE------LLVDTSKAGYGGLSVSV------QGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSA---GRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA--KGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQM 2031          

HSP 8 Score: 132.494 bits (332), Expect = 2.913e-30
Identity = 196/870 (22.53%), Postives = 328/870 (37.70%), Query Frame = 2
Query: 1304 FNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVE---TNGETGALGFSIKGPSEAKIDCVDN--GDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLD-TKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAG---------SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI---ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPYKVI---ATDRVNTKEYPE------------TETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNF--------EPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTI---------YPDTKSSSNID------------------DVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSY 3706
            FNV      P  ++ +++    +K+  +  I    +   L++YT K  G H +++   G Q+Q +P    V +          +AT  G   +   V + A F V  + +   +L V++ GP +S  K    K   C    +++P  PG Y V +K G   +  SPF V V           G G     +S  +  EV    T  E   +  SIK P   +  C       G   V++ P   GE+ + +  D + +PK+P+  +I++D T++ D  KV   G G   GI T +  + +V+T  AG          PS  +  C +V              G     YTP  PG + + + + + ++ +SP  V          I+     +E+    +   E++  +        DI   ++D K     +   D G   +            +T+ + + +A +  SPF+  + S ++   +K+         G+   F     +        + V     S+  ++ ++ N+G     +     G + V V+     I +SP+KV    AT  V   E  +            T T L   A   ++ K    P+  V +  + P+E           K+  N          P  E  + + R   K       ++A G+GLVKG       F+I++       L V ++GP +A +D  +   G   V Y P  PGSY  +V YN  H   SPF + +         Y +T S   ID                  D AKVTA G GLN    F    + F ++       G  ++   +           V +   G Y CSY
Sbjct: 1356 FNVRDLGYQPKDLEAIVMPPTQKKEVAE--IIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD------GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTC--SAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----------MGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPF--KIKVDKTQVGDASKVEVSGSGKAKGI-TLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEV------------KSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQ-QYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVT-PNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRL-RVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNET-SHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNK--FFPGRPAAFQIDT---GLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSY 2180          

HSP 9 Score: 122.865 bits (307), Expect = 2.759e-27
Identity = 201/876 (22.95%), Postives = 346/876 (39.50%), Query Frame = 2
Query:  953 YGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVD--CVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG--------------------ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFD---PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTG-QTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA-GNAANIKV---YGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINN-----LNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLG---VTIEGPM-EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNV 3463
            YGPGL+     +G PA FTV    +    L + +  P   K   +I D  NK+   S +++P + GEY++ +K     + +SPF+V V       S ++        V   + ++    +  +   PG ++  C +    G               +  + +T +E G H + V   G  +  +PF + V  KT   DA +   +G G + +G+ ++   E  V T  AG+  L V+V GP ++   C  K+V   L +  Y P  PG Y + IK+ ++ +  SP  V               G + G V +    +VE +G                    +  A     KG ++  I+  D G     + + P + G + + ++  D ++  SP+    Q     F      KV A G G++ G  T     F +  + AG    V A    + G     ++ +D+NDG     Y    PG++ V V + + +IP+SPFKV +  A G    +++   +G GI   K    T+ V+  +  G  +  +   + ++  + +V  +  DG              + I +    A + +SPF++ +   +      I+      +  TT  GQ  EF I T   G+ +   + V+    S+  +   E   G+   +TP   G +  +V+  G     SP+K+     V  KE               +    YN+ S      K+  V +++  T +               + P  + +         VTA G GL K     PA+F ID+       L    VT +GP  E  + +  +G   CS     +  G   V + Y D+ I  SPF +
Sbjct: 1435 YGPGLQ--NAVVGEPATFTVCAKGSQAKELSVSIEGP--AKSQIKIHD--NKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG--STSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDG--------------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKV-DKTQVGDASKVEVSGSG-KAKGITLQ-ANELLVDTSKAGYGGLSVSVQGPSKAELTC--KEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCT------------GKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTD-DIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPF----QFTVGSFSEGGAHKVRAAGQGVVRG-ETGTFNAFNIYHREAG----VGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAF--TFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIE--DGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTT--GQKCEFVINTANAGAGI---LTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKI----PVEGKE---------------LGGNGYNETS----HVKIDAVAKTSKGTVA---------------VVPEYQGD------AAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKG--FVFIKYGDKEIPGSPFAI 2206          

HSP 10 Score: 105.916 bits (263), Expect = 3.849e-22
Identity = 90/370 (24.32%), Postives = 162/370 (43.78%), Query Frame = 2
Query: 1424 IEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGF--ADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            I +T  + G ++++VF+ G  +    +  +   +     A++A       + +  +     +FQ +  D G+   DL   V  P +  E  +I           Y P+  G + + I      +  +P    V  Y +     +GPGL   +V +PA F V   G +   L  SI+GP++++I   DN DG+ +  + P VPGEY VH+    + +  SP+   +  + +    L V           ST++ A  I   +  G  +++K+      G   P  +R  + G     +TP+  G+H + V      +P++PFK+ V   + G+A+ ++V G G  +  T      +VD   AG G + +SV
Sbjct: 1293 IVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEK-EDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG----------STSEVALPITQQELKGISASIKSPG----GIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSV 1647          

HSP 11 Score: 103.219 bits (256), Expect = 2.287e-21
Identity = 125/476 (26.26%), Postives = 198/476 (41.60%), Query Frame = 2
Query:  986 IGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSC----------SYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIE-PVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES-----------KIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILC----DDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGIST-----NKPADFIVNT-KNAGSPSTVKAECFDVTGQTIPVQIRD-NNDGTYSCRYTP 2311
            +G   PF VDT   G      + L PK      EI D     ++Y            + IP    +++I +  A   +P +PF V VK    D SK+   GPG++ PV ++    T F +   +AGPG+V+  + D +G  ++V   +    +  F ++YT +  G + +NV FAG +I  SP  + V      S               G+RV  +    +         + +    P +S     I +V+   Y         G Y  D        H      D  P KE+           K KA+GPGL   +V + A FE++ +G   GAL   ++GP++A+    D G+G  +V Y    PG+Y + I        E++  SP+ A +       DP ++T      ISG+       N+P +F+++T K    P  VKA       Q  PV  R  +N   ++ R+ P
Sbjct:  659 VGEKIPFRVDTRLCG------VDLVPK-----VEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPT-DASKLKIFGPGVDGPVYSK--EPTRFTIDATQAGPGAVEVALRDDQG--ENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVS---------------GIRVEGLENENLLIGSHLRPTINIGKLEP-KSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK---DPSQIT------ISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRSPSNPRHHNVRFVP 1089          

HSP 12 Score: 73.559 bits (179), Expect = 2.227e-12
Identity = 111/492 (22.56%), Postives = 215/492 (43.70%), Query Frame = 2
Query:  929 TNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNE---VGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNP----IHLSPFNVDVAPYKE--SKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSE-AKIDCVDNGDGS----ANVTYWP------TVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDN-NDGTYSCRYTPKIPGKHTVI 2338
            T++ +++ +GPG++    +   P  FT+D   AG G +++ + + +G+    ++ D  N++ +++  Y     G Y++ + FA  EI  SP ++NVK        V  SG  +E + NE   +G      +   +  P S    ++D   G++ +V  KI    +  +  +    E G H + + F  + ++ +   V+       +D  +  A G G+  E   V + A F++  + AG   L + + GP ++  + Q +    C  E  Y+ + PG Y + IK+G +     +  SPF   V  YK+  S+I   G       +++P  F ++T+ +T  L      PS+ A++  V +   S     NV + P      ++P E     L  DE + K     + QL   L D  K +     + +  S      F  + ++ G+   +++  F   G+     +R    +G Y   +   + G++ V+
Sbjct:  738 TDASKLKIFGPGVDGPVYS-KEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLD--NQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK------PNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKIN--PDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVI-----KGTDVNKCKAYGPGL--EQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVE--YVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTS-KTKDLPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPF--DVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVV 1203          

HSP 13 Score: 65.4698 bits (158), Expect = 6.196e-10
Identity = 82/310 (26.45%), Postives = 128/310 (41.29%), Query Frame = 2
Query:  974 EGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA-AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSK---------TSNSDAKQAYATGRGI-------QPEGVRVRDV------------AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSY-IPQRPGPYVVDIKYGNNPIHLSPFNVD 1813
            +G   G    FTV T  A KG+L+  V+ P  + +  +I    + E +Y+  ++P   G + I +    + +  SPF++ V      DP+ ++ASG G+  V    G++  F + TA AG G     IL  +    S       + E  + + YT    G +  +V + G+    SPF + V  K         TS+        T +G        Q +  +V               A FQ+ T  AG   L V V       E+  ++      Y CSY IP R   +V  IKYG+  I  SPF ++
Sbjct: 1908 QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIEDGE-SYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGL--VKGTTGQKCEFVINTANAGAG-----ILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVF-IKYGDKEIPGSPFAIE 2207          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 489/1511 (32.36%), Postives = 767/1511 (50.76%), Query Frame = 2
Query: 3251 ANTPASFIIDSTEEPPAPLGVTIEGPM--EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKF----NEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEI--EVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVR------------PHRGHLIANKVPSLFTINTRDAGE-SDLELMVTGPN-NESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSE-------AKPEQCYIEGPILNEVPVGKTVTIPVNTQNA----GDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPV---GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKI-DNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX--------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSN----------DSIRET-KSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +  P  F ID+T+  P  + V +         +D +DN DG+ +V Y  + PG+Y +NV++  E I  SP  + + P+        DV+ +     GL    +   S  + T+N   ++   KG+   +I     +R    +  N DGTYS        G+HK+ + +D +PV ++   V V +G+D ++ +AYGPGLE+ +  +   F +DL+GAG+G L + + GPA A+ +  D  +G CSV+Y+ + PG Y+++IKF     ++H+ GSPF   +    D S++     GL++   R+  P  F +D SK  + P+K  V  +    ++P      S P   +V ++P    N  I  E++Y+ +++     +  VL   EP+ + +  +  +             H GH     VP     + RD G    +E  V GP+  E +N       +G +   +  D+ G Y V      + V      VPV +E          E+      I    P   T   P++ +         +L+AK        +   ++N       + +   K+G   + + +  E++ +  +   A    E   I+        E+   + + E     +KF V   G     + A+V  P+ +K+V  +I+N DGTI V+Y P   G HEL +  NG  + G+P KFYVD+    G  T YGPGL        A FT+  K + A  LS+++EGP+K++I+  DNK+GTC  +++P  PG+Y + +K   K +  SPF   + GE +KRS + VG+TS+V L I++ ++  ++A + SP G EE C ++ L  G LG+SFTP+E GEHL+ V R G+ +P +PFKI V + ++G+AS+V++ G G   G+  +  + +VDT  AGYGGLS+S++GPSK E+ C +   G   V Y PTEPG Y I +K+AD +V  SP  V   G  +  + + I +  +   +        L L +   +  + TA ++ P G  +  E+  L    + ++F PK  G+HT+SV   + HV GSPFQFTVG   +GG HKV   G GV RG     N F IY REAG G++++ IEGPSKA ++F+D+ DG+C V Y+V  PG+YV ++KFND+H+P SPF +         Y  P   E       R + +A    QG   G    F +  H    G + A V++P+N+     I  I D   Y++ FVP E G H +HV ++ +P+  SPFR+ V          ++ SG+G+  G TG+  EF ++T+NAG G LTV +DGPSK  L+  E E GY   Y P APG Y  S+KY G  H  GSPF + + G     N          D++ +T K     V    G   K       V  +G GL     G+   F +D GLAG ++L VGV     PCEEV ++H G+  +  +Y + ++ +  + +++G+ ++PGSPF I
Sbjct:  754 SKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNV-------DVSGIRV--EGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITI--SGLDQPNYRLNQPINFVIDTSKTKDLPVKATV-PSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGH-----VP----FDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAAR---VPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDH--VEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQ---YKFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA-YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKV---------YIAPATGE------VRKLELAQFHGQGIPAGKAFTFTVLTH-RAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAK-------VTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2202          

HSP 2 Score: 456.062 bits (1172), Expect = 2.234e-129
Identity = 357/1116 (31.99%), Postives = 535/1116 (47.94%), Query Frame = 2
Query:  191 EDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIK------FANSEIPNSPFKVNVKNAAG--DPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDS-VKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHT----EDAGFADLGVNVYGP--GRSLEKCQIKKVSPCLYECSYIP-QRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDP--LKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE-TYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLY----NDEHIKDSPFNVTI 3469
            +DA+WK+IQ+NTFTRW   HL+ +   I+ L+ D +DGLKLI L Q LS  N    +K+  FR+QKLENV++ L F +  E ++++NIDS+ I D   KLILGL+WTLILHYSI+M  W  E   ++DG  K  +PKQ+LL WI +++P  P+ NFT+DWNDG A+GALV++ APG   +W  W P  AL+N ++A+ +A++ L VAPLI P EMI+P++DE ++MTYLSQFP  +     P +  T S   +            + +P  F +     G     + + +  GQ     +    +KE AY   + PT  G   + +       F    IP +     V   A   D +K             +VG    F V  A  GP  V+ +++D  G++   V    T   E+ F  EY     GLHSVNVF   + +  SPF +    K S          GRGI PEG+R  DV    V +    E+   A++ + V  P  G  L             +  Y P Q P    V +K     I      + VAP   SKI+AFG GL GGIV++P  F+VE NGE+  L F+++GPS+A+I C +  DGSA ++Y PTV G Y V +L D ++I  SP++ ++    +   P   +VT      +  +    P  F V+T+  G     K E  D     I    R+   G +     P  P KH + VS   V++P +PF V V E  +A+ +K++GPG++    + E T F +D   AG G + +++ D++  +V +   DN DG+FT+KYT +  G      +F  E EI  SP ++ ++ + D    ++  L         NE  ++    GS +RP I +         ++L +  NG                V  K NP G                   T+TPL+   ++ +    +++  IPV+ A +  ++ ++V      NK +                            AYG GL + V    A F +D        L + + GP +A+    D G+G CSV Y+ K PG Y + + +      EH+K SPF   +
Sbjct:   20 DDAEWKIIQQNTFTRWVKNHLQKAGETIESLETDFSDGLKLIALAQVLSHKNVGKFNKKVAFRSQKLENVSLALNFFQNEENIKIINIDSTHIVDHNKKLILGLVWTLILHYSISMG-WIQE--KREDGDNKEETPKQKLLNWIRNRLPGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATKPIIMKPKVQATISNLDKIL---------QVNDPREFDLKLSRDG-FKPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGFIHVDVAANDVHTFETQTIPEASVICQVVPIARLLDYNKTA-----------KVGDDVKFAVVDAIEGP--VEAIVVDPTGKEHRMVILDGTSPGEHSF--EYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK------VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVI--ESHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIP--FRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGE-EI--SPIEINVKPNVDVSGIRVEGLE--------NENLLI----GSHLRPTINIGKLEPKSKGLQLIDEVNG------------KRYNVPMKINPDGTY----------------STDTPLMEVGEHKL-QLLFDE--IPVKEAVVEVIKGTDV------NKCK----------------------------AYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVV 1017          

HSP 3 Score: 275.404 bits (703), Expect = 1.157e-73
Identity = 325/1353 (24.02%), Postives = 575/1353 (42.50%), Query Frame = 2
Query: 3809 SRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA---GEA-PLKVNVIDTATKSVKPAQIL-----PKS------TPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNT---QNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHY-TTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFY----NGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSK-AEIQCIDNKNGT----CDVSYLPLAPGDYHIGIKF------MDKHIIG-----SPFTAKIFGEPKKRSQICVGTTSD------VPLRISET-DINNLNAIVISPTGREESCTLKRL-QNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGD--GLNDGMVNETCQF-----------------VVDTRNAGYGGLSLSIEGPSKVEIE-----CHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPF-AVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPF-MLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX--------XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            S+IRA+G GLE GI  +P  F V++ G  +  L  ++EGP+ A+I C +  DG+  + Y P   G Y V +  + KHI  SPF + + + ++         GL+ + +RV       +D SK    GE  P +V+        V   +IL     P S      TPGLF+ T IP+     +I+V    + VPG+PF   V    +  K+ + G GV       + +K P+ FTI+   AG   +E+ +     E+V+LDV ++ DG+FT +Y    PG Y + V++  + +  SP  + V          +EG     + +G  +   +N    +    G+     V      VP  I  +  G  +      ++G +++QL+F++  IP   +++   +  +   + +   +    EQ+   +  E +V +     G     +   +  P+  +   R+ + G+G  +V+Y     G +E+ + +      + + GSPFK  VD      Q+T  G      R +   +F I T  +    L +    PS  A++Q + +++ +     +V ++P    +  I I+       +D+ ++       P   KI  + KK S      T++      VP  + +  ++  + + V  P G+E    ++   QNG   +SF     GE+ V    +G+ +                A+RV +  +  G  + ++ E   F                 +   +   +  + +    P  V +E       + H     + +  T+ GT  ++V Y   +V    + A+    Y         +  +   +V +     + N+   GY  ++  A V+ P+   E+ EII   D    +++ PK  G H +S+  +   + G+P +F V    DG      + G G++  +  +   FT+  + + A  LS++IEGP+K++I   DNKDG+C   +    PG+Y   +K   + V  SPF +L + E    S+                           ++GS +   +         ISA + SP   E+   +  +D  +  V F P E G H + V  +   +P +PF++           +V VSG G   G T + NE  VDTS AG G L+V++ GPSK +L C+E +SG     Y P  PG Y I+IK+  ++H+  SP  V  +G            KS  + +  I    QK      +V+  G  L   E    + F+     +  D+    +  P    +++ ++ LG   +Q+ +  + +G H L V + +  V GSPF+  V
Sbjct:  547 SKIRAFGAGLEGGIVNEPCVFDVEMNGESKD-LSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIE---------GLKPSATRVTG-----IDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV----DGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPD--GTYSTDTPLMEVGEHKLQLLFDE--IP---VKEAVVEVIKGTDVNKCKAYGPGLEQA---VVGEKAVFELDLD-GAGEGALSMEMRGPAKAES--RIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDT--SKTKDLPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV----------------AARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGW---ATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSH--------------------------LSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG------------KSAGRVIQTI----QK------DVEQHGICLPDQE---SHLFLKLLNTSPMDIT-ARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTV 1791          

HSP 4 Score: 210.69 bits (535), Expect = 6.115e-54
Identity = 223/883 (25.25%), Postives = 379/883 (42.92%), Query Frame = 2
Query: 1964 DCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTG-QTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNG-----------DGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDN--DFKKYKINNLNNTTPIG-QLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPY----------KVIATDRVNTKEY----PETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQ--RSNFEPNEEIIYPVQRTNEKAELR---------------KPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDG-TYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIH-----------------DIV----------------DVSKVKCYGPGLERNGSRVF--TPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTY-IPENIGNCEIEVLYNNMQVPGSPF 4354
            + +DN DG+  V Y P V G + + IL +   +  +P    I+     +     T YGPGL + +   +PA F V  K     S  K     + G     ++I DN DGT S  + P +PG++ V V  G   + +SPF+V V+           G G +R+  ++            + ++ + +  ++++ +       G           DG              + I +      +P++PFK+ ++     D  K +++       I  Q NE  + T   G      + V+ P  S+  +  +E  +G +   +TPT  G + + ++   + + +SP           +VI T + + +++    P+ E+ L +        K  N   + + +  + P   ++     +  +Q  +  F P  E I+ +    + A +                   V A G+G+V+G   T  +F I   E     + VTIEGP +A +++ D+ DG C V+Y    PG Y+V V +ND+HI DSPF V I P T     +  +     +G G+ P G    +F+ FTV    +    KG ++A +  P N+  T  +    DG +Y+  + P   G H I +T DG P+ +SP+ + V      DP+ I A G GL +G T Q  +F ++   AG G L + ++GP+ A +  ++ + G   V+Y P  PGSY  S+K+N  H PGSPF +P+                  D V                D +KV   G GL    ++ F   P+ F +D   AG   L V V+   TK      ++     G +  +Y IP+ +    + + Y + ++PGSPF
Sbjct: 1379 EIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTP----IKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKG----SQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVM-----------GEGQKRSHLSV----------GSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGL-SVSVQGP--SKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFL--------KLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPAT---GEVRKLELAQFHGQGI-PAG---KAFT-FTV----LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGL----NKFFPGRPAAFQIDTGLAGTNLLMVGVV--TTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGF-VFIKYGDKEIPGSPF 2200          

HSP 5 Score: 203.756 bits (517), Expect = 8.252e-52
Identity = 234/854 (27.40%), Postives = 345/854 (40.40%), Query Frame = 2
Query: 3218 TAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----GEAPLKVNVIDTATKSVKPAQILPKSTPG----------LFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCE--PEKVIVTGEG-VRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPF---IVPVHSEA-KPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGP-----VGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQ-PSESGL--HELE------------------VFYNGQPITGSPFKFYVD----------------------------STIP-----SGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAV---EGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT 5524
            T YG GL   V   PA+F + +       L V+IEGP +++I   DN DGTCS  ++P  PG Y V+V    + +KDSPF V +  + +  S++                     S    +  A PI       + A I +P      C V     G    S++P   G+H I +  DG  V K+P+ + V   Q  D S++   G G  +GIT Q  +  VD   AG GGL +S++GP+ A++ C + K G   V Y P +PG Y ++IKF + H+  SP T           V+C G    ++  RV    Q  V+         E+ L + +++T+   +    + PK               + + + P+  G   + V+Y +  V GSPF   V +  E    KV   G+G VR   G   A      F I  R+AG   + + + GP+  +  L+  +H DG     YK   PG Y V V + ++++P SPF   I P   E  K E     G     +P GK  T  V T  A  G L AK V P       +IVP   + E Y    + +VP++ G + + +  +        +R+  F+ +              +   P   T  S        G        V+N            N G G +TVQ   PS++ L  +ELE                  V YNG    GSPFK  V+                            + +P     + +VTA G GL+   P   A F I T  AG   L + V   +GP + E+      +G    SY         + IK+ DK I GSPF 
Sbjct: 1429 TVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHL---------------------SVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLT-----------VQCTG----KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNA------FNIYHREAGVGAVAVTIEGPSKAT--LEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIE-DGESYA---MRFVPKETGNHFIHVTLD-----GAPMRESPFRLRVG----------GKDLCDP---TAISASGDGLVKGTTGQKCEFVINTA----------NAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFA 2201          

HSP 6 Score: 171.014 bits (432), Expect = 7.653e-42
Identity = 332/1506 (22.05%), Postives = 570/1506 (37.85%), Query Frame = 2
Query: 3350 IDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPF-NQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP----QKFTVD-LEGAGQGGLGLSIEGPADAQ----IQCFDNKDGTCSVQYLP-QKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNV---LNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDL--ELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYI-----EGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENI--------PNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKF----MDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISE-----TDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNA----------SRVKLYGDGLNDGM--------VNETCQFVVDTRNAG-YGGLSLSIEGPSKVEIECH---DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGS-PFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTA--SVISPSGSFEMCEIIALSDNQF----SIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPL----IDGGPHKVHIMGSGVERGLANDANQFTIYTREAG--AGSLSIAIEGPS-KAEI-DFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQ---YSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNC-----QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +++ +    V + P + G   V+V  ND H     F     P+      +  +A++  Y    N T    D      V+A       +G V+AI+ +P   +     +D    G +S  Y     G H +++ +  +P+  SP+ +   +G   +  + +G G+  EGI K         ++D  E      + L +  P+D         ++++  +   +Y P Q P   +V +K   + I      V        SK++ +G GLE  G  V  P  F V+ +  GE+      ++  +K+    Q  P  +  L   +Y P   G  ++ VL +   +  SPFV  V   +   +P    VT  G+   + + +  K+P  F ++TR  G  DL  ++ +  P    ++        G F      D P  + + V     +VPG+PF V V       +  I     +GP+ ++ P   T    ++   AG G +        G  V   + + + G  TV Y  Q+ GAY++ ++F  E I        PN  +     +  E  ++   +H          +R   ++   +    P    ++ +      R +VP  IN  DGT +      E G H+L++ ++  P+  +  +    + +   +  AYGPGL        A F +    AG G LS+ + GP+KAE +  D  NG C V Y+  APGDY + IKF      +H+ GSPF A +    K  SQI +        R+++      D +    + +  T   +   L+ +      +S +P     H V  + SG+   + P +I     +I               +K+  D   D +         +       D R+ G    +   + GP   E   H      +G   V++     G Y +        V    P      G     + E I+ H + AE S    V   N  I    ++   A   + +   +  +  I  L DN       I F   +LG +T+ V     HV    ++  +G L    I     KV +     E  +     Q+    R+ G     L   +  P+ K E+ +  DN DG+  V Y     G +  SI  N   + G+P    +D                 + D  + ++     Q   +G  A F +   G     +S  +  P+ K Q+    KI +N+    S  +VP   G + VHV +    +  SPFRV+V           H   G  +E  +  +      ++ +I  P  ++  C          G +FT  P   G++ I++K  G   +  +PF + +                           TQ G +    V+  G G       + NE +VD   AG   L V V GP +   E+  K + +   +V Y   E G + + +++ +H V  SP  +
Sbjct:  309 VEDKENAYKVKFTPTKIGFIHVDVAANDVHT----FETQTIPEASVICQVVPIARLLDY----NKTAKVGDDVKFAVVDAI------EGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPL---RGKPKNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLE--GGIVNEPCVFDVEMN--GESKDLSFAVEGPSKAEIGCQERPDGSAIL---SYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVT--GIDESKVYNVGEKIP--FRVDTRLCG-VDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFT----IDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEISPIEINVKPNVDVSGIRVEGLENENLLIGSH----------LRPTINIGKLE----PKSKGLQLIDEVNGKRYNVPMKINP-DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDV--NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLPVKATVPSDFAQLQPV------VSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSP--TVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE-AIGKLEYERIQAERAKVVVEK---EDDVDKYEKQYKFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA----------------YGDG-WATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPA-KSQI----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRS---HLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFT--PREAGEHLITVKRDG-KLVPKAPFKIKVD-------------------------KTQVGDAS--KVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKA--ELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTV 1691          

HSP 7 Score: 135.961 bits (341), Expect = 2.693e-31
Identity = 130/546 (23.81%), Postives = 238/546 (43.59%), Query Frame = 2
Query:  926 KTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNV-KNAAGDPSKVTASG----PGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIE--YTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDV-AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES---KIKAFGPGLTGGIVSKPAFFEV-ETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDG-TYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            K +  RV   G G +    ++G+ +   +         +   + +P G +EPC +       L    S+ P   GE+ I +K     +P +PFK+ V K   GD SKV  SG     GI    NE        V T++AG G +   +      +   K ++T +     LI+  YT  E G++++ + FA   ++ SP  V  + K++    +      + ++  G+ + D  +   +   +    D+   +  P    +  +++ +    Y+  + P+  G + + + Y +  ++ SPF   V  + E    K++A G G+  G       F +       GA+  +I+GPS+A ++  D+ DG+ +V Y    PGEY V +  +D++IP SP+   I   T     L++  +      GI   K   F V T  A     ++A+      +   + I    DG +Y+ R+ PK  G H + V+     + ESPF++ V   +  +   I   G G+ +  T  +  FV++   AG+G + + +
Sbjct: 1504 KDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLG--VSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE------LLVDTSKAGYGGLSVSV------QGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSA---GRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA--KGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQM 2027          

HSP 8 Score: 133.265 bits (334), Expect = 1.977e-30
Identity = 196/877 (22.35%), Postives = 330/877 (37.63%), Query Frame = 2
Query: 1304 FNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVE---TNGETGALGFSIKGPSEAKIDCVDN--GDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLD-TKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAG---------SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI---ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPYKVI---ATDRVNTKEYPE------------TETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKP---------------NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTI---------YPDTKSSSNID------------------DVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSY 3706
            FNV      P  ++ +++    +K+  +  I    +   L++YT K  G H +++   G Q+Q +P    V +          +AT  G   +   V + A F V  + +   +L V++ GP +S  K    K   C    +++P  PG Y V +K G   +  SPF V V           G G     +S  +  EV    T  E   +  SIK P   +  C       G   V++ P   GE+ + +  D + +PK+P+  +I++D T++ D  KV   G G   GI T +  + +V+T  AG          PS  +  C +V              G     YTP  PG + + + + + ++ +SP  V          I+     +E+    +   E++  +        DI   ++D K     +   D G   +            +T+ + + +A +  SPF+  + S ++   +K+         G+   F     +        + V     S+  ++ ++ N+G     +     G + V V+     I +SP+KV    AT  V   E  +            T T L   A   ++ K    P+  V +  + P+E                F P E   + +  T + A +R+                 ++A G+GLVKG       F+I++       L V ++GP +A +D  +   G   V Y P  PGSY  +V YN  H   SPF + +         Y +T S   ID                  D AKVTA G GLN    F    + F ++       G  ++   +           V +   G Y CSY
Sbjct: 1352 FNVRDLGYQPKDLEAIVMPPTQKKEVAE--IIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD------GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTC--SAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----------MGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPF--KIKVDKTQVGDASKVEVSGSGKAKGI-TLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEV------------KSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQ-QYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVT-PNNEVDTIDIVPIEDGESYAM--------RFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNET-SHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNK--FFPGRPAAFQIDT---GLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSY 2176          

HSP 9 Score: 123.25 bits (308), Expect = 1.857e-27
Identity = 201/876 (22.95%), Postives = 347/876 (39.61%), Query Frame = 2
Query:  953 YGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVD--CVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG--------------------ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFD---PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQT-IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA-GNAANIKV---YGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINN-----LNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLG---VTIEGPM-EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNV 3463
            YGPGL+     +G PA FTV    +    L + +  P   K   +I D  NK+   S +++P + GEY++ +K     + +SPF+V V       S ++        V   + ++    +  +   PG ++  C +    G               +  + +T +E G H + V   G  +  +PF + V  KT   DA +   +G G + +G+ ++   E  V T  AG+  L V+V GP ++   C  K+V   L +  Y P  PG Y + IK+ ++ +  SP  V               G + G V +    +VE +G                    +  A     KG ++  I+  D G     + + P + G + + ++  D ++  SP+    Q     F      KV A G G++ G  T     F +  + AG    V A    + G +   ++ +D+NDG     Y    PG++ V V + + +IP+SPFKV +  A G    +++   +G GI   K    T+ V+  +  G  +  +   + ++  + +V  +  DG              + I +    A + +SPF++ +   +      I+      +  TT  GQ  EF I T   G+ +   + V+    S+  +   E   G+   +TP   G +  +V+  G     SP+K+     V  KE               +    YN+ S      K+  V +++  T +               + P  + +         VTA G GL K     PA+F ID+       L    VT +GP  E  + +  +G   CS     +  G   V + Y D+ I  SPF +
Sbjct: 1431 YGPGLQ--NAVVGEPATFTVCAKGSQAKELSVSIEGP--AKSQIKIHD--NKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG--STSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDG--------------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKV-DKTQVGDASKVEVSGSG-KAKGITLQ-ANELLVDTSKAGYGGLSVSVQGPSKAELTC--KEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCT------------GKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTD-DIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPF----QFTVGSFSEGGAHKVRAAGQGVVRG-ETGTFNAFNIYHREAG----VGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAF--TFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIE--DGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTT--GQKCEFVINTANAGAGI---LTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKI----PVEGKE---------------LGGNGYNETS----HVKIDAVAKTSKGTVA---------------VVPEYQGD------AAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKG--FVFIKYGDKEIPGSPFAI 2202          

HSP 10 Score: 105.531 bits (262), Expect = 4.438e-22
Identity = 89/370 (24.05%), Postives = 163/370 (44.05%), Query Frame = 2
Query: 1424 IEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGF--ADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            I +T  + G ++++VF+ G  +    +  +   +     A++A      ++ E    +   +++ +  D G+   DL   V  P +  E  +I           Y P+  G + + I      +  +P    V  Y +     +GPGL   +V +PA F V   G +   L  SI+GP++++I   DN DG+ +  + P VPGEY VH+    + +  SP+   +  + +    L V           ST++ A  I   +  G  +++K+      G   P  +R  + G     +TP+  G+H + V      +P++PFK+ V   + G+A+ ++V G G  +  T      +VD   AG G + +SV
Sbjct: 1291 IVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVV---VEKEDDVDKYEKQYKFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG----------STSEVALPITQQELKGISASIKSPG----GIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSV 1643          

HSP 11 Score: 103.605 bits (257), Expect = 1.791e-21
Identity = 125/476 (26.26%), Postives = 198/476 (41.60%), Query Frame = 2
Query:  986 IGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSC----------SYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIE-PVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES-----------KIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILC----DDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGIST-----NKPADFIVNT-KNAGSPSTVKAECFDVTGQTIPVQIRD-NNDGTYSCRYTP 2311
            +G   PF VDT   G      + L PK      EI D     ++Y            + IP    +++I +  A   +P +PF V VK    D SK+   GPG++ PV ++    T F +   +AGPG+V+  + D +G  ++V   +    +  F ++YT +  G + +NV FAG +I  SP  + V      S               G+RV  +    +         + +    P +S     I +V+   Y         G Y  D        H      D  P KE+           K KA+GPGL   +V + A FE++ +G   GAL   ++GP++A+    D G+G  +V Y    PG+Y + I        E++  SP+ A +       DP ++T      ISG+       N+P +F+++T K    P  VKA       Q  PV  R  +N   ++ R+ P
Sbjct:  657 VGEKIPFRVDTRLCG------VDLVPK-----VEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPT-DASKLKIFGPGVDGPVYSK--EPTRFTIDATQAGPGAVEVALRDDQG--ENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVS---------------GIRVEGLENENLLIGSHLRPTINIGKLEP-KSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK---DPSQIT------ISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRSPSNPRHHNVRFVP 1087          

HSP 12 Score: 73.9442 bits (180), Expect = 1.882e-12
Identity = 111/492 (22.56%), Postives = 215/492 (43.70%), Query Frame = 2
Query:  929 TNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNE---VGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNP----IHLSPFNVDVAPYKE--SKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSE-AKIDCVDNGDGS----ANVTYWP------TVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDN-NDGTYSCRYTPKIPGKHTVI 2338
            T++ +++ +GPG++    +   P  FT+D   AG G +++ + + +G+    ++ D  N++ +++  Y     G Y++ + FA  EI  SP ++NVK        V  SG  +E + NE   +G      +   +  P S    ++D   G++ +V  KI    +  +  +    E G H + + F  + ++ +   V+       +D  +  A G G+  E   V + A F++  + AG   L + + GP ++  + Q +    C  E  Y+ + PG Y + IK+G +     +  SPF   V  YK+  S+I   G       +++P  F ++T+ +T  L      PS+ A++  V +   S     NV + P      ++P E     L  DE + K     + QL   L D  K +     + +  S      F  + ++ G+   +++  F   G+     +R    +G Y   +   + G++ V+
Sbjct:  736 TDASKLKIFGPGVDGPVYS-KEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLD--NQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK------PNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKIN--PDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVI-----KGTDVNKCKAYGPGL--EQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVE--YVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTS-KTKDLPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPF--DVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVV 1201          

HSP 13 Score: 65.855 bits (159), Expect = 5.370e-10
Identity = 82/310 (26.45%), Postives = 128/310 (41.29%), Query Frame = 2
Query:  974 EGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA-AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSK---------TSNSDAKQAYATGRGI-------QPEGVRVRDV------------AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSY-IPQRPGPYVVDIKYGNNPIHLSPFNVD 1813
            +G   G    FTV T  A KG+L+  V+ P  + +  +I    + E +Y+  ++P   G + I +    + +  SPF++ V      DP+ ++ASG G+  V    G++  F + TA AG G     IL  +    S       + E  + + YT    G +  +V + G+    SPF + V  K         TS+        T +G        Q +  +V               A FQ+ T  AG   L V V       E+  ++      Y CSY IP R   +V  IKYG+  I  SPF ++
Sbjct: 1904 QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIEDGE-SYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGL--VKGTTGQKCEFVINTANAGAG-----ILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVF-IKYGDKEIPGSPFAIE 2203          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 489/1511 (32.36%), Postives = 764/1511 (50.56%), Query Frame = 2
Query: 3251 ANTPASFIIDSTEEPPAPLGVTIEGPM--EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKF----NEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEI--EVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVR------------PHRGHLIANKVPSLFTINTRDAGE-SDLELMVTGPN-NESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSE-------AKPEQCYIEGPILNEVPVGKTVTIPVNTQNA----GDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPV---GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKI-DNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX--------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSN----------DSIRET-KSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +  P  F ID+T+  P  + V +         +D +DN DG+ +V Y  + PG+Y +NV++  E I  SP  + + P+        DV+ +     GL    +   S  + T+N   ++   KG+   +I     +R    +  N DGTYS        G+HK+ + +D +PV ++   V V +G+D ++ +AYGPGLE+ +  +   F +DL+GAG+G L + + GPA A+ +  D  +G CSV+Y+ + PG Y+++IKF     ++H+ GSPF   +    D S++     GL++   R+  P  F +D SK  + P+K  V  +    ++P      S P   +V ++P    N  I  E++Y+ +++     +  VL   EP+ + +  +  +             H GH     VP     + RD G    +E  V GP+  E +N       +G +   +  D+ G Y V      + V      VPV +E          E+      I    P   T   P++ +         +L+AK        +   ++N       + +   K+G   + + +  E++ +           E+   ER       E        +Y    F+F V   G     + A+V  P+ +K+V  +I+N DGTI V+Y P   G HEL +  NG  + G+P KFYVD+    G  T YGPGL        A FT+  K + A  LS+++EGP+K++I+  DNK+GTC  +++P  PG+Y + +K   K +  SPF   + GE +KRS + VG+TS+V L I++ ++  ++A + SP G EE C ++ L  G LG+SFTP+E GEHL+ V R G+ +P +PFKI V + ++G+AS+V++ G G   G+  +  + +VDT  AGYGGLS+S++GPSK E+ C +   G   V Y PTEPG Y I +K+AD +V  SP  V   G  +  + + I +  +   +        L L +   +  + TA ++ P G  +  E+  L    + ++F PK  G+HT+SV   + HV GSPFQFTVG   +GG HKV   G GV RG     N F IY REAG G++++ IEGPSKA ++F+D+ DG+C V Y+V  PG+YV ++KFND+H+P SPF +         Y  P   E       R + +A    QG   G    F +  H    G + A V++P+N+     I  I D   Y++ FVP E G H +HV ++ +P+  SPFR+ V          ++ SG+G+  G TG+  EF ++T+NAG G LTV +DGPSK  L+  E E GY   Y P APG Y  S+KY G  H  GSPF + + G     N          D++ +T K     V    G   K       V  +G GL     G+   F +D GLAG ++L VGV     PCEEV ++H G+  +  +Y + ++ +  + +++G+ ++PGSPF I
Sbjct:  622 SKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNV-------DVSGIRV--EGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITI--SGLDQPNYRLNQPINFVIDTSKTKDLPVKATV-PSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGH-----VP----FDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAAR---VPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYK---FQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA-YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKV---------YIAPATGE------VRKLELAQFHGQGIPAGKAFTFTVLTH-RAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAK-------VTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2072          

HSP 2 Score: 320.472 bits (820), Expect = 1.555e-87
Identity = 293/994 (29.48%), Postives = 449/994 (45.17%), Query Frame = 2
Query:  563 NQQDGQGKGPSPKQRLLGWINSKMP--HKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIK------FANSEIPNSPFKVNVKNAAG--DPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDS-VKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHT----EDAGFADLGVNVYGP--GRSLEKCQIKKVSPCLYECSYIP-QRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDP--LKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE-TYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLY----NDEHIKDSPFNVTI 3469
             ++DG  K  +PKQ+LL WI +++P    P+ NFT+DWNDG A+GALV++ APG   +W  W P  AL+N ++A+ +A++ L VAPLI P EMI+P++DE ++MTYLSQFP  +     P +  T S   +            + +P  F +     G     + + +  GQ     +    +KE AY   + PT  G   + +       F    IP +     V   A   D +K             +VG    F V  A  GP  V+ +++D  G++   V    T   E+ F  EY     GLHSVNVF   + +  SPF +    K S          GRGI PEG+R  DV    V +    E+   A++ + V  P  G  L             +  Y P Q P    V +K     I      + VAP   SKI+AFG GL GGIV++P  F+VE NGE+  L F+++GPS+A+I C +  DGSA ++Y PTV G Y V +L D ++I  SP++ ++    +   P   +VT      +  +    P  F V+T+  G     K E  D     I    R+   G +     P  P KH + VS   V++P +PF V V E  +A+ +K++GPG++    + E T F +D   AG G + +++ D++  +V +   DN DG+FT+KYT +  G      +F  E EI  SP ++ ++ + D    ++  L         NE  ++    GS +RP I +         ++L +  NG                V  K NP G                   T+TPL+   ++ +    +++  IPV+ A +  ++ ++V      NK +                            AYG GL + V    A F +D        L + + GP +A+    D G+G CSV Y+ K PG Y + + +      EH+K SPF   +
Sbjct:    7 KREDGDNKEETPKQKLLNWIRNRLPVSGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATKPIIMKPKVQATISNLDKIL---------QVNDPREFDLKLSRDG-FKPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGFIHVDVAANDVHTFETQTIPEASVICQVVPIARLLDYNKTA-----------KVGDDVKFAVVDAIEGP--VEAIVVDPTGKEHRMVILDGTSPGEHSF--EYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK------VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIE--SHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIP--FRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGE-EI--SPIEINVKPNVDVSGIRVEGLE--------NENLLI----GSHLRPTINIGKLEPKSKGLQLIDEVNG------------KRYNVPMKINPDGTY----------------STDTPLMEVGEHKL-QLLFDE--IPVKEAVVEVIKGTDV------NKCK----------------------------AYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVV 885          

HSP 3 Score: 275.404 bits (703), Expect = 1.020e-73
Identity = 325/1359 (23.91%), Postives = 574/1359 (42.24%), Query Frame = 2
Query: 3809 SRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA---GEA-PLKVNVIDTATKSVKPAQIL-----PKS------TPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNT---QNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHY-TTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFY----NGQPITGSPFKFYVDSTIPSGQVTAYG---PGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSK-AEIQCIDNKNGT----CDVSYLPLAPGDYHIGIKF------MDKHIIG-----SPFTAKIFGEPKKRSQICVGTTSD------VPLRISET-DINNLNAIVISPTGREESCTLKRL-QNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGD--GLNDGMVNETCQF-----------------VVDTRNAGYGGLSLSIEGPSKVEIE-----CHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSL-TER---ILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPF-MLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX--------XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            S+IRA+G GLE GI  +P  F V++ G  +  L  ++EGP+ A+I C +  DG+  + Y P   G Y V +  + KHI  SPF + + + ++         GL+ + +RV       +D SK    GE  P +V+        V   +IL     P S      TPGLF+ T IP+     +I+V    + VPG+PF   V    +  K+ + G GV       + +K P+ FTI+   AG   +E+ +     E+V+LDV ++ DG+FT +Y    PG Y + V++  + +  SP  + V          +EG     + +G  +   +N    +    G+     V      VP  I  +  G  +      ++G +++QL+F++  IP   +++   +  +   + +   +    EQ+   +  E +V +     G     +   +  P+  +   R+ + G+G  +V+Y     G +E+ + +      + + GSPFK  VD      Q+T  G   P     +P      T  TKD     L +    PS  A++Q + +++ +     +V ++P    +  I I+       +D+ ++       P   KI  + KK S      T++      VP  + +  ++  + + V  P G+E    ++   QNG   +SF     GE+ V    +G+ +                A+RV +  +  G  + ++ E   F                 +   +   +  + +    P  V +E       + H     + +  T+ GT  ++V Y   +V    +   IG      +  ER   ++  +D  +  +     + N+   GY  ++  A V+ P+   E+ EII   D    +++ PK  G H +S+  +   + G+P +F V    DG      + G G++  +  +   FT+  + + A  LS++IEGP+K++I   DNKDG+C   +    PG+Y   +K   + V  SPF +L + E    S+                           ++GS +   +         ISA + SP   E+   +  +D  +  V F P E G H + V  +   +P +PF++           +V VSG G   G T + NE  VDTS AG G L+V++ GPSK +L C+E +SG     Y P  PG Y I+IK+  ++H+  SP  V  +G            KS  + +  I    ++      +  C  D      +   N   +D        +   +  P    +++ ++ LG   +Q+ +  + +G H L V + +  V GSPF+  V
Sbjct:  415 SKIRAFGAGLEGGIVNEPCVFDVEMNGESKD-LSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIE---------GLKPSATRVTG-----IDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV----DGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPD--GTYSTDTPLMEVGEHKLQLLFDE--IP---VKEAVVEVIKGTDVNKCKAYGPGLEQA---VVGEKAVFELDLD-GAGEGALSMEMRGPAKAES--RIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKD-----LPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV----------------AARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEA-IGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGW---ATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSH--------------------------LSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG------------KSAGRVIQTIQKDVEQ------HGICLPDQESHLFLKLLNTSPMD--------ITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTV 1661          

HSP 4 Score: 209.149 bits (531), Expect = 1.457e-53
Identity = 223/883 (25.25%), Postives = 379/883 (42.92%), Query Frame = 2
Query: 1964 DCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTG-QTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNG-----------DGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDN--DFKKYKINNLNNTTPIG-QLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPY----------KVIATDRVNTKEY----PETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQ--RSNFEPNEEIIYPVQRTNEKAELR---------------KPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDG-TYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIH-----------------DIV----------------DVSKVKCYGPGLERNGSRVF--TPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTY-IPENIGNCEIEVLYNNMQVPGSPF 4354
            + +DN DG+  V Y P V G + + IL +   +  +P    I+     +     T YGPGL + +   +PA F V  K     S  K     + G     ++I DN DGT S  + P +PG++ V V  G   + +SPF+V V+           G G +R+  ++            + ++ + +  ++++ +       G           DG              + I +      +P++PFK+ ++     D  K +++       I  Q NE  + T   G      + V+ P  S+  +  +E  +G +   +TPT  G + + ++   + + +SP           +VI T + + +++    P+ E+ L +        K  N   + + +  + P   ++     +  +Q  +  F P  E I+ +    + A +                   V A G+G+V+G   T  +F I   E     + VTIEGP +A +++ D+ DG C V+Y    PG Y+V V +ND+HI DSPF V I P T     +  +     +G G+ P G    +F+ FTV    +    KG ++A +  P N+  T  +    DG +Y+  + P   G H I +T DG P+ +SP+ + V      DP+ I A G GL +G T Q  +F ++   AG G L + ++GP+ A +  ++ + G   V+Y P  PGSY  S+K+N  H PGSPF +P+                  D V                D +KV   G GL    ++ F   P+ F +D   AG   L V V+   TK      ++     G +  +Y IP+ +    + + Y + ++PGSPF
Sbjct: 1249 EIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTP----IKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKG----SQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVM-----------GEGQKRSHLSV----------GSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGL-SVSVQGP--SKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFL--------KLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPAT---GEVRKLELAQFHGQGI-PAG---KAFT-FTV----LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGL----NKFFPGRPAAFQIDTGLAGTNLLMVGVV--TTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGF-VFIKYGDKEIPGSPF 2070          

HSP 5 Score: 202.216 bits (513), Expect = 2.354e-51
Identity = 234/854 (27.40%), Postives = 345/854 (40.40%), Query Frame = 2
Query: 3218 TAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----GEAPLKVNVIDTATKSVKPAQILPKSTPG----------LFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCE--PEKVIVTGEG-VRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPF---IVPVHSEA-KPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGP-----VGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQ-PSESGL--HELE------------------VFYNGQPITGSPFKFYVD----------------------------STIP-----SGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAV---EGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT 5524
            T YG GL   V   PA+F + +       L V+IEGP +++I   DN DGTCS  ++P  PG Y V+V    + +KDSPF V +  + +  S++                     S    +  A PI       + A I +P      C V     G    S++P   G+H I +  DG  V K+P+ + V   Q  D S++   G G  +GIT Q  +  VD   AG GGL +S++GP+ A++ C + K G   V Y P +PG Y ++IKF + H+  SP T           V+C G    ++  RV    Q  V+         E+ L + +++T+   +    + PK               + + + P+  G   + V+Y +  V GSPF   V +  E    KV   G+G VR   G   A      F I  R+AG   + + + GP+  +  L+  +H DG     YK   PG Y V V + ++++P SPF   I P   E  K E     G     +P GK  T  V T  A  G L AK V P       +IVP   + E Y    + +VP++ G + + +  +        +R+  F+ +              +   P   T  S        G        V+N            N G G +TVQ   PS++ L  +ELE                  V YNG    GSPFK  V+                            + +P     + +VTA G GL+   P   A F I T  AG   L + V   +GP + E+      +G    SY         + IK+ DK I GSPF 
Sbjct: 1299 TVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHL---------------------SVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLT-----------VQCTG----KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNA------FNIYHREAGVGAVAVTIEGPSKAT--LEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIE-DGESYA---MRFVPKETGNHFIHVTLD-----GAPMRESPFRLRVG----------GKDLCDP---TAISASGDGLVKGTTGQKCEFVINTA----------NAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFA 2071          

HSP 6 Score: 168.703 bits (426), Expect = 3.119e-41
Identity = 331/1505 (21.99%), Postives = 569/1505 (37.81%), Query Frame = 2
Query: 3350 IDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPF-NQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP----QKFTVD-LEGAGQGGLGLSIEGPADAQ----IQCFDNKDGTCSVQYLP-QKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNV---LNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDL--ELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYI-----EGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENI--------PNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKF----MDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISE-----TDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNA----------SRVKLYGDGLNDGM--------VNETCQFVVDTRNAG-YGGLSLSIEGPSKVEIECH---DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGS-PFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTA--SVISPSGSFEMCEIIALSDNQF----SIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPL----IDGGPHKVHIMGS-GVERGLANDANQFTIYTREAGAGSLSIAIEGPS-KAEI-DFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQ---YSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNC-----QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +++ +    V + P + G   V+V  ND H     F     P+      +  +A++  Y    N T    D      V+A       +G V+AI+ +P   +     +D    G +S  Y     G H +++ +  +P+  SP+ +   +G   +  + +G G+  EGI K         ++D  E      + L +  P+D         ++++  +   +Y P Q P   +V +K   + I      V        SK++ +G GLE  G  V  P  F V+ +  GE+      ++  +K+    Q  P  +  L   +Y P   G  ++ VL +   +  SPFV  V   +   +P    VT  G+   + + +  K+P  F ++TR  G  DL  ++ +  P    ++        G F      D P  + + V     +VPG+PF V V       +  I     +GP+ ++ P   T    ++   AG G +        G  V   + + + G  TV Y  Q+ GAY++ ++F  E I        PN  +     +  E  ++   +H          +R   ++   +    P    ++ +      R +VP  IN  DGT +      E G H+L++ ++  P+  +  +    + +   +  AYGPGL        A F +    AG G LS+ + GP+KAE +  D  NG C V Y+  APGDY + IKF      +H+ GSPF A +    K  SQI +        R+++      D +    + +  T   +   L+ +      +S +P     H V  + SG+   + P +I     +I               +K+  D   D +         +       D R+ G    +   + GP   E   H      +G   V++     G Y +        V    P      G     + E I+ H + AE S    V   N  I    ++   A   + +   +  +  I  L DN       I F   +LG +T+ V     HV    ++  +G L    I     KV +     V++       QF +         L   +  P+ K E+ +  DN DG+  V Y     G +  SI  N   + G+P    +D                 + D  + ++     Q   +G  A F +   G     +S  +  P+ K Q+    KI +N+    S  +VP   G + VHV +    +  SPFRV+V           H   G  +E  +  +      ++ +I  P  ++  C          G +FT  P   G++ I++K  G   +  +PF + +                           TQ G +    V+  G G       + NE +VD   AG   L V V GP +   E+  K + +   +V Y   E G + + +++ +H V  SP  +
Sbjct:  177 VEDKENAYKVKFTPTKIGFIHVDVAANDVHT----FETQTIPEASVICQVVPIARLLDY----NKTAKVGDDVKFAVVDAI------EGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPL---RGKPKNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLE--GGIVNEPCVFDVEMN--GESKDLSFAVEGPSKAEIGCQERPDGSAIL---SYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVT--GIDESKVYNVGEKIP--FRVDTRLCG-VDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFT----IDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEISPIEINVKPNVDVSGIRVEGLENENLLIGSH----------LRPTINIGKLE----PKSKGLQLIDEVNGKRYNVPMKINP-DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDV--NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLPVKATVPSDFAQLQPV------VSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSP--TVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE-AIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA----------------YGDG-WATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPA-KSQI----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRS---HLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFT--PREAGEHLITVKRDG-KLVPKAPFKIKVD-------------------------KTQVGDAS--KVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSK--AELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTV 1561          

HSP 7 Score: 135.191 bits (339), Expect = 4.940e-31
Identity = 130/546 (23.81%), Postives = 238/546 (43.59%), Query Frame = 2
Query:  926 KTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNV-KNAAGDPSKVTASG----PGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIE--YTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDV-AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES---KIKAFGPGLTGGIVSKPAFFEV-ETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDG-TYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            K +  RV   G G +    ++G+ +   +         +   + +P G +EPC +       L    S+ P   GE+ I +K     +P +PFK+ V K   GD SKV  SG     GI    NE        V T++AG G +   +      +   K ++T +     LI+  YT  E G++++ + FA   ++ SP  V  + K++    +      + ++  G+ + D  +   +   +    D+   +  P    +  +++ +    Y+  + P+  G + + + Y +  ++ SPF   V  + E    K++A G G+  G       F +       GA+  +I+GPS+A ++  D+ DG+ +V Y    PGEY V +  +D++IP SP+   I   T     L++  +      GI   K   F V T  A     ++A+      +   + I    DG +Y+ R+ PK  G H + V+     + ESPF++ V   +  +   I   G G+ +  T  +  FV++   AG+G + + +
Sbjct: 1374 KDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLG--VSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE------LLVDTSKAGYGGLSVSV------QGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSA---GRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA--KGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQM 1897          

HSP 8 Score: 132.494 bits (332), Expect = 3.066e-30
Identity = 196/870 (22.53%), Postives = 328/870 (37.70%), Query Frame = 2
Query: 1304 FNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVE---TNGETGALGFSIKGPSEAKIDCVDN--GDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLD-TKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAG---------SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI---ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPYKVI---ATDRVNTKEYPE------------TETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNF--------EPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTI---------YPDTKSSSNID------------------DVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSY 3706
            FNV      P  ++ +++    +K+  +  I    +   L++YT K  G H +++   G Q+Q +P    V +          +AT  G   +   V + A F V  + +   +L V++ GP +S  K    K   C    +++P  PG Y V +K G   +  SPF V V           G G     +S  +  EV    T  E   +  SIK P   +  C       G   V++ P   GE+ + +  D + +PK+P+  +I++D T++ D  KV   G G   GI T +  + +V+T  AG          PS  +  C +V              G     YTP  PG + + + + + ++ +SP  V          I+     +E+    +   E++  +        DI   ++D K     +   D G   +            +T+ + + +A +  SPF+  + S ++   +K+         G+   F     +        + V     S+  ++ ++ N+G     +     G + V V+     I +SP+KV    AT  V   E  +            T T L   A   ++ K    P+  V +  + P+E           K+  N          P  E  + + R   K       ++A G+GLVKG       F+I++       L V ++GP +A +D  +   G   V Y P  PGSY  +V YN  H   SPF + +         Y +T S   ID                  D AKVTA G GLN    F    + F ++       G  ++   +           V +   G Y CSY
Sbjct: 1222 FNVRDLGYQPKDLEAIVMPPTQKKEVAE--IIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD------GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTC--SAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----------MGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPF--KIKVDKTQVGDASKVEVSGSGKAKGI-TLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEV------------KSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQ-QYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVT-PNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRL-RVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNET-SHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNK--FFPGRPAAFQIDT---GLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSY 2046          

HSP 9 Score: 122.479 bits (306), Expect = 3.142e-27
Identity = 201/876 (22.95%), Postives = 347/876 (39.61%), Query Frame = 2
Query:  953 YGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVD--CVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG--------------------ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFD---PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQT-IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA-GNAANIKV---YGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINN-----LNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLG---VTIEGPM-EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNV 3463
            YGPGL+     +G PA FTV    +    L + +  P   K   +I D  NK+   S +++P + GEY++ +K     + +SPF+V V       S ++        V   + ++    +  +   PG ++  C +    G               +  + +T +E G H + V   G  +  +PF + V  KT   DA +   +G G + +G+ ++   E  V T  AG+  L V+V GP ++   C  K+V   L +  Y P  PG Y + IK+ ++ +  SP  V               G + G V +    +VE +G                    +  A     KG ++  I+  D G     + + P + G + + ++  D ++  SP+    Q     F      KV A G G++ G  T     F +  + AG    V A    + G +   ++ +D+NDG     Y    PG++ V V + + +IP+SPFKV +  A G    +++   +G GI   K    T+ V+  +  G  +  +   + ++  + +V  +  DG              + I +    A + +SPF++ +   +      I+      +  TT  GQ  EF I T   G+ +   + V+    S+  +   E   G+   +TP   G +  +V+  G     SP+K+     V  KE               +    YN+ S      K+  V +++  T +               + P  + +         VTA G GL K     PA+F ID+       L    VT +GP  E  + +  +G   CS     +  G   V + Y D+ I  SPF +
Sbjct: 1301 YGPGLQ--NAVVGEPATFTVCAKGSQAKELSVSIEGP--AKSQIKIHD--NKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG--STSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDG--------------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKV-DKTQVGDASKVEVSGSG-KAKGITLQ-ANELLVDTSKAGYGGLSVSVQGPSKAELTC--KEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCT------------GKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTD-DIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPF----QFTVGSFSEGGAHKVRAAGQGVVRG-ETGTFNAFNIYHREAG----VGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAF--TFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIE--DGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTT--GQKCEFVINTANAGAGI---LTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKI----PVEGKE---------------LGGNGYNETS----HVKIDAVAKTSKGTVA---------------VVPEYQGDAA------KVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKG--FVFIKYGDKEIPGSPFAI 2072          

HSP 10 Score: 105.531 bits (262), Expect = 4.786e-22
Identity = 90/370 (24.32%), Postives = 162/370 (43.78%), Query Frame = 2
Query: 1424 IEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGF--ADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            I +T  + G ++++VF+ G  +    +  +   +     A++A       + +  +     +FQ +  D G+   DL   V  P +  E  +I           Y P+  G + + I      +  +P    V  Y +     +GPGL   +V +PA F V   G +   L  SI+GP++++I   DN DG+ +  + P VPGEY VH+    + +  SP+   +  + +    L V           ST++ A  I   +  G  +++K+      G   P  +R  + G     +TP+  G+H + V      +P++PFK+ V   + G+A+ ++V G G  +  T      +VD   AG G + +SV
Sbjct: 1159 IVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEK-EDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG----------STSEVALPITQQELKGISASIKSPG----GIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSV 1513          

HSP 11 Score: 103.219 bits (256), Expect = 2.798e-21
Identity = 125/476 (26.26%), Postives = 198/476 (41.60%), Query Frame = 2
Query:  986 IGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSC----------SYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIE-PVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES-----------KIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILC----DDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGIST-----NKPADFIVNT-KNAGSPSTVKAECFDVTGQTIPVQIRD-NNDGTYSCRYTP 2311
            +G   PF VDT   G      + L PK      EI D     ++Y            + IP    +++I +  A   +P +PF V VK    D SK+   GPG++ PV ++    T F +   +AGPG+V+  + D +G  ++V   +    +  F ++YT +  G + +NV FAG +I  SP  + V      S               G+RV  +    +         + +    P +S     I +V+   Y         G Y  D        H      D  P KE+           K KA+GPGL   +V + A FE++ +G   GAL   ++GP++A+    D G+G  +V Y    PG+Y + I        E++  SP+ A +       DP ++T      ISG+       N+P +F+++T K    P  VKA       Q  PV  R  +N   ++ R+ P
Sbjct:  525 VGEKIPFRVDTRLCG------VDLVPK-----VEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPT-DASKLKIFGPGVDGPVYSK--EPTRFTIDATQAGPGAVEVALRDDQG--ENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVS---------------GIRVEGLENENLLIGSHLRPTINIGKLEP-KSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK---DPSQIT------ISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRSPSNPRHHNVRFVP 955          

HSP 12 Score: 73.559 bits (179), Expect = 2.651e-12
Identity = 111/492 (22.56%), Postives = 215/492 (43.70%), Query Frame = 2
Query:  929 TNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNE---VGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNP----IHLSPFNVDVAPYKE--SKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSE-AKIDCVDNGDGS----ANVTYWP------TVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDN-NDGTYSCRYTPKIPGKHTVI 2338
            T++ +++ +GPG++    +   P  FT+D   AG G +++ + + +G+    ++ D  N++ +++  Y     G Y++ + FA  EI  SP ++NVK        V  SG  +E + NE   +G      +   +  P S    ++D   G++ +V  KI    +  +  +    E G H + + F  + ++ +   V+       +D  +  A G G+  E   V + A F++  + AG   L + + GP ++  + Q +    C  E  Y+ + PG Y + IK+G +     +  SPF   V  YK+  S+I   G       +++P  F ++T+ +T  L      PS+ A++  V +   S     NV + P      ++P E     L  DE + K     + QL   L D  K +     + +  S      F  + ++ G+   +++  F   G+     +R    +G Y   +   + G++ V+
Sbjct:  604 TDASKLKIFGPGVDGPVYS-KEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLD--NQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK------PNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKIN--PDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVI-----KGTDVNKCKAYGPGL--EQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVE--YVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTS-KTKDLPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPF--DVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVV 1069          

HSP 13 Score: 65.4698 bits (158), Expect = 6.403e-10
Identity = 82/310 (26.45%), Postives = 128/310 (41.29%), Query Frame = 2
Query:  974 EGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA-AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSK---------TSNSDAKQAYATGRGI-------QPEGVRVRDV------------AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSY-IPQRPGPYVVDIKYGNNPIHLSPFNVD 1813
            +G   G    FTV T  A KG+L+  V+ P  + +  +I    + E +Y+  ++P   G + I +    + +  SPF++ V      DP+ ++ASG G+  V    G++  F + TA AG G     IL  +    S       + E  + + YT    G +  +V + G+    SPF + V  K         TS+        T +G        Q +  +V               A FQ+ T  AG   L V V       E+  ++      Y CSY IP R   +V  IKYG+  I  SPF ++
Sbjct: 1774 QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIEDGE-SYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGL--VKGTTGQKCEFVINTANAGAG-----ILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVF-IKYGDKEIPGSPFAIE 2073          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 489/1511 (32.36%), Postives = 764/1511 (50.56%), Query Frame = 2
Query: 3251 ANTPASFIIDSTEEPPAPLGVTIEGPM--EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKF----NEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEI--EVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVR------------PHRGHLIANKVPSLFTINTRDAGE-SDLELMVTGPN-NESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSE-------AKPEQCYIEGPILNEVPVGKTVTIPVNTQNA----GDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPV---GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKI-DNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX--------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSN----------DSIRET-KSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +  P  F ID+T+  P  + V +         +D +DN DG+ +V Y  + PG+Y +NV++  E I  SP  + + P+        DV+ +     GL    +   S  + T+N   ++   KG+   +I     +R    +  N DGTYS        G+HK+ + +D +PV ++   V V +G+D ++ +AYGPGLE+ +  +   F +DL+GAG+G L + + GPA A+ +  D  +G CSV+Y+ + PG Y+++IKF     ++H+ GSPF   +    D S++     GL++   R+  P  F +D SK  + P+K  V  +    ++P      S P   +V ++P    N  I  E++Y+ +++     +  VL   EP+ + +  +  +             H GH     VP     + RD G    +E  V GP+  E +N       +G +   +  D+ G Y V      + V      VPV +E          E+      I    P   T   P++ +         +L+AK        +   ++N       + +   K+G   + + +  E++ +           E+   ER       E        +Y    F+F V   G     + A+V  P+ +K+V  +I+N DGTI V+Y P   G HEL +  NG  + G+P KFYVD+    G  T YGPGL        A FT+  K + A  LS+++EGP+K++I+  DNK+GTC  +++P  PG+Y + +K   K +  SPF   + GE +KRS + VG+TS+V L I++ ++  ++A + SP G EE C ++ L  G LG+SFTP+E GEHL+ V R G+ +P +PFKI V + ++G+AS+V++ G G   G+  +  + +VDT  AGYGGLS+S++GPSK E+ C +   G   V Y PTEPG Y I +K+AD +V  SP  V   G  +  + + I +  +   +        L L +   +  + TA ++ P G  +  E+  L    + ++F PK  G+HT+SV   + HV GSPFQFTVG   +GG HKV   G GV RG     N F IY REAG G++++ IEGPSKA ++F+D+ DG+C V Y+V  PG+YV ++KFND+H+P SPF +         Y  P   E       R + +A    QG   G    F +  H    G + A V++P+N+     I  I D   Y++ FVP E G H +HV ++ +P+  SPFR+ V          ++ SG+G+  G TG+  EF ++T+NAG G LTV +DGPSK  L+  E E GY   Y P APG Y  S+KY G  H  GSPF + + G     N          D++ +T K     V    G   K       V  +G GL     G+   F +D GLAG ++L VGV     PCEEV ++H G+  +  +Y + ++ +  + +++G+ ++PGSPF I
Sbjct:  620 SKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNV-------DVSGIRV--EGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITI--SGLDQPNYRLNQPINFVIDTSKTKDLPVKATV-PSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEK--LVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGH-----VP----FDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAAR---VPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEKEDDVDKYEKQYK---FQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA-YGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKV---------YIAPATGE------VRKLELAQFHGQGIPAGKAFTFTVLTH-RAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAK-------VTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAI 2070          

HSP 2 Score: 325.865 bits (834), Expect = 4.218e-89
Identity = 293/992 (29.54%), Postives = 449/992 (45.26%), Query Frame = 2
Query:  563 NQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIK------FANSEIPNSPFKVNVKNAAG--DPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDS-VKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHT----EDAGFADLGVNVYGP--GRSLEKCQIKKVSPCLYECSYIP-QRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDP--LKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE-TYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLY----NDEHIKDSPFNVTI 3469
             ++DG  K  +PKQ+LL WI +++P  P+ NFT+DWNDG A+GALV++ APG   +W  W P  AL+N ++A+ +A++ L VAPLI P EMI+P++DE ++MTYLSQFP  +     P +  T S   +            + +P  F +     G     + + +  GQ     +    +KE AY   + PT  G   + +       F    IP +     V   A   D +K             +VG    F V  A  GP  V+ +++D  G++   V    T   E+ F  EY     GLHSVNVF   + +  SPF +    K S          GRGI PEG+R  DV    V +    E+   A++ + V  P  G  L             +  Y P Q P    V +K     I      + VAP   SKI+AFG GL GGIV++P  F+VE NGE+  L F+++GPS+A+I C +  DGSA ++Y PTV G Y V +L D ++I  SP++ ++    +   P   +VT      +  +    P  F V+T+  G     K E  D     I    R+   G +     P  P KH + VS   V++P +PF V V E  +A+ +K++GPG++    + E T F +D   AG G + +++ D++  +V +   DN DG+FT+KYT +  G      +F  E EI  SP ++ ++ + D    ++  L         NE  ++    GS +RP I +         ++L +  NG                V  K NP G                   T+TPL+   ++ +    +++  IPV+ A +  ++ ++V      NK +                            AYG GL + V    A F +D        L + + GP +A+    D G+G CSV Y+ K PG Y + + +      EH+K SPF   +
Sbjct:    7 KREDGDNKEETPKQKLLNWIRNRLPGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATKPIIMKPKVQATISNLDKIL---------QVNDPREFDLKLSRDG-FKPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGFIHVDVAANDVHTFETQTIPEASVICQVVPIARLLDYNKTA-----------KVGDDVKFAVVDAIEGP--VEAIVVDPTGKEHRMVILDGTSPGEHSF--EYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK------VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIE--SHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVGEKIP--FRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGE-EI--SPIEINVKPNVDVSGIRVEGLE--------NENLLI----GSHLRPTINIGKLEPKSKGLQLIDEVNG------------KRYNVPMKINPDGTY----------------STDTPLMEVGEHKL-QLLFDE--IPVKEAVVEVIKGTDV------NKCK----------------------------AYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVV 883          

HSP 3 Score: 275.789 bits (704), Expect = 8.383e-74
Identity = 325/1359 (23.91%), Postives = 574/1359 (42.24%), Query Frame = 2
Query: 3809 SRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA---GEA-PLKVNVIDTATKSVKPAQIL-----PKS------TPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNT---QNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHY-TTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFY----NGQPITGSPFKFYVDSTIPSGQVTAYG---PGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSK-AEIQCIDNKNGT----CDVSYLPLAPGDYHIGIKF------MDKHIIG-----SPFTAKIFGEPKKRSQICVGTTSD------VPLRISET-DINNLNAIVISPTGREESCTLKRL-QNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGD--GLNDGMVNETCQF-----------------VVDTRNAGYGGLSLSIEGPSKVEIE-----CHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSL-TER---ILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPF-MLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX--------XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            S+IRA+G GLE GI  +P  F V++ G  +  L  ++EGP+ A+I C +  DG+  + Y P   G Y V +  + KHI  SPF + + + ++         GL+ + +RV       +D SK    GE  P +V+        V   +IL     P S      TPGLF+ T IP+     +I+V    + VPG+PF   V    +  K+ + G GV       + +K P+ FTI+   AG   +E+ +     E+V+LDV ++ DG+FT +Y    PG Y + V++  + +  SP  + V          +EG     + +G  +   +N    +    G+     V      VP  I  +  G  +      ++G +++QL+F++  IP   +++   +  +   + +   +    EQ+   +  E +V +     G     +   +  P+  +   R+ + G+G  +V+Y     G +E+ + +      + + GSPFK  VD      Q+T  G   P     +P      T  TKD     L +    PS  A++Q + +++ +     +V ++P    +  I I+       +D+ ++       P   KI  + KK S      T++      VP  + +  ++  + + V  P G+E    ++   QNG   +SF     GE+ V    +G+ +                A+RV +  +  G  + ++ E   F                 +   +   +  + +    P  V +E       + H     + +  T+ GT  ++V Y   +V    +   IG      +  ER   ++  +D  +  +     + N+   GY  ++  A V+ P+   E+ EII   D    +++ PK  G H +S+  +   + G+P +F V    DG      + G G++  +  +   FT+  + + A  LS++IEGP+K++I   DNKDG+C   +    PG+Y   +K   + V  SPF +L + E    S+                           ++GS +   +         ISA + SP   E+   +  +D  +  V F P E G H + V  +   +P +PF++           +V VSG G   G T + NE  VDTS AG G L+V++ GPSK +L C+E +SG     Y P  PG Y I+IK+  ++H+  SP  V  +G            KS  + +  I    ++      +  C  D      +   N   +D        +   +  P    +++ ++ LG   +Q+ +  + +G H L V + +  V GSPF+  V
Sbjct:  413 SKIRAFGAGLEGGIVNEPCVFDVEMNGESKD-LSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIE---------GLKPSATRVTG-----IDESKVYNVGEKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGV----DGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKINPD--GTYSTDTPLMEVGEHKLQLLFDE--IP---VKEAVVEVIKGTDVNKCKAYGPGLEQA---VVGEKAVFELDLD-GAGEGALSMEMRGPAKAES--RIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKD-----LPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEV----------------AARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYEA-IGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGW---ATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSH--------------------------LSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKF-ADHHVKDSPLTVQCTG------------KSAGRVIQTIQKDVEQ------HGICLPDQESHLFLKLLNTSPMD--------ITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTV 1659          

HSP 4 Score: 209.534 bits (532), Expect = 1.305e-53
Identity = 223/883 (25.25%), Postives = 379/883 (42.92%), Query Frame = 2
Query: 1964 DCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTG-QTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNG-----------DGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDN--DFKKYKINNLNNTTPIG-QLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPY----------KVIATDRVNTKEY----PETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQ--RSNFEPNEEIIYPVQRTNEKAELR---------------KPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDG-TYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIH-----------------DIV----------------DVSKVKCYGPGLERNGSRVF--TPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTY-IPENIGNCEIEVLYNNMQVPGSPF 4354
            + +DN DG+  V Y P V G + + IL +   +  +P    I+     +     T YGPGL + +   +PA F V  K     S  K     + G     ++I DN DGT S  + P +PG++ V V  G   + +SPF+V V+           G G +R+  ++            + ++ + +  ++++ +       G           DG              + I +      +P++PFK+ ++     D  K +++       I  Q NE  + T   G      + V+ P  S+  +  +E  +G +   +TPT  G + + ++   + + +SP           +VI T + + +++    P+ E+ L +        K  N   + + +  + P   ++     +  +Q  +  F P  E I+ +    + A +                   V A G+G+V+G   T  +F I   E     + VTIEGP +A +++ D+ DG C V+Y    PG Y+V V +ND+HI DSPF V I P T     +  +     +G G+ P G    +F+ FTV    +    KG ++A +  P N+  T  +    DG +Y+  + P   G H I +T DG P+ +SP+ + V      DP+ I A G GL +G T Q  +F ++   AG G L + ++GP+ A +  ++ + G   V+Y P  PGSY  S+K+N  H PGSPF +P+                  D V                D +KV   G GL    ++ F   P+ F +D   AG   L V V+   TK      ++     G +  +Y IP+ +    + + Y + ++PGSPF
Sbjct: 1247 EIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTP----IKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKG----SQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVM-----------GEGQKRSHLSV----------GSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGL-SVSVQGP--SKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFL--------KLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPAT---GEVRKLELAQFHGQGI-PAG---KAFT-FTV----LTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGL----NKFFPGRPAAFQIDTGLAGTNLLMVGVV--TTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGF-VFIKYGDKEIPGSPF 2068          

HSP 5 Score: 202.216 bits (513), Expect = 1.987e-51
Identity = 232/850 (27.29%), Postives = 342/850 (40.24%), Query Frame = 2
Query: 3218 TAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----GEAPLKVNVIDTATKSVKPAQILPKSTPG----------LFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCE--PEKVIVTGEG-VRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPF---IVPVHSEA-KPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHS-TVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQ-PSESGL--HELE------------------VFYNGQPITGSPFKFYVD----------------------------STIP-----SGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAV---EGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT 5524
            T YG GL   V   PA+F + +       L V+IEGP +++I   DN DGTCS  ++P  PG Y V+V    + +KDSPF V +  + +  S++                     S    +  A PI       + A I +P      C V     G    S++P   G+H I +  DG  V K+P+ + V   Q  D S++   G G  +GIT Q  +  VD   AG GGL +S++GP+ A++ C + K G   V Y P +PG Y ++IKF + H+  SP T           V+C G    ++  RV    Q  V+         E+ L + +++T+   +    + PK               + + + P+  G   + V+Y +  V GSPF   V +  E    KV   G+G VR   G   A      F I  R+AG   + + + GP+  +  L+  +H DG     YK   PG Y V V + ++++P SPF   I P   E  K E     G     +P GK  T  V T  A  G L AK V P   +    I     G S  + +VP++ G + + +  +        +R+  F+ +              +   P   T  S        G        V+N            N G G +TVQ   PS++ L  +ELE                  V YNG    GSPFK  V+                            + +P     + +VTA G GL+   P   A F I T  AG   L + V   +GP + E+      +G    SY         + IK+ DK I GSPF 
Sbjct: 1297 TVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHL---------------------SVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLT-----------VQCTG----KSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNA------FNIYHREAGVGAVAVTIEGPSKAT--LEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLD-----GAPMRESPFRLRVG----------GKDLCDP---TAISASGDGLVKGTTGQKCEFVINTA----------NAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCE-EVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFA 2069          

HSP 6 Score: 169.088 bits (427), Expect = 2.504e-41
Identity = 331/1505 (21.99%), Postives = 569/1505 (37.81%), Query Frame = 2
Query: 3350 IDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPF-NQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP----QKFTVD-LEGAGQGGLGLSIEGPADAQ----IQCFDNKDGTCSVQYLP-QKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNV---LNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDL--ELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYI-----EGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENI--------PNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKF----MDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISE-----TDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNA----------SRVKLYGDGLNDGM--------VNETCQFVVDTRNAG-YGGLSLSIEGPSKVEIECH---DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGS-PFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTA--SVISPSGSFEMCEIIALSDNQF----SIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPL----IDGGPHKVHIMGS-GVERGLANDANQFTIYTREAGAGSLSIAIEGPS-KAEI-DFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQ---YSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNC-----QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            +++ +    V + P + G   V+V  ND H     F     P+      +  +A++  Y    N T    D      V+A       +G V+AI+ +P   +     +D    G +S  Y     G H +++ +  +P+  SP+ +   +G   +  + +G G+  EGI K         ++D  E      + L +  P+D         ++++  +   +Y P Q P   +V +K   + I      V        SK++ +G GLE  G  V  P  F V+ +  GE+      ++  +K+    Q  P  +  L   +Y P   G  ++ VL +   +  SPFV  V   +   +P    VT  G+   + + +  K+P  F ++TR  G  DL  ++ +  P    ++        G F      D P  + + V     +VPG+PF V V       +  I     +GP+ ++ P   T    ++   AG G +        G  V   + + + G  TV Y  Q+ GAY++ ++F  E I        PN  +     +  E  ++   +H          +R   ++   +    P    ++ +      R +VP  IN  DGT +      E G H+L++ ++  P+  +  +    + +   +  AYGPGL        A F +    AG G LS+ + GP+KAE +  D  NG C V Y+  APGDY + IKF      +H+ GSPF A +    K  SQI +        R+++      D +    + +  T   +   L+ +      +S +P     H V  + SG+   + P +I     +I               +K+  D   D +         +       D R+ G    +   + GP   E   H      +G   V++     G Y +        V    P      G     + E I+ H + AE S    V   N  I    ++   A   + +   +  +  I  L DN       I F   +LG +T+ V     HV    ++  +G L    I     KV +     V++       QF +         L   +  P+ K E+ +  DN DG+  V Y     G +  SI  N   + G+P    +D                 + D  + ++     Q   +G  A F +   G     +S  +  P+ K Q+    KI +N+    S  +VP   G + VHV +    +  SPFRV+V           H   G  +E  +  +      ++ +I  P  ++  C          G +FT  P   G++ I++K  G   +  +PF + +                           TQ G +    V+  G G       + NE +VD   AG   L V V GP +   E+  K + +   +V Y   E G + + +++ +H V  SP  +
Sbjct:  175 VEDKENAYKVKFTPTKIGFIHVDVAANDVHT----FETQTIPEASVICQVVPIARLLDY----NKTAKVGDDVKFAVVDAI------EGPVEAIVVDPTGKEHRMVILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPL---RGKPKNSFKVWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPE---SSSKIRAFGAGLE--GGIVNEPCVFDVEMN--GESKDLSFAVEGPSKAEIGCQERPDGSAIL---SYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVT--GIDESKVYNVGEKIP--FRVDTRLCG-VDLVPKVEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFT----IDATQAGPGAVEVALRDDQGENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEISPIEINVKPNVDVSGIRVEGLENENLLIGSH----------LRPTINIGKLE----PKSKGLQLIDEVNGKRYNVPMKINP-DGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDV--NKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTSKTKDLPVKATVPSDFAQLQPV------VSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVVFYINGQEVAARVPVMAEKIGRKEDVIKEEIVFHPEIAEHSP--TVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE-AIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDA----------------YGDG-WATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPA-KSQI----KIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRS---HLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFT--PREAGEHLITVKRDG-KLVPKAPFKIKVD-------------------------KTQVGDAS--KVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSK--AELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTV 1559          

HSP 7 Score: 135.191 bits (339), Expect = 4.578e-31
Identity = 130/546 (23.81%), Postives = 238/546 (43.59%), Query Frame = 2
Query:  926 KTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNV-KNAAGDPSKVTASG----PGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIE--YTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDV-AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES---KIKAFGPGLTGGIVSKPAFFEV-ETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDG-TYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            K +  RV   G G +    ++G+ +   +         +   + +P G +EPC +       L    S+ P   GE+ I +K     +P +PFK+ V K   GD SKV  SG     GI    NE        V T++AG G +   +      +   K ++T +     LI+  YT  E G++++ + FA   ++ SP  V  + K++    +      + ++  G+ + D  +   +   +    D+   +  P    +  +++ +    Y+  + P+  G + + + Y +  ++ SPF   V  + E    K++A G G+  G       F +       GA+  +I+GPS+A ++  D+ DG+ +V Y    PGEY V +  +D++IP SP+   I   T     L++  +      GI   K   F V T  A     ++A+      +   + I    DG +Y+ R+ PK  G H + V+     + ESPF++ V   +  +   I   G G+ +  T  +  FV++   AG+G + + +
Sbjct: 1372 KDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLG--VSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANE------LLVDTSKAGYGGLSVSV------QGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSA---GRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHG---QGIPAGKAFTFTVLTHRA--KGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQM 1895          

HSP 8 Score: 132.88 bits (333), Expect = 2.702e-30
Identity = 196/870 (22.53%), Postives = 328/870 (37.70%), Query Frame = 2
Query: 1304 FNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVE---TNGETGALGFSIKGPSEAKIDCVDN--GDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLD-TKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAG---------SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI---ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFV-AGFTPTVIGPHTVTVECKGNPIGNSPYKVI---ATDRVNTKEYPE------------TETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNF--------EPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTI---------YPDTKSSSNID------------------DVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSY 3706
            FNV      P  ++ +++    +K+  +  I    +   L++YT K  G H +++   G Q+Q +P    V +          +AT  G   +   V + A F V  + +   +L V++ GP +S  K    K   C    +++P  PG Y V +K G   +  SPF V V           G G     +S  +  EV    T  E   +  SIK P   +  C       G   V++ P   GE+ + +  D + +PK+P+  +I++D T++ D  KV   G G   GI T +  + +V+T  AG          PS  +  C +V              G     YTP  PG + + + + + ++ +SP  V          I+     +E+    +   E++  +        DI   ++D K     +   D G   +            +T+ + + +A +  SPF+  + S ++   +K+         G+   F     +        + V     S+  ++ ++ N+G     +     G + V V+     I +SP+KV    AT  V   E  +            T T L   A   ++ K    P+  V +  + P+E           K+  N          P  E  + + R   K       ++A G+GLVKG       F+I++       L V ++GP +A +D  +   G   V Y P  PGSY  +V YN  H   SPF + +         Y +T S   ID                  D AKVTA G GLN    F    + F ++       G  ++   +           V +   G Y CSY
Sbjct: 1220 FNVRDLGYQPKDLEAIVMPPTQKKEVAE--IIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGD------GWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTC--SAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----------MGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPF--KIKVDKTQVGDASKVEVSGSGKAKGI-TLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEV------------KSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQ-QYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAFTFTVLTHRAKGHLEAKVVT-PNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRL-RVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG-YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNET-SHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNK--FFPGRPAAFQIDT---GLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSY 2044          

HSP 9 Score: 122.865 bits (307), Expect = 2.815e-27
Identity = 201/876 (22.95%), Postives = 347/876 (39.61%), Query Frame = 2
Query:  953 YGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVD--CVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG--------------------ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFD---PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQT-IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA-GNAANIKV---YGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINN-----LNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLG---VTIEGPM-EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNV 3463
            YGPGL+     +G PA FTV    +    L + +  P   K   +I D  NK+   S +++P + GEY++ +K     + +SPF+V V       S ++        V   + ++    +  +   PG ++  C +    G               +  + +T +E G H + V   G  +  +PF + V  KT   DA +   +G G + +G+ ++   E  V T  AG+  L V+V GP ++   C  K+V   L +  Y P  PG Y + IK+ ++ +  SP  V               G + G V +    +VE +G                    +  A     KG ++  I+  D G     + + P + G + + ++  D ++  SP+    Q     F      KV A G G++ G  T     F +  + AG    V A    + G +   ++ +D+NDG     Y    PG++ V V + + +IP+SPFKV +  A G    +++   +G GI   K    T+ V+  +  G  +  +   + ++  + +V  +  DG              + I +    A + +SPF++ +   +      I+      +  TT  GQ  EF I T   G+ +   + V+    S+  +   E   G+   +TP   G +  +V+  G     SP+K+     V  KE               +    YN+ S      K+  V +++  T +               + P  + +         VTA G GL K     PA+F ID+       L    VT +GP  E  + +  +G   CS     +  G   V + Y D+ I  SPF +
Sbjct: 1299 YGPGLQ--NAVVGEPATFTVCAKGSQAKELSVSIEGP--AKSQIKIHD--NKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG--STSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDG--------------GRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKV-DKTQVGDASKVEVSGSG-KAKGITLQ-ANELLVDTSKAGYGGLSVSVQGPSKAELTC--KEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCT------------GKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTD-DIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPF----QFTVGSFSEGGAHKVRAAGQGVVRG-ETGTFNAFNIYHREAG----VGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAGKAF--TFTVLTHRAKGHLEAKVVTPNNEVDTIDIVPIE--DGESYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTT--GQKCEFVINTANAGAGI---LTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKI----PVEGKE---------------LGGNGYNETS----HVKIDAVAKTSKGTVA---------------VVPEYQGDAA------KVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKG--FVFIKYGDKEIPGSPFAI 2070          

HSP 10 Score: 105.531 bits (262), Expect = 4.626e-22
Identity = 90/370 (24.32%), Postives = 162/370 (43.78%), Query Frame = 2
Query: 1424 IEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGF--ADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            I +T  + G ++++VF+ G  +    +  +   +     A++A       + +  +     +FQ +  D G+   DL   V  P +  E  +I           Y P+  G + + I      +  +P    V  Y +     +GPGL   +V +PA F V   G +   L  SI+GP++++I   DN DG+ +  + P VPGEY VH+    + +  SP+   +  + +    L V           ST++ A  I   +  G  +++K+      G   P  +R  + G     +TP+  G+H + V      +P++PFK+ V   + G+A+ ++V G G  +  T      +VD   AG G + +SV
Sbjct: 1157 IVFTATKLGTNTLDVFYGGEHVDHVEYEAIGKLEYERIQAERAKVVVEK-EDDVDKYEKQYKFQFNVRDLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVG----------STSEVALPITQQELKGISASIKSPG----GIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSV 1511          

HSP 11 Score: 103.219 bits (256), Expect = 2.465e-21
Identity = 125/476 (26.26%), Postives = 198/476 (41.60%), Query Frame = 2
Query:  986 IGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSC----------SYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIE-PVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES-----------KIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILC----DDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGIST-----NKPADFIVNT-KNAGSPSTVKAECFDVTGQTIPVQIRD-NNDGTYSCRYTP 2311
            +G   PF VDT   G      + L PK      EI D     ++Y            + IP    +++I +  A   +P +PF V VK    D SK+   GPG++ PV ++    T F +   +AGPG+V+  + D +G  ++V   +    +  F ++YT +  G + +NV FAG +I  SP  + V      S               G+RV  +    +         + +    P +S     I +V+   Y         G Y  D        H      D  P KE+           K KA+GPGL   +V + A FE++ +G   GAL   ++GP++A+    D G+G  +V Y    PG+Y + I        E++  SP+ A +       DP ++T      ISG+       N+P +F+++T K    P  VKA       Q  PV  R  +N   ++ R+ P
Sbjct:  523 VGEKIPFRVDTRLCG------VDLVPK-----VEILDPELNPISYGAREITPGLFEYTLIPDAPIKHKIDVSVAGVSVPGAPFSVKVKEPT-DASKLKIFGPGVDGPVYSK--EPTRFTIDATQAGPGAVEVALRDDQG--ENVDLDVLDNQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVKPNVDVS---------------GIRVEGLENENLLIGSHLRPTINIGKLEP-KSKGLQLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKK---DPSQIT------ISGLDQPNYRLNQPINFVIDTSKTKDLP--VKATVPSDFAQLQPVVSRSPSNPRHHNVRFVP 953          

HSP 12 Score: 73.559 bits (179), Expect = 2.585e-12
Identity = 111/492 (22.56%), Postives = 215/492 (43.70%), Query Frame = 2
Query:  929 TNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNE---VGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNP----IHLSPFNVDVAPYKE--SKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSE-AKIDCVDNGDGS----ANVTYWP------TVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDN-NDGTYSCRYTPKIPGKHTVI 2338
            T++ +++ +GPG++    +   P  FT+D   AG G +++ + + +G+    ++ D  N++ +++  Y     G Y++ + FA  EI  SP ++NVK        V  SG  +E + NE   +G      +   +  P S    ++D   G++ +V  KI    +  +  +    E G H + + F  + ++ +   V+       +D  +  A G G+  E   V + A F++  + AG   L + + GP ++  + Q +    C  E  Y+ + PG Y + IK+G +     +  SPF   V  YK+  S+I   G       +++P  F ++T+ +T  L      PS+ A++  V +   S     NV + P      ++P E     L  DE + K     + QL   L D  K +     + +  S      F  + ++ G+   +++  F   G+     +R    +G Y   +   + G++ V+
Sbjct:  602 TDASKLKIFGPGVDGPVYS-KEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLD--NQDGSFTVKYTAQRPGAYQLNVVFAGEEI--SPIEINVK------PNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGLQLIDEVNGKRYNVPMKIN--PDGTYSTDTPLMEVGEHKLQLLFDEIPVKEAVVEVI-----KGTDVNKCKAYGPGL--EQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVE--YVAKAPGDYEMAIKFGKDEQKEHVKGSPFKA-VVDYKKDPSQITISGLDQPNYRLNQPINFVIDTS-KTKDLPVKATVPSDFAQLQPVVSRSPSNPRHHNVRFVPSGKPNVSIPIEIIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPF--DVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSFPTDMAGEYCVV 1067          

HSP 13 Score: 65.4698 bits (158), Expect = 6.243e-10
Identity = 82/310 (26.45%), Postives = 128/310 (41.29%), Query Frame = 2
Query:  974 EGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA-AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSK---------TSNSDAKQAYATGRGI-------QPEGVRVRDV------------AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSY-IPQRPGPYVVDIKYGNNPIHLSPFNVD 1813
            +G   G    FTV T  A KG+L+  V+ P  + +  +I    + E +Y+  ++P   G + I +    + +  SPF++ V      DP+ ++ASG G+  V    G++  F + TA AG G     IL  +    S       + E  + + YT    G +  +V + G+    SPF + V  K         TS+        T +G        Q +  +V               A FQ+ T  AG   L V V       E+  ++      Y CSY IP R   +V  IKYG+  I  SPF ++
Sbjct: 1772 QGIPAGKAFTFTVLTHRA-KGHLEAKVVTPNNEVDTIDIVPIEDGE-SYAMRFVPKETGNHFIHVTLDGAPMRESPFRLRVGGKDLCDPTAISASGDGL--VKGTTGQKCEFVINTANAGAG-----ILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPVEGKELGGNGYNETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVF-IKYGDKEIPGSPFAIE 2071          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0303364)

HSP 1 Score: 1132.86 bits (2929), Expect = 0.000e+0
Identity = 726/2005 (36.21%), Postives = 1080/2005 (53.87%), Query Frame = 2
Query: 1832 SKIKAFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPS----EAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGS--PSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNG-FVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPE---TETPLLIS--------ADYAID-NKAYNKP-SIPVQSAKLT--PVERSNVKTFSNPN-KQRSNFEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVA-NTPASFIIDSTEEPPAPLGVTI---EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFN-GKGIVKAIITNPFNQ-RSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNC-EIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE---------YSVVDF-KFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDV--PLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG-------HTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMIS-GSTQKGPSKPY------NVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            ++++A+GPG+   G +V  PA F VET +   G++   I+GP+    +A +   ++ + +  V+Y P   G + V +     +IPKSP+   ++++    D  KV   GPG+  +G++  KP  F +  K+AG   P  +  +  +    ++  ++R   + T+ C Y   + G H+V V Y    IP SPF V V    +A  ++  G G++     +  +  F +  + AG G+  + V+     +  V+     DG     +   T    Y I + F+  E+ +SPF+V +    +          ++  IG    F + T  +G        V  P  S+  ++  +  +G  +  + PT +G + V + C    I  SP+  IA     T  +PE      P L            + +D +KA N P  + VQ    T  PVE  N     NP+  ++  + P   + + V+             R      +    V A+G  L  GV  N    F +D+ E   A L V I   E  +E     IDN D T SV  +P   G+Y   + Y  + +   P    +  +        DV+K+     GL P+ V  ++ + F V+   +  N   G +   I +P      +  V    D  +   Y+P   G+H I++ YD +PV  SP+ V V  G DP+R +AYGPGLE+G+T Q  KFTV+ +GAG GGL L+IEGP++A++ C DN+DG+C V YL   PG YD++I+F +KHIPGSPF V + + VD SKVK YGPG+E    R   P+ F VD  +AG   + V + ++    V   ++  K    ++ V Y+P   G+    +V ++ ++VP SPFV  V    EP KV V G   +          +P+ F I+T+ AG++D+ + +  P  +++   ++    GT+   +  D  G Y   + YG+K + GSPF +      + ++C +          G    + V+ + AGDG ++ K     G+ +      E+ G   + Y     G Y++ + F  ++IPNGS    A +  EQYS       +TT+  +   ++E         Y  V F K P+      V A V  PS + D P + +N DGT++V+Y P E G HEL V YNG+P+ GSPFKF+VDS I SG VTAYGPGL++G     A+FTI TK A AGGL++AVEGPSKA+I   DNK+GT  V YLP APG+Y + ++F DKHI GSP+ AKI GE +KR+QI VG+ S+V  P  I++ D+  LNA + +P+G EE C LKR+  G +GISFTP+E+GEHLV+V R G+HI NSPFK+ V E E+G+A +VK+ G GL +G  +    F VDTRNAG+GGLS+SIEGPSK EI+C D  DGT  ++YKPTEPG YI+N+K+AD +V GSPF V + G  S+   E+I R +DA  +++IG+ C+L   +PG    +  A V SPS   E  EI  + D  +++ F+PKELGVHTVSV+    H+ GSPFQFTVGPL D G H V   GSG+ERG+  +A +F ++TREAG GSL+I++EGPSKA+I+F+D KDGSC V+Y+V EPG+Y   +KFND H+P SPF + +  +                 D+  + +           +   F++  +G   G + A +++PS  +    I  ID   YSV F P ENGIH +HV  N   IP SPFR+ VG+       +H          TG   +F ++T NAG G L V+IDGPSKV ++C E E GY   Y P  PG++ I++KY  N HI+GSPF V  +G+      +   +  + +TV  ++ G    G   P        V  +G GLK A IGK+N+F + A  AG ++LYVG+ GP  PCEE ++KH G+N + V Y V+++G+++L+++WG   +PGSPF+I V
Sbjct:  285 NRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPF--PVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPAN-HKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVM-QSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVET--NGETGALGFTVAGP--SQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF--IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKN-----NPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRV---PLGEKVVVEQTV-----DVSKIKV--DGLEPS-VIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGN-CIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDS-ITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---------------GDAHKLEVQQFPQGNIQADAPYQFMVRKNG-AKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2240          

HSP 2 Score: 1007.28 bits (2603), Expect = 0.000e+0
Identity = 738/2289 (32.24%), Postives = 1145/2289 (50.02%), Query Frame = 2
Query:  173 AERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAG-SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIE-RAKTNIETYFVVDCKLAGSGDIGISVLDEKMR-DVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKV---RPEIIVKSPNGSRVPVKLQE--TNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV---IATDRVNTKEY-PETETPLLISAD-YAIDNKAYNKPSIPV-----QSAKLT-----------------PVERSNVKTFSNPNKQRSNFEP-NEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVA--NTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYI---DNGDGTCSVNYLPKEPGSYIV-NVLYNDEHIKDSPFNVTIYPDTKSS----SNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFD--NKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFT----------PSQFTVDASKAGEAPLKVNVIDTATKSVKPAQ-----ILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKT--VTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQ----EQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYV---DSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSK----AEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT-------------AKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNH-DGTCL-VTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQF---------------------TVGPLIDGGPH-------------KVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDG--SCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQI 6655
            AER+LAEDAQWK IQ+NTFTRWAN+HLK  +  I++L+ DL+DGL+LI L++ LS       +KRP FR+QKLENV++ L+FL++ EG+++VNIDSSDI DC+LKLILGLIWTLILHYSI+MP+W+GED  Q +G G   +PKQRLL WI++K+P  P+ NFT DW  G A+GALVDACAPGLCP+W  WDPK A++NA EA+  A++ LNV  LI+P E++NP VDE++MMTYLSQ+PN++L   APL PKTN  RVRAYGPG+E  G  +G PA FTV+TF+AGKG++D+ +  P G+ E  ++  + +K L Y+ SYIP  EG +++ +KF+  +IP SPF V V+  AGD SKV  +GPGI+P G  + + TFF++   +AG G  + +I+D    K SV  K+ +   + +  EY T  +GLHSVNVF+AG  I +SPF V V+     SDA++  A+GRG+Q  GVRV D A+F+++TE AG  +  V V GPG   +     KV    YEC Y P + G YV+ + +    +  SPF V V P KES I A+GPGL+ G++  PA F VETNGETGALGF++ GPS+A+I+C DNGDGSA V Y PT  GEYAVHILCD+E+IPKSP++AQI L    F P  V A GPGL  +G++ N+P  F V+   AG +P  V  +  DV G  +PV++++N DGT    YTP     HTV V+YG V+ P SP +V V    +AA ++ +GP ++   + N  T+F VD + AG  ++ + ++ E+ + +VP    DN D T++++  P + G   T   +  +  +P    KV +E   D  K K++ L  +  +    +F +     GS +   +    +  P G  +P K+ +  T++ F   +TP   G HT+ +     P+  SP+ V      D    K Y P  E  L    + + ++ K      + +       AK+T                 P E      F++ +   S F    EE + P +            V  YG G+  G    + P  F +D  E  P  + V +       +D +   D G+   +V+Y+P + GS +   V +++  +  SPF +T++P ++ +      +++  K  A  P            ++F ++ K     G+  +   I NP  +     ++    GTY  S+ P   G ++  I Y    +  SP+ +  +   +  + +      +   +       VD   AG G +   I   A ++I   D   KDG   + Y    PG YD+++KF  K IP   F++   + ++      Y   +E + ++V             S+ T  +    + PL     +   +   P+      ++  +  G   V Y P   G+ E+ V YN   V GSPF  +V +S     V   G G+     H +  + P+ FTI+T+ A    L + V GP+   +N    ++ DGT + QY    PG Y V V +G+K++ GSP+   +  E +           N++ VG    VT+P +  +     L+A    P G   PC ++    G+  +S+ P++IG + V +    ++I N   +    + +    ++  +  T        +  I   +     F      +    +A + C           +  DGT+ + Y+P+E G + + + +    + GSPF   V    S     ++      +           T       +  L+  V  PS     AEIQ ++  +G   V ++P   G + + +++ + HI GSPF               K  G   +R    VG  ++  +   E    +L   V  P+  +     K  ++G   +S+   E GE+ V +  + RHIP+SPFK++V  +  G+A ++++      +   +   QF+V  +N   G L   I  PS  + +C     DG    V + P E G + I+VK+   ++P SPF + +G      + +    H     + ++    + + II   N    T +V S  G  ++       +  + +R+ P   G H ++VK +N H+ GSPF+                      TV  +  GG +             KV   G G+++      NQF+I   +AG   L + + GP     +F     G  +  V Y V + G YV  IK+ +EH+PGSPF + +
Sbjct:   33 AERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGH--TPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL---SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI-LPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQ--DVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ-RVPLGE-KVVVEQTVDVSKIKVDGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSK------------VKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP------------AEFEIDTKQA---GQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEY---IEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHV-DSITSGYVTAYGPGLT----HGVTGE-PANFTISTKGASAGGLTMAVEGPSKADINY--HDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKR---------NQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQC----------TDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVE--DGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERG--VVGEAAEFNVWTREAGGGSLAISVEGPS--KADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA-GDAHKLEVQQFPQGNIQADAPYQFMV-RKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVG----KDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAV-SIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2240          

HSP 3 Score: 228.024 bits (580), Expect = 4.239e-59
Identity = 304/1254 (24.24%), Postives = 530/1254 (42.26%), Query Frame = 2
Query: 4064 PIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGL-FDVTYIPENIGNCEIEVLYNNMQVPGSPF-VQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNE--SVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVH--SEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVG---NIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIER----TTHHYTTEQSKPIIRTEYSVVDFKFPV-GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQ-----VTAYGPGLSYGRPDMH--AHFTIVTKDAGAGGLSLAVEG--PSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQI-CVGTTSDVPLRISETDINNLNA-----------IVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMV-NETCQFVVDTRNAG----YGGLSLSIEG------PSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDA--NQFTIYTREAGAGSLSIAIEGPSKAEID-FQDNKDGSC--GVTYRVNEPGDYV-CSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX--XXXXXXXXXIHHG----HTGRINEFFVDTSNAGNGALTVTID---GPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAI-SGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGL--AGGDVLYVGVSGPVR-PCEEVNIKHLGNNR---FQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            P+    + ++V+ YGPG+E  G  V  P+ FTV+   AG+  + V+ I      ++ A +   +   L + V+YIP++ G+ ++ V ++   +P SPF V+   ++ +  KV VTG G++P+    +  K P+ F I  +DAG    E+++  P N   SV   V    + T+ C+Y   + G ++V V Y    +P SPF V V   S+A+  +    G     V VG      + T+ AG+G    + +GP G   N++   ++   Y      Y P K G Y + + F  + +   S  +    P+++ SI       +       +  ++ T        F V GP     +A + C           +NGDG+  V+Y P+  G + + +  + + I  SPF   +   +P        V A GPGL      ++    FT+    AG   L + V+    +K  ++  +N +GT  V+Y P +   + + + +       SP    + G P   +++   G      +R +     N++A           I+   T  E  C +   ++    +   P   G +   +   G+ +P    K+ V   +  + S++K+  DGL   ++ N    F+VD    G     G LS +I        PSK+        D    + Y P E G + I + Y +  VPGSPF VN+    S     R   +    E        +  +   G      + ++  PS +   C      D    + ++  + G + ++++  ++H+ GSPF+  V   +D  P KV + G G+E G   ++    F +   EAG G +++ +       +D  +    G+C   V Y   + G  + C +KF++  VP SPF++ +        S+P K +    N+ +  + A+L          A F I+        I+  + +P  K     + ++    Y V FVP E G +   +   +  I GSPF++           + +        +G  +   VD   AG+GA+T  I    G   V ++  E +  ++  Y  N PGDY I++K+GG +   GS    A+ S   Y  ++ I E      T  ++  +TQ   S+  N K        +EI  R+       L   GG+     V+  VR P  +V+   + +NR     V Y  +E+G H L+V++    V GSPF+  V
Sbjct:  277 PLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVD-IQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNG---VTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTY---ECHYYPTKEGRYVIMVTFAGQEVAK-SPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGP----SQAEIECH----------DNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF---IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV-GVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGE-KVVV--EQTVDVSKIKV--DGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKI---VQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV---KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVD--PSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV-----FPKSEPTKVKVKGVNEKKK-TPASL---------PAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEE-----HTTKVVQQTTQ---SELVNGK--------SEITYRSVAFEKLPLPTTGGN-----VTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHV 1453          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0089471)

HSP 1 Score: 1132.86 bits (2929), Expect = 0.000e+0
Identity = 726/2005 (36.21%), Postives = 1080/2005 (53.87%), Query Frame = 2
Query: 1832 SKIKAFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPS----EAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGS--PSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNG-FVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPE---TETPLLIS--------ADYAID-NKAYNKP-SIPVQSAKLT--PVERSNVKTFSNPN-KQRSNFEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVA-NTPASFIIDSTEEPPAPLGVTI---EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFN-GKGIVKAIITNPFNQ-RSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNC-EIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE---------YSVVDF-KFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDV--PLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG-------HTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMIS-GSTQKGPSKPY------NVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            ++++A+GPG+   G +V  PA F VET +   G++   I+GP+    +A +   ++ + +  V+Y P   G + V +     +IPKSP+   ++++    D  KV   GPG+  +G++  KP  F +  K+AG   P  +  +  +    ++  ++R   + T+ C Y   + G H+V V Y    IP SPF V V    +A  ++  G G++     +  +  F +  + AG G+  + V+     +  V+     DG     +   T    Y I + F+  E+ +SPF+V +    +          ++  IG    F + T  +G        V  P  S+  ++  +  +G  +  + PT +G + V + C    I  SP+  IA     T  +PE      P L            + +D +KA N P  + VQ    T  PVE  N     NP+  ++  + P   + + V+             R      +    V A+G  L  GV  N    F +D+ E   A L V I   E  +E     IDN D T SV  +P   G+Y   + Y  + +   P    +  +        DV+K+     GL P+ V  ++ + F V+   +  N   G +   I +P      +  V    D  +   Y+P   G+H I++ YD +PV  SP+ V V  G DP+R +AYGPGLE+G+T Q  KFTV+ +GAG GGL L+IEGP++A++ C DN+DG+C V YL   PG YD++I+F +KHIPGSPF V + + VD SKVK YGPG+E    R   P+ F VD  +AG   + V + ++    V   ++  K    ++ V Y+P   G+    +V ++ ++VP SPFV  V    EP KV V G   +          +P+ F I+T+ AG++D+ + +  P  +++   ++    GT+   +  D  G Y   + YG+K + GSPF +      + ++C +          G    + V+ + AGDG ++ K     G+ +      E+ G   + Y     G Y++ + F  ++IPNGS    A +  EQYS       +TT+  +   ++E         Y  V F K P+      V A V  PS + D P + +N DGT++V+Y P E G HEL V YNG+P+ GSPFKF+VDS I SG VTAYGPGL++G     A+FTI TK A AGGL++AVEGPSKA+I   DNK+GT  V YLP APG+Y + ++F DKHI GSP+ AKI GE +KR+QI VG+ S+V  P  I++ D+  LNA + +P+G EE C LKR+  G +GISFTP+E+GEHLV+V R G+HI NSPFK+ V E E+G+A +VK+ G GL +G  +    F VDTRNAG+GGLS+SIEGPSK EI+C D  DGT  ++YKPTEPG YI+N+K+AD +V GSPF V + G  S+   E+I R +DA  +++IG+ C+L   +PG    +  A V SPS   E  EI  + D  +++ F+PKELGVHTVSV+    H+ GSPFQFTVGPL D G H V   GSG+ERG+  +A +F ++TREAG GSL+I++EGPSKA+I+F+D KDGSC V+Y+V EPG+Y   +KFND H+P SPF + +  +                 D+  + +           +   F++  +G   G + A +++PS  +    I  ID   YSV F P ENGIH +HV  N   IP SPFR+ VG+       +H          TG   +F ++T NAG G L V+IDGPSKV ++C E E GY   Y P  PG++ I++KY  N HI+GSPF V  +G+      +   +  + +TV  ++ G    G   P        V  +G GLK A IGK+N+F + A  AG ++LYVG+ GP  PCEE ++KH G+N + V Y V+++G+++L+++WG   +PGSPF+I V
Sbjct:  255 NRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPF--PVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPAN-HKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVM-QSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVET--NGETGALGFTVAGP--SQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF--IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKN-----NPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRV---PLGEKVVVEQTV-----DVSKIKV--DGLEPS-VIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGN-CIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDS-ITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---------------GDAHKLEVQQFPQGNIQADAPYQFMVRKNG-AKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2210          

HSP 2 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 740/2289 (32.33%), Postives = 1145/2289 (50.02%), Query Frame = 2
Query:  173 AERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAG-SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIE-RAKTNIETYFVVDCKLAGSGDIGISVLDEKMR-DVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKV---RPEIIVKSPNGSRVPVKLQE--TNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV---IATDRVNTKEY-PETETPLLISAD-YAIDNKAYNKPSIPV-----QSAKLT-----------------PVERSNVKTFSNPNKQRSNFEP-NEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVA--NTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYI---DNGDGTCSVNYLPKEPGSYIV-NVLYNDEHIKDSPFNVTIYPDTKSS----SNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFD--NKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFT----------PSQFTVDASKAGEAPLKVNVIDTATKSVKPAQ-----ILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKT--VTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQ----EQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYV---DSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSK----AEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT-------------AKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNH-DGTCL-VTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQF---------------------TVGPLIDGGPH-------------KVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDG--SCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQI 6655
            AER+LAEDAQWK IQ+NTFTRWAN+HLK  +  I++L+ DL+DGL+LI L++ LS       +KRP FR+QKLENV++ L+FL++ EG+++VNIDSSDI DC+LKLILGLIWTLILHYSI+MP+W+GED  Q +G G   +PKQRLL WI++K+P  P+ NFT DW  G A+GALVDACAPGLCP+W  WDPK A++NA EA+  A++ LNV  LI+P E++NP VDE++MMTYLSQ+PN++L   APL PKTN  RVRAYGPG+E  G  +G PA FTV+TF+AGKG++D+ +  P G+ E  ++  + +K L Y+ SYIP  EG +++ +KF+  +IP SPF V V+  AGD SKV  +GPGI+P G  + + TFF++   +AG G  + +I+D    K SV  K+ +   + +  EY T  +GLHSVNVF+AG  I +SPF V V+     SDA++  A+GRG+Q  GVRV D A+F+++TE AG  +  V V GPG   +     KV    YEC Y P + G YV+ + +    +  SPF V V P KES I A+GPGL+ G++  PA F VETNGETGALGF++ GPS+A+I+C DNGDGSA V Y PT  GEYAVHILCD+E+IPKSP++AQI L    F P  V A GPGL  +G++ N+P  F V+   AG +P  V  +  DV G  +PV++++N DGT    YTP     HTV V+YG V+ P SP +V V    +AA ++ +GP ++   + N  T+F VD + AG  ++ + ++ E+ + +VP    DN D T++++  P + G   T   +  +  +P    KV +E   D  K K++ L  +  +    +F +     GS +   +    +  P G  +P K+ +  T++ F   +TP   G HT+ +     P+  SP+ V      D    K Y P  E  L    + + ++ K      + +       AK+T                 P E      F++ +   S F    EE + P +            V  YG G+  G    + P  F +D  E  P  + V +       +D +   D G+   +V+Y+P + GS +   V +++  +  SPF +T++P ++ +      +++  K  A  P            ++F ++ K     G+  +   I NP  +     ++    GTY  S+ P   G ++  I Y    +  SP+ +  +   +  + +      +   +       VD   AG G +   I   A ++I   D   KDG   + Y    PG YD+++KF  K IP   F++   + ++      Y   +E + ++V             S+ T  +    + PL     +   +   P+      ++  +  G   V Y P   G+ E+ V YN   V GSPF  +V +S     V   G G+     H +  + P+ FTI+T+ A    L + V GP+   +N   DN  DGT + QY    PG Y V V +G+K++ GSP+   +  E +           N++ VG    VT+P +  +     L+A    P G   PC ++    G+  +S+ P++IG + V +    ++I N   +    + +    ++  +  T        +  I   +     F      +    +A + C           +  DGT+ + Y+P+E G + + + +    + GSPF   V    S     ++      +           T       +  L+  V  PS     AEIQ ++  +G   V ++P   G + + +++ + HI GSPF               K  G   +R    VG  ++  +   E    +L   V  P+  +     K  ++G   +S+   E GE+ V +  + RHIP+SPFK++V  +  G+A ++++      +   +   QF+V  +N   G L   I  PS  + +C     DG    V + P E G + I+VK+   ++P SPF + +G      + +    H     + ++    + + II   N    T +V S  G  ++       +  + +R+ P   G H ++VK +N H+ GSPF+                      TV  +  GG +             KV   G G+++      NQF+I   +AG   L + + GP     +F     G  +  V Y V + G YV  IK+ +EH+PGSPF + +
Sbjct:    3 AERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGH--TPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL---SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI-LPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQ--DVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ-RVPLGE-KVVVEQTVDVSKIKVDGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSK------------VKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP------------AEFEIDTKQA---GQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEY---IEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHV-DSITSGYVTAYGPGLT----HGVTGE-PANFTISTKGASAGGLTMAVEGPSKADINYH-DNK-DGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKR---------NQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQC----------TDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVE--DGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERG--VVGEAAEFNVWTREAGGGSLAISVEGPS--KADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA-GDAHKLEVQQFPQGNIQADAPYQFMV-RKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVG----KDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAV-SIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2210          

HSP 3 Score: 228.024 bits (580), Expect = 4.555e-59
Identity = 304/1254 (24.24%), Postives = 530/1254 (42.26%), Query Frame = 2
Query: 4064 PIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGL-FDVTYIPENIGNCEIEVLYNNMQVPGSPF-VQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNE--SVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVH--SEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVG---NIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIER----TTHHYTTEQSKPIIRTEYSVVDFKFPV-GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQ-----VTAYGPGLSYGRPDMH--AHFTIVTKDAGAGGLSLAVEG--PSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQI-CVGTTSDVPLRISETDINNLNA-----------IVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMV-NETCQFVVDTRNAG----YGGLSLSIEG------PSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDA--NQFTIYTREAGAGSLSIAIEGPSKAEID-FQDNKDGSC--GVTYRVNEPGDYV-CSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX--XXXXXXXXXIHHG----HTGRINEFFVDTSNAGNGALTVTID---GPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAI-SGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGL--AGGDVLYVGVSGPVR-PCEEVNIKHLGNNR---FQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            P+    + ++V+ YGPG+E  G  V  P+ FTV+   AG+  + V+ I      ++ A +   +   L + V+YIP++ G+ ++ V ++   +P SPF V+   ++ +  KV VTG G++P+    +  K P+ F I  +DAG    E+++  P N   SV   V    + T+ C+Y   + G ++V V Y    +P SPF V V   S+A+  +    G     V VG      + T+ AG+G    + +GP G   N++   ++   Y      Y P K G Y + + F  + +   S  +    P+++ SI       +       +  ++ T        F V GP     +A + C           +NGDG+  V+Y P+  G + + +  + + I  SPF   +   +P        V A GPGL      ++    FT+    AG   L + V+    +K  ++  +N +GT  V+Y P +   + + + +       SP    + G P   +++   G      +R +     N++A           I+   T  E  C +   ++    +   P   G +   +   G+ +P    K+ V   +  + S++K+  DGL   ++ N    F+VD    G     G LS +I        PSK+        D    + Y P E G + I + Y +  VPGSPF VN+    S     R   +    E        +  +   G      + ++  PS +   C      D    + ++  + G + ++++  ++H+ GSPF+  V   +D  P KV + G G+E G   ++    F +   EAG G +++ +       +D  +    G+C   V Y   + G  + C +KF++  VP SPF++ +        S+P K +    N+ +  + A+L          A F I+        I+  + +P  K     + ++    Y V FVP E G +   +   +  I GSPF++           + +        +G  +   VD   AG+GA+T  I    G   V ++  E +  ++  Y  N PGDY I++K+GG +   GS    A+ S   Y  ++ I E      T  ++  +TQ   S+  N K        +EI  R+       L   GG+     V+  VR P  +V+   + +NR     V Y  +E+G H L+V++    V GSPF+  V
Sbjct:  247 PLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVD-IQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNG---VTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTY---ECHYYPTKEGRYVIMVTFAGQEVAK-SPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGP----SQAEIECH----------DNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF---IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV-GVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGE-KVVV--EQTVDVSKIKV--DGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKI---VQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV---KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVD--PSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV-----FPKSEPTKVKVKGVNEKKK-TPASL---------PAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEE-----HTTKVVQQTTQ---SELVNGK--------SEITYRSVAFEKLPLPTTGGN-----VTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHV 1423          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0290014)

HSP 1 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 623/1498 (41.59%), Postives = 884/1498 (59.01%), Query Frame = 2
Query: 3215 VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFN-GKGIVKAIITNPFNQ-RSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNC-EIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE---------YSVVDF-KFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDV--PLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG-------HTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMIS-GSTQKGPSKPY------NVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            V A+G GL +G+   PA F+ID+       LGVT+EGP EA I+  DNGDGTC+V YLP E G Y VN+ +N+ HI  SPF   I P       + ++      G G+ P GV  ++ + F V+   +  N   G +   I +P      +  V    D  +   Y+P   G+H I++ YD +PV  SP+ V V  G DP+R +AYGPGLE+G+T Q  KFTV+ +GAG GGL L+IEGP++A++ C DN+DG+C V YL   PG YD++I+F +KHIPGSPF V + + VD SKVK YGPG+E    R   P+ F VD  +AG   + V + ++    V   ++  K    ++ V Y+P   G+    +V ++ ++VP SPFV  V    EP KV V G   +          +P+ F I+T+ AG++D+ + +  P  +++   ++    GT+   +  D  G Y   + YG+K + GSPF +      + ++C +          G    + V+ + AGDG ++ K     G+ +      E+ G   + Y     G Y++ + F  ++IPNGS    A +  EQYS       +TT+  +   ++E         Y  V F K P+      V A V  PS + D P + +N DGT++V+Y P E G HEL V YNG+P+ GSPFKF+VDS I SG VTAYGPGL++G     A+FTI TK A AGGL++AVEGPSKA+I   DNK+GT  V YLP APG+Y + ++F DKHI GSP+ AKI GE +KR+QI VG+ S+V  P  I++ D+  LNA + +P+G EE C LKR+  G +GISFTP+E+GEHLV+V R G+HI NSPFK+ V E E+G+A +VK+ G GL +G  +    F VDTRNAG+GGLS+SIEGPSK EI+C D  DGT  ++YKPTEPG YI+N+K+AD +V GSPF V + G  S+   E+I R +DA  +++IG+ C+L   +PG    +  A V SPS   E  EI  + D  +++ F+PKELGVHTVSV+    H+ GSPFQFTVGPL D G H V   GSG+ERG+  +A +F ++TREAG GSL+I++EGPSKA+I+F+D KDGSC V+Y+V EPG+Y   +KFND H+P SPF + +  +                 D+  + +           +   F++  +G   G + A +++PS  +    I  ID   YSV F P ENGIH +HV  N   IP SPFR+ VG+       +H          TG   +F ++T NAG G L V+IDGPSKV ++C E E GY   Y P  PG++ I++KY  N HI+GSPF V  +G+      +   +  + +TV  ++ G    G   P        V  +G GLK A IGK+N+F + A  AG ++LYVG+ GP  PCEE ++KH G+N + V Y V+++G+++L+++WG   +PGSPF+I V
Sbjct:  932 VQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVP-------VPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGN-CIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDS-ITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---------------GDAHKLEVQQFPQGNIQADAPYQFMVRKNG-AKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2399          

HSP 2 Score: 1107.82 bits (2864), Expect = 0.000e+0
Identity = 816/2493 (32.73%), Postives = 1254/2493 (50.30%), Query Frame = 2
Query:  173 AERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAG-SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIE-RAKTNIETYFVVDCKLAGSGDIGISVLDEKMR-DVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYK---VIATDRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSI------PVQSA-------------KLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEE----PPAPLGVTIEGPMEAKI-DYIDNG--DGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQ--PQKFTVDLEGAGQGGLGLSI---EGPADAQIQCFDNKDGTCSVQYLPQKPGS-YDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTG-PNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPV--------HSEAKPEQC--YIEGPILNEVPVGKT---------VTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIER---TTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNK--NGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI----FGEPKKRSQICVG-----TTSDVPLRISETDINN-----LNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFV-GENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKV--EIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGA-GSLSIAIEGPSKAEID-FQDNKDGSC-GVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSP------------------------------------------FRXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQE------NESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAI 7249
            AER+LAEDAQWK IQ+NTFTRWAN+HLK  +  I++L+ DL+DGL+LI L++ LS       +KRP FR+QKLENV++ L+FL++ EG+++VNIDSSDI DC+LKLILGLIWTLILHYSI+MP+W+GED  Q +G G   +PKQRLL WI++K+P  P+ NFT DW  G A+GALVDACAPGLCP+W  WDPK A++NA EA+  A++ LNV  LI+P E++NP VDE++MMTYLSQ+PN++L   APL PKTN  RVRAYGPG+E  G  +G PA FTV+TF+AGKG++D+ +  P G+ E  ++  + +K L Y+ SYIP  EG +++ +KF+  +IP SPF V V+  AGD SKV  +GPGI+P G  + + TFF++   +AG G  + +I+D    K SV  K+ +   + +  EY T  +GLHSVNVF+AG  I +SPF V V+     SDA++  A+GRG+Q  GVRV D A+F+++TE AG  +  V V GPG   +     KV    YEC Y P + G YV+ + +    +  SPF V V P KES I A+GPGL+ G++  PA F VETNGETGALGF++ GPS+A+I+C DNGDGSA V Y PT  GEYAVHILCD+E+IPKSP++AQI L    F P  V A GPGL  +G++ N+P  F V+   AG +P  V  +  DV G  +PV++++N DGT    YTP     HTV V+YG V+ P SP +V V    +AA ++ +GP ++   + N  T+F VD + AG  ++ + ++ E+ + +VP    DN D T++++  P + G   T   +  +  +P    KV +E   D  K K++ L  T P+  L +F I+T     K    + + SP+G+R+   +  T  GF+  FTPT +G + +++   G PI   P++   +  +D    + + P  E  ++   A++ ID +   +  +      P ++A                P E  +       N++     P + +I PV        L+   V+  G      + N    F++D ++         L   I  PM   +   I  G  D    + Y P E G + + ++Y++  +  SPF V +    KS     D A+  AYGPGL       +  +KFTV  K     G G +   I  P   + TCT  +N DG+    Y     G++ I I +    +  SP+ V V +  DPS+++ YGPG+E G  ++  P  F VD+  AG G + + +   EG     ++  D  +   +V Y+P K GS     +KF+E  +P SPF + +    + +KVK  G   E+  +    P++F +D  +AG+A + V + +   K+++P   L + + G + V+++P+  G  +  + Y + ++ GSPF      + E +K  +  +  +     +  +   S   ++ R+AG+  +   +T    +E V++DV    DG F   Y  + PG+Y + V +G K++P   F +          HSE   E     ++    +E+  GK+           +P+ T     G ++A+   P G +    I++ R G  +V Y P++ G++E+ + +N E +     + +       Y        TH  T E +   I T+          G     +   V  PS + D+    +N DGT++VQY P+  G +++ V +  + I GSP+   +          + G   S     M    T    D     L+ +++ PS  E  C   +   G   +S+ P   G++ + +K + KHI  SPF   +     G+ KK      G     T +D    I   D  N     L+  +  P+  E  CT K   +G L IS+ P E G ++VN+  +  H+  SPF + V GE       +++   D +    +   C+            L+  +  PS V  + E  +  DG   V + P E G + ++V+Y++ ++PGSPF   +G    S  +  +       E   +G   E N+        +   SV  PS +    E     D    + +   E G + V +K ++RH+  SPF+  V P   G  HK+ +         A+   QF +  R+ GA G L   I  PS  + D F    DG    V +   E G +   +KFN  H+P SPF +++ ++                 D   +  +         G KA+F+IN      G+++  +  PS   ++A         Y V + P+  G H + V  NN  I GSP                                          F+    +V   G G+   + G+ N+F +  ++AGN  L V + GP   +  C+E        + YN  Y+    G Y + IK+ G  HI GSPF + +
Sbjct:    3 AERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGH--TPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL---SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI-LPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQ--DVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ-RVPLGE-KVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIIT-HGLPKADLAVTITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV------PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV----KSGC---DPARCKAYGPGLEKG--LTNQKNKFTVETKGA---GNGGLSLAIEGPSEAKMTCT--DNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVN-EKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPR--LEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPK-----IQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEK-DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTG---GNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTK----------GASAGGLTMAVEGPS-KADI-NYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVG---SCSEVTMPGDIT----DDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHAD---NIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDK--DDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSG-SHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKA--DIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA-GDAHKLEVQQFPQGNIQADAPYQFMV--RKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKD---------------VADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPS---KVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGP---KGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKW-GEEHIPGSPFQIDV 2399          

HSP 3 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 578/2035 (28.40%), Postives = 934/2035 (45.90%), Query Frame = 2
Query: 1832 SKIKAFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPS----EAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGS--PSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNG-FVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPE---TETPLLIS--------ADYAID-NKAYNKP-SIPVQSAKLT--PVERSNVKTFSNPN-KQRSNFEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVA-NTPASFIIDSTEEPPAPLGVTI---EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAG----EAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVT--IPVNTQNAGDGILSAKNVG----PVGNIVPCSIENERYGHSTVSYVPQKIGA-YEVQLMFNDENIPNGSIRQYAFQPQE--QYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDY-VRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDM-----HAHFTIVTKDAGAGGLSLAVEGPSKAEIQCID--NKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFG--EPKKRSQICVGTTSDVPLRISETDI-----------------------NNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQ----DAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFR--------XXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            ++++A+GPG+   G +V  PA F VET +   G++   I+GP+    +A +   ++ + +  V+Y P   G + V +     +IPKSP+   ++++    D  KV   GPG+  +G++  KP  F +  K+AG   P  +  +  +    ++  ++R   + T+ C Y   + G H+V V Y    IP SPF V V    +A  ++  G G++     +  +  F +  + AG G+  + V+     +  V+     DG     +   T    Y I + F+  E+ +SPF+V +    +          ++  IG    F + T  +G        V  P  S+  ++  +  +G  +  + PT +G + V + C    I  SP+  IA     T  +PE      P L            + +D +KA N P  + VQ    T  PVE  N     NP+  ++  + P   + + V+             R      +    V A+G  L  GV  N    F +D+ E   A L V I   E  +E     IDN D T SV  +P   G+Y   + Y  + +   P    +  +        DV+K+     GL PT    +S  +F +    +    K  +   IT+P   R    +    +G +  +++P   G++ + I + G P+   P+ +    GSD ++++A+GPGLE GI  QP +F +D  GAGQGGLG+++EGP +A I C DN DGTC+V YLP + G Y V+I FNE+HI GSPF   I  + ++   +  G G++ +G  +   + F VD SK G       L   + D     V P++I+   T  +F + Y P   G   IE++Y+N+ VPGSPFV NV + C+P +    G G+   +G  + N+  + FT+ T+ AG   L L + GP+   +    DN  DG+    Y    PG Y + + + +K++PGSPF V V     P +  + GP +    V ++V     V+   AG G ++ K       PV N+    +E++      V YVP K G+    Q+ F++  +P        F   E  +  ++       T  S P         +F+          +   +  P  +   PRL     GT  V + P E G ++  + Y  + I GSPFK       P+G+  A    L    P +      +H  +  ++AG G ++  +   + +EI  ID   K+G  D+ Y    PGDY I +KF  K I    F+ K     E    S+     T+ V  + +++++                        N+ A V  P+G+ +   ++  ++G + + + P+E G H + V  +G  +  SPFK  V     G    V  YG GL  G+  E   F + T+ A  GGL++++EGPSK +I  HDN DGT  V Y PT PG Y ++V++ D ++ GSP+   I G       E   R+Q      +EV+  G++ + +L       R   AS+ +PSG  E C +  +      I F P+E+G H VSVK   +H+  SPF+ TV     G   KV + G+G++ G  +  N F++ TR AG G LS++IEGPSKAEI   D  DG+  ++Y+  EPG Y+ ++KF D HV GSPF +++     +   + ++ E     D+  I+          IGS+        G+T   ++A V SPSN  + A I ++++  Y+VHFVP E G+H V V  +   IPGSPF+             V   G G+  G  G   EF V T  AG G+L ++++GPSK  +  ++ + G  + +Y    PG+Y + +K+  + HI  SPF V +S +   ++    E +   Q      G+ Q     PY                  +F+V    A G+ L   +  P    ++  I+ +    + V +Y +E G H + V++    +P SPF I V
Sbjct:  255 NRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPF--PVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPAN-HKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVM-QSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVET--NGETGALGFTVAGP--SQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF--IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKN-----NPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRV---PLGEKVVVEQTV-----DVSKIKV--DGLEPTAPL-NSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFD-PMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLE--KG--LTNQ-KNKFTVETKGAGNGGLSLAIEGPSEAKMTC-TDNR-DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNL---RVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP--------AEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKL---EAFPTGE--AKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITG-------EGRKRNQISVGSCSEVTMPGDITDDDL-------RALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRE----RDAVPIT---------EIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHK--LEVQQFPQ------GNIQA--DAPY------------------QFMVRKNGAKGE-LDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2175          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337100)

HSP 1 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 623/1498 (41.59%), Postives = 884/1498 (59.01%), Query Frame = 2
Query: 3215 VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFN-GKGIVKAIITNPFNQ-RSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNC-EIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE---------YSVVDF-KFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDV--PLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG-------HTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMIS-GSTQKGPSKPY------NVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            V A+G GL +G+   PA F+ID+       LGVT+EGP EA I+  DNGDGTC+V YLP E G Y VN+ +N+ HI  SPF   I P       + ++      G G+ P GV  ++ + F V+   +  N   G +   I +P      +  V    D  +   Y+P   G+H I++ YD +PV  SP+ V V  G DP+R +AYGPGLE+G+T Q  KFTV+ +GAG GGL L+IEGP++A++ C DN+DG+C V YL   PG YD++I+F +KHIPGSPF V + + VD SKVK YGPG+E    R   P+ F VD  +AG   + V + ++    V   ++  K    ++ V Y+P   G+    +V ++ ++VP SPFV  V    EP KV V G   +          +P+ F I+T+ AG++D+ + +  P  +++   ++    GT+   +  D  G Y   + YG+K + GSPF +      + ++C +          G    + V+ + AGDG ++ K     G+ +      E+ G   + Y     G Y++ + F  ++IPNGS    A +  EQYS       +TT+  +   ++E         Y  V F K P+      V A V  PS + D P + +N DGT++V+Y P E G HEL V YNG+P+ GSPFKF+VDS I SG VTAYGPGL++G     A+FTI TK A AGGL++AVEGPSKA+I   DNK+GT  V YLP APG+Y + ++F DKHI GSP+ AKI GE +KR+QI VG+ S+V  P  I++ D+  LNA + +P+G EE C LKR+  G +GISFTP+E+GEHLV+V R G+HI NSPFK+ V E E+G+A +VK+ G GL +G  +    F VDTRNAG+GGLS+SIEGPSK EI+C D  DGT  ++YKPTEPG YI+N+K+AD +V GSPF V + G  S+   E+I R +DA  +++IG+ C+L   +PG    +  A V SPS   E  EI  + D  +++ F+PKELGVHTVSV+    H+ GSPFQFTVGPL D G H V   GSG+ERG+  +A +F ++TREAG GSL+I++EGPSKA+I+F+D KDGSC V+Y+V EPG+Y   +KFND H+P SPF + +  +                 D+  + +           +   F++  +G   G + A +++PS  +    I  ID   YSV F P ENGIH +HV  N   IP SPFR+ VG+       +H          TG   +F ++T NAG G L V+IDGPSKV ++C E E GY   Y P  PG++ I++KY  N HI+GSPF V  +G+      +   +  + +TV  ++ G    G   P        V  +G GLK A IGK+N+F + A  AG ++LYVG+ GP  PCEE ++KH G+N + V Y V+++G+++L+++WG   +PGSPF+I V
Sbjct:  932 VQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVP-------VPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGN-CIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDS-ITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---------------GDAHKLEVQQFPQGNIQADAPYQFMVRKNG-AKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2399          

HSP 2 Score: 1107.82 bits (2864), Expect = 0.000e+0
Identity = 816/2493 (32.73%), Postives = 1254/2493 (50.30%), Query Frame = 2
Query:  173 AERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAG-SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIE-RAKTNIETYFVVDCKLAGSGDIGISVLDEKMR-DVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYK---VIATDRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSI------PVQSA-------------KLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEE----PPAPLGVTIEGPMEAKI-DYIDNG--DGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQ--PQKFTVDLEGAGQGGLGLSI---EGPADAQIQCFDNKDGTCSVQYLPQKPGS-YDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTG-PNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPV--------HSEAKPEQC--YIEGPILNEVPVGKT---------VTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIER---TTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNK--NGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI----FGEPKKRSQICVG-----TTSDVPLRISETDINN-----LNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFV-GENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKV--EIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGA-GSLSIAIEGPSKAEID-FQDNKDGSC-GVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSP------------------------------------------FRXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQE------NESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAI 7249
            AER+LAEDAQWK IQ+NTFTRWAN+HLK  +  I++L+ DL+DGL+LI L++ LS       +KRP FR+QKLENV++ L+FL++ EG+++VNIDSSDI DC+LKLILGLIWTLILHYSI+MP+W+GED  Q +G G   +PKQRLL WI++K+P  P+ NFT DW  G A+GALVDACAPGLCP+W  WDPK A++NA EA+  A++ LNV  LI+P E++NP VDE++MMTYLSQ+PN++L   APL PKTN  RVRAYGPG+E  G  +G PA FTV+TF+AGKG++D+ +  P G+ E  ++  + +K L Y+ SYIP  EG +++ +KF+  +IP SPF V V+  AGD SKV  +GPGI+P G  + + TFF++   +AG G  + +I+D    K SV  K+ +   + +  EY T  +GLHSVNVF+AG  I +SPF V V+     SDA++  A+GRG+Q  GVRV D A+F+++TE AG  +  V V GPG   +     KV    YEC Y P + G YV+ + +    +  SPF V V P KES I A+GPGL+ G++  PA F VETNGETGALGF++ GPS+A+I+C DNGDGSA V Y PT  GEYAVHILCD+E+IPKSP++AQI L    F P  V A GPGL  +G++ N+P  F V+   AG +P  V  +  DV G  +PV++++N DGT    YTP     HTV V+YG V+ P SP +V V    +AA ++ +GP ++   + N  T+F VD + AG  ++ + ++ E+ + +VP    DN D T++++  P + G   T   +  +  +P    KV +E   D  K K++ L  T P+  L +F I+T     K    + + SP+G+R+   +  T  GF+  FTPT +G + +++   G PI   P++   +  +D    + + P  E  ++   A++ ID +   +  +      P ++A                P E  +       N++     P + +I PV        L+   V+  G      + N    F++D ++         L   I  PM   +   I  G  D    + Y P E G + + ++Y++  +  SPF V +    KS     D A+  AYGPGL       +  +KFTV  K     G G +   I  P   + TCT  +N DG+    Y     G++ I I +    +  SP+ V V +  DPS+++ YGPG+E G  ++  P  F VD+  AG G + + +   EG     ++  D  +   +V Y+P K GS     +KF+E  +P SPF + +    + +KVK  G   E+  +    P++F +D  +AG+A + V + +   K+++P   L + + G + V+++P+  G  +  + Y + ++ GSPF      + E +K  +  +  +     +  +   S   ++ R+AG+  +   +T    +E V++DV    DG F   Y  + PG+Y + V +G K++P   F +          HSE   E     ++    +E+  GK+           +P+ T     G ++A+   P G +    I++ R G  +V Y P++ G++E+ + +N E +     + +       Y        TH  T E +   I T+          G     +   V  PS + D+    +N DGT++VQY P+  G +++ V +  + I GSP+   +          + G   S     M    T    D     L+ +++ PS  E  C   +   G   +S+ P   G++ + +K + KHI  SPF   +     G+ KK      G     T +D    I   D  N     L+  +  P+  E  CT K   +G L IS+ P E G ++VN+  +  H+  SPF + V GE       +++   D +    +   C+            L+  +  PS V  + E  +  DG   V + P E G + ++V+Y++ ++PGSPF   +G    S  +  +       E   +G   E N+        +   SV  PS +    E     D    + +   E G + V +K ++RH+  SPF+  V P   G  HK+ +         A+   QF +  R+ GA G L   I  PS  + D F    DG    V +   E G +   +KFN  H+P SPF +++ ++                 D   +  +         G KA+F+IN      G+++  +  PS   ++A         Y V + P+  G H + V  NN  I GSP                                          F+    +V   G G+   + G+ N+F +  ++AGN  L V + GP   +  C+E        + YN  Y+    G Y + IK+ G  HI GSPF + +
Sbjct:    3 AERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGH--TPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL---SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI-LPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQ--DVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ-RVPLGE-KVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIIT-HGLPKADLAVTITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV------PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV----KSGC---DPARCKAYGPGLEKG--LTNQKNKFTVETKGA---GNGGLSLAIEGPSEAKMTCT--DNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVN-EKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPR--LEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPK-----IQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEK-DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTG---GNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTK----------GASAGGLTMAVEGPS-KADI-NYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVG---SCSEVTMPGDIT----DDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHAD---NIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDK--DDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSG-SHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKA--DIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA-GDAHKLEVQQFPQGNIQADAPYQFMV--RKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKD---------------VADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPS---KVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGP---KGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKW-GEEHIPGSPFQIDV 2399          

HSP 3 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 578/2035 (28.40%), Postives = 934/2035 (45.90%), Query Frame = 2
Query: 1832 SKIKAFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPS----EAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGS--PSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNG-FVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPE---TETPLLIS--------ADYAID-NKAYNKP-SIPVQSAKLT--PVERSNVKTFSNPN-KQRSNFEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVA-NTPASFIIDSTEEPPAPLGVTI---EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAG----EAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVT--IPVNTQNAGDGILSAKNVG----PVGNIVPCSIENERYGHSTVSYVPQKIGA-YEVQLMFNDENIPNGSIRQYAFQPQE--QYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDY-VRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDM-----HAHFTIVTKDAGAGGLSLAVEGPSKAEIQCID--NKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFG--EPKKRSQICVGTTSDVPLRISETDI-----------------------NNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQ----DAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFR--------XXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            ++++A+GPG+   G +V  PA F VET +   G++   I+GP+    +A +   ++ + +  V+Y P   G + V +     +IPKSP+   ++++    D  KV   GPG+  +G++  KP  F +  K+AG   P  +  +  +    ++  ++R   + T+ C Y   + G H+V V Y    IP SPF V V    +A  ++  G G++     +  +  F +  + AG G+  + V+     +  V+     DG     +   T    Y I + F+  E+ +SPF+V +    +          ++  IG    F + T  +G        V  P  S+  ++  +  +G  +  + PT +G + V + C    I  SP+  IA     T  +PE      P L            + +D +KA N P  + VQ    T  PVE  N     NP+  ++  + P   + + V+             R      +    V A+G  L  GV  N    F +D+ E   A L V I   E  +E     IDN D T SV  +P   G+Y   + Y  + +   P    +  +        DV+K+     GL PT    +S  +F +    +    K  +   IT+P   R    +    +G +  +++P   G++ + I + G P+   P+ +    GSD ++++A+GPGLE GI  QP +F +D  GAGQGGLG+++EGP +A I C DN DGTC+V YLP + G Y V+I FNE+HI GSPF   I  + ++   +  G G++ +G  +   + F VD SK G       L   + D     V P++I+   T  +F + Y P   G   IE++Y+N+ VPGSPFV NV + C+P +    G G+   +G  + N+  + FT+ T+ AG   L L + GP+   +    DN  DG+    Y    PG Y + + + +K++PGSPF V V     P +  + GP +    V ++V     V+   AG G ++ K       PV N+    +E++      V YVP K G+    Q+ F++  +P        F   E  +  ++       T  S P         +F+          +   +  P  +   PRL     GT  V + P E G ++  + Y  + I GSPFK       P+G+  A    L    P +      +H  +  ++AG G ++  +   + +EI  ID   K+G  D+ Y    PGDY I +KF  K I    F+ K     E    S+     T+ V  + +++++                        N+ A V  P+G+ +   ++  ++G + + + P+E G H + V  +G  +  SPFK  V     G    V  YG GL  G+  E   F + T+ A  GGL++++EGPSK +I  HDN DGT  V Y PT PG Y ++V++ D ++ GSP+   I G       E   R+Q      +EV+  G++ + +L       R   AS+ +PSG  E C +  +      I F P+E+G H VSVK   +H+  SPF+ TV     G   KV + G+G++ G  +  N F++ TR AG G LS++IEGPSKAEI   D  DG+  ++Y+  EPG Y+ ++KF D HV GSPF +++     +   + ++ E     D+  I+          IGS+        G+T   ++A V SPSN  + A I ++++  Y+VHFVP E G+H V V  +   IPGSPF+             V   G G+  G  G   EF V T  AG G+L ++++GPSK  +  ++ + G  + +Y    PG+Y + +K+  + HI  SPF V +S +   ++    E +   Q      G+ Q     PY                  +F+V    A G+ L   +  P    ++  I+ +    + V +Y +E G H + V++    +P SPF I V
Sbjct:  255 NRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPF--PVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPAN-HKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVM-QSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVET--NGETGALGFTVAGP--SQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF--IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKN-----NPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRV---PLGEKVVVEQTV-----DVSKIKV--DGLEPTAPL-NSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFD-PMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLE--KG--LTNQ-KNKFTVETKGAGNGGLSLAIEGPSEAKMTC-TDNR-DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNL---RVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP--------AEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKL---EAFPTGE--AKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITG-------EGRKRNQISVGSCSEVTMPGDITDDDL-------RALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRE----RDAVPIT---------EIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHK--LEVQQFPQ------GNIQA--DAPY------------------QFMVRKNGAKGE-LDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2175          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337101)

HSP 1 Score: 1129.78 bits (2921), Expect = 0.000e+0
Identity = 623/1498 (41.59%), Postives = 884/1498 (59.01%), Query Frame = 2
Query: 3215 VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFN-GKGIVKAIITNPFNQ-RSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNC-EIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE---------YSVVDF-KFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDV--PLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG-------HTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMIS-GSTQKGPSKPY------NVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            V A+G GL +G+   PA F+ID+       LGVT+EGP EA I+  DNGDGTC+V YLP E G Y VN+ +N+ HI  SPF   I P       + ++      G G+ P GV  ++ + F V+   +  N   G +   I +P      +  V    D  +   Y+P   G+H I++ YD +PV  SP+ V V  G DP+R +AYGPGLE+G+T Q  KFTV+ +GAG GGL L+IEGP++A++ C DN+DG+C V YL   PG YD++I+F +KHIPGSPF V + + VD SKVK YGPG+E    R   P+ F VD  +AG   + V + ++    V   ++  K    ++ V Y+P   G+    +V ++ ++VP SPFV  V    EP KV V G   +          +P+ F I+T+ AG++D+ + +  P  +++   ++    GT+   +  D  G Y   + YG+K + GSPF +      + ++C +          G    + V+ + AGDG ++ K     G+ +      E+ G   + Y     G Y++ + F  ++IPNGS    A +  EQYS       +TT+  +   ++E         Y  V F K P+      V A V  PS + D P + +N DGT++V+Y P E G HEL V YNG+P+ GSPFKF+VDS I SG VTAYGPGL++G     A+FTI TK A AGGL++AVEGPSKA+I   DNK+GT  V YLP APG+Y + ++F DKHI GSP+ AKI GE +KR+QI VG+ S+V  P  I++ D+  LNA + +P+G EE C LKR+  G +GISFTP+E+GEHLV+V R G+HI NSPFK+ V E E+G+A +VK+ G GL +G  +    F VDTRNAG+GGLS+SIEGPSK EI+C D  DGT  ++YKPTEPG YI+N+K+AD +V GSPF V + G  S+   E+I R +DA  +++IG+ C+L   +PG    +  A V SPS   E  EI  + D  +++ F+PKELGVHTVSV+    H+ GSPFQFTVGPL D G H V   GSG+ERG+  +A +F ++TREAG GSL+I++EGPSKA+I+F+D KDGSC V+Y+V EPG+Y   +KFND H+P SPF + +  +                 D+  + +           +   F++  +G   G + A +++PS  +    I  ID   YSV F P ENGIH +HV  N   IP SPFR+ VG+       +H          TG   +F ++T NAG G L V+IDGPSKV ++C E E GY   Y P  PG++ I++KY  N HI+GSPF V  +G+      +   +  + +TV  ++ G    G   P        V  +G GLK A IGK+N+F + A  AG ++LYVG+ GP  PCEE ++KH G+N + V Y V+++G+++L+++WG   +PGSPF+I V
Sbjct:  962 VQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVP-------VPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGN-CIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDS-ITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---------------GDAHKLEVQQFPQGNIQADAPYQFMVRKNG-AKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2429          

HSP 2 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 816/2493 (32.73%), Postives = 1254/2493 (50.30%), Query Frame = 2
Query:  173 AERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAG-SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIE-RAKTNIETYFVVDCKLAGSGDIGISVLDEKMR-DVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYK---VIATDRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSI------PVQSA-------------KLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEE----PPAPLGVTIEGPMEAKI-DYIDNG--DGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQ--PQKFTVDLEGAGQGGLGLSI---EGPADAQIQCFDNKDGTCSVQYLPQKPGS-YDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTG-PNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPV--------HSEAKPEQC--YIEGPILNEVPVGKT---------VTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIER---TTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNK--NGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI----FGEPKKRSQICVG-----TTSDVPLRISETDINN-----LNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFV-GENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKV--EIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGA-GSLSIAIEGPSKAEID-FQDNKDGSC-GVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSP------------------------------------------FRXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQE------NESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAI 7249
            AER+LAEDAQWK IQ+NTFTRWAN+HLK  +  I++L+ DL+DGL+LI L++ LS       +KRP FR+QKLENV++ L+FL++ EG+++VNIDSSDI DC+LKLILGLIWTLILHYSI+MP+W+GED  Q +G G   +PKQRLL WI++K+P  P+ NFT DW  G A+GALVDACAPGLCP+W  WDPK A++NA EA+  A++ LNV  LI+P E++NP VDE++MMTYLSQ+PN++L   APL PKTN  RVRAYGPG+E  G  +G PA FTV+TF+AGKG++D+ +  P G+ E  ++  + +K L Y+ SYIP  EG +++ +KF+  +IP SPF V V+  AGD SKV  +GPGI+P G  + + TFF++   +AG G  + +I+D    K SV  K+ +   + +  EY T  +GLHSVNVF+AG  I +SPF V V+     SDA++  A+GRG+Q  GVRV D A+F+++TE AG  +  V V GPG   +     KV    YEC Y P + G YV+ + +    +  SPF V V P KES I A+GPGL+ G++  PA F VETNGETGALGF++ GPS+A+I+C DNGDGSA V Y PT  GEYAVHILCD+E+IPKSP++AQI L    F P  V A GPGL  +G++ N+P  F V+   AG +P  V  +  DV G  +PV++++N DGT    YTP     HTV V+YG V+ P SP +V V    +AA ++ +GP ++   + N  T+F VD + AG  ++ + ++ E+ + +VP    DN D T++++  P + G   T   +  +  +P    KV +E   D  K K++ L  T P+  L +F I+T     K    + + SP+G+R+   +  T  GF+  FTPT +G + +++   G PI   P++   +  +D    + + P  E  ++   A++ ID +   +  +      P ++A                P E  +       N++     P + +I PV        L+   V+  G      + N    F++D ++         L   I  PM   +   I  G  D    + Y P E G + + ++Y++  +  SPF V +    KS     D A+  AYGPGL       +  +KFTV  K     G G +   I  P   + TCT  +N DG+    Y     G++ I I +    +  SP+ V V +  DPS+++ YGPG+E G  ++  P  F VD+  AG G + + +   EG     ++  D  +   +V Y+P K GS     +KF+E  +P SPF + +    + +KVK  G   E+  +    P++F +D  +AG+A + V + +   K+++P   L + + G + V+++P+  G  +  + Y + ++ GSPF      + E +K  +  +  +     +  +   S   ++ R+AG+  +   +T    +E V++DV    DG F   Y  + PG+Y + V +G K++P   F +          HSE   E     ++    +E+  GK+           +P+ T     G ++A+   P G +    I++ R G  +V Y P++ G++E+ + +N E +     + +       Y        TH  T E +   I T+          G     +   V  PS + D+    +N DGT++VQY P+  G +++ V +  + I GSP+   +          + G   S     M    T    D     L+ +++ PS  E  C   +   G   +S+ P   G++ + +K + KHI  SPF   +     G+ KK      G     T +D    I   D  N     L+  +  P+  E  CT K   +G L IS+ P E G ++VN+  +  H+  SPF + V GE       +++   D +    +   C+            L+  +  PS V  + E  +  DG   V + P E G + ++V+Y++ ++PGSPF   +G    S  +  +       E   +G   E N+        +   SV  PS +    E     D    + +   E G + V +K ++RH+  SPF+  V P   G  HK+ +         A+   QF +  R+ GA G L   I  PS  + D F    DG    V +   E G +   +KFN  H+P SPF +++ ++                 D   +  +         G KA+F+IN      G+++  +  PS   ++A         Y V + P+  G H + V  NN  I GSP                                          F+    +V   G G+   + G+ N+F +  ++AGN  L V + GP   +  C+E        + YN  Y+    G Y + IK+ G  HI GSPF + +
Sbjct:   33 AERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGH--TPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL---SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI-LPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQ--DVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ-RVPLGE-KVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIIT-HGLPKADLAVTITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPV------PNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV----KSGC---DPARCKAYGPGLEKG--LTNQKNKFTVETKGA---GNGGLSLAIEGPSEAKMTCT--DNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVN-EKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPR--LEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPK-----IQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEK-DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTG---GNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTK----------GASAGGLTMAVEGPS-KADI-NYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVG---SCSEVTMPGDIT----DDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHAD---NIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDK--DDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSG-SHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKA--DIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA-GDAHKLEVQQFPQGNIQADAPYQFMV--RKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKD---------------VADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPS---KVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGP---KGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKW-GEEHIPGSPFQIDV 2429          

HSP 3 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 578/2035 (28.40%), Postives = 934/2035 (45.90%), Query Frame = 2
Query: 1832 SKIKAFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPS----EAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGS--PSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNG-FVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPE---TETPLLIS--------ADYAID-NKAYNKP-SIPVQSAKLT--PVERSNVKTFSNPN-KQRSNFEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVA-NTPASFIIDSTEEPPAPLGVTI---EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAG----EAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVT--IPVNTQNAGDGILSAKNVG----PVGNIVPCSIENERYGHSTVSYVPQKIGA-YEVQLMFNDENIPNGSIRQYAFQPQE--QYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDY-VRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDM-----HAHFTIVTKDAGAGGLSLAVEGPSKAEIQCID--NKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFG--EPKKRSQICVGTTSDVPLRISETDI-----------------------NNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQ----DAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFR--------XXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            ++++A+GPG+   G +V  PA F VET +   G++   I+GP+    +A +   ++ + +  V+Y P   G + V +     +IPKSP+   ++++    D  KV   GPG+  +G++  KP  F +  K+AG   P  +  +  +    ++  ++R   + T+ C Y   + G H+V V Y    IP SPF V V    +A  ++  G G++     +  +  F +  + AG G+  + V+     +  V+     DG     +   T    Y I + F+  E+ +SPF+V +    +          ++  IG    F + T  +G        V  P  S+  ++  +  +G  +  + PT +G + V + C    I  SP+  IA     T  +PE      P L            + +D +KA N P  + VQ    T  PVE  N     NP+  ++  + P   + + V+             R      +    V A+G  L  GV  N    F +D+ E   A L V I   E  +E     IDN D T SV  +P   G+Y   + Y  + +   P    +  +        DV+K+     GL PT    +S  +F +    +    K  +   IT+P   R    +    +G +  +++P   G++ + I + G P+   P+ +    GSD ++++A+GPGLE GI  QP +F +D  GAGQGGLG+++EGP +A I C DN DGTC+V YLP + G Y V+I FNE+HI GSPF   I  + ++   +  G G++ +G  +   + F VD SK G       L   + D     V P++I+   T  +F + Y P   G   IE++Y+N+ VPGSPFV NV + C+P +    G G+   +G  + N+  + FT+ T+ AG   L L + GP+   +    DN  DG+    Y    PG Y + + + +K++PGSPF V V     P +  + GP +    V ++V     V+   AG G ++ K       PV N+    +E++      V YVP K G+    Q+ F++  +P        F   E  +  ++       T  S P         +F+          +   +  P  +   PRL     GT  V + P E G ++  + Y  + I GSPFK       P+G+  A    L    P +      +H  +  ++AG G ++  +   + +EI  ID   K+G  D+ Y    PGDY I +KF  K I    F+ K     E    S+     T+ V  + +++++                        N+ A V  P+G+ +   ++  ++G + + + P+E G H + V  +G  +  SPFK  V     G    V  YG GL  G+  E   F + T+ A  GGL++++EGPSK +I  HDN DGT  V Y PT PG Y ++V++ D ++ GSP+   I G       E   R+Q      +EV+  G++ + +L       R   AS+ +PSG  E C +  +      I F P+E+G H VSVK   +H+  SPF+ TV     G   KV + G+G++ G  +  N F++ TR AG G LS++IEGPSKAEI   D  DG+  ++Y+  EPG Y+ ++KF D HV GSPF +++     +   + ++ E     D+  I+          IGS+        G+T   ++A V SPSN  + A I ++++  Y+VHFVP E G+H V V  +   IPGSPF+             V   G G+  G  G   EF V T  AG G+L ++++GPSK  +  ++ + G  + +Y    PG+Y + +K+  + HI  SPF V +S +   ++    E +   Q      G+ Q     PY                  +F+V    A G+ L   +  P    ++  I+ +    + V +Y +E G H + V++    +P SPF I V
Sbjct:  285 NRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPF--PVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPAN-HKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVM-QSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVET--NGETGALGFTVAGP--SQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF--IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKN-----NPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRV---PLGEKVVVEQTV-----DVSKIKV--DGLEPTAPL-NSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSCAIFD-PMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLE--KG--LTNQ-KNKFTVETKGAGNGGLSLAIEGPSEAKMTC-TDNR-DGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNL---RVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP--------AEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKL---EAFPTGE--AKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITG-------EGRKRNQISVGSCSEVTMPGDITDDDL-------RALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRE----RDAVPIT---------EIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHK--LEVQQFPQ------GNIQA--DAPY------------------QFMVRKNGAKGE-LDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2205          
BLAST of Filamin vs. Ensembl Zebrafish
Match: flna (filamin A, alpha (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-030131-2145])

HSP 1 Score: 1860.88 bits (4819), Expect = 0.000e+0
Identity = 1079/2571 (41.97%), Postives = 1530/2571 (59.51%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGP-GLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV-APYKESKIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQ-LDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE----TYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNE---FEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETE--TPLLISADYAIDNKAYNKPSIPVQSAKLT-PVERS---NVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKA---------ELRKPN----VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE---------VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIR-------------------QYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXX---------XXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLT--QTVHMISGSTQKGP----SKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    FR  ++RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W   D  ++  + K  +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGP G+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   YS  Y+P + G++++ + FA   I  SPF+V+V  A GD SKVTA GPG+EP GN   + T+F+V+TA AG G V+ VI+D  G+KD+V+  +  +  + +   Y   +EG H + + FAG QI  SP+ V V    + S      A GRG+QP+G+RV++ AEF+V+T+ AG  DL V + GP    E C+ K +   +Y   Y P  PG Y++ I +G   I  SPF V + +     +++A+GPGL  G+V K A F VE  G+  G LGFS++GPS AKI+C D GDGS +V YWPT PGEYAVH+LC +E+I  SP+MA+I     K F P KV AYGPGL  SG+S  KPA+F V+ K  G  + +K +  D  G  + VQ++DN +GTYSC YTP+ P KHTV+VS+G VNIPESPF++N+    +   +KV GPG+  AKT ++    TYF VDC  AG GDI I +          E   D  ++ +DN   T         +       + F++  IP +P ++ ++  +D  K K      +    +LN+   F + T   G K + +     PN           +N        +TP   G   + V   G+PI  SP+ V     ++  +       + + +  D  I  K+          AK+T P  +S    V+   +P   +  F P ++  Y V+ T + A         E   P     V   G GL +     P  F++D T   PA L + I  +   EA++   DNGDGT ++ Y+P  PG+Y + + Y D+ + + P  + + P  ++S        V  +GPG+   GVF+++ + FTV+A+ +   G   +K  I NP   R+   + +  DGTY   Y+P  +G H +++ YD  PV KSP+ VPV +G DP+R+R +GPGL+ GIT +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+C V+Y+P +PG+Y++++ +  + I GSPF+VP+HD VD +KVKC G GL  N  R   P  F+VDASKAG APL+V V       V+PA+++         V+Y+P   G   I VLY + ++P SP+   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P+ +    ++ ++ DGT+   Y  D+ G YT+ + YG   +P SP+ +         +C +   I            + +G+   I V+ + AG G ++     P G  V   +     G   + Y   + G Y + + F  E+IPN   +                   QYA+ P    +                +R    V+ F    G +   VR     PS +   P + +N DGT+TV+Y P+E+GLHE+++ Y+G  I GSP +FYVD  + SG VTAYGPGL +G  +  A FT+ TKDAG GGLSLA+EGPSKA+I C DN++GTC VSYLP+ PGDY+I +K+ DK+I GSPF +KI G+   R S + VG+ +D+PL I E D++ L A + +P+GREE C LK L+NG++GISF PKE+GEHLVN+ ++GRHIP+SP  + + ++EIG+ASRV++ G GL++    E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGS F V + G     + E I R + AA V+ +G+ C+L+L IP  +  + TA V SPSG     EI+   +N + IRF+P E+GVHTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER  A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGS GV+Y V EPGDY  SIKFNDEH+P SPF++     P +S S          +D+R +++A+LQ+ G  +   A+F ++ +G   G I A V SPS   +   +++ID ++Y+V F+P ENG++ + V  N S IPGSPF++ VGE          +  G G+  G TG   EF V+TS+AG GAL VTIDGPSKV+++CQE   GY  TY P APG+Y ISIKYGG  HI+GSPF   I+G+   ++ S+ ET S+        ++ S Q  P    S    V  +G GL    IG++N F VD   AG ++L VGV GP  PCEE+ +KHLGN  + V+Y ++EKG ++L+V+WG+  +PGSP+ I V
Sbjct:   33 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIANLQTDLSDGLRLIALLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLD-IENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMW---DEEEESEESKQKTPKQRLLGWIQNKLPELPITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKPVDNAREAMQQADDWLGVPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPAGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPS---LCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGK-APLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGV--AKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTI---MVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAG-KAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSG-------VKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNN-VRANIPQVFSVDASKAGMAPLQVRV-QGPKGVVEPAEVVDNGDQ-THTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTALEGDSPDQLMQQSQNLQYAYAPNMGQTWATDGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRM----PSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVD-YVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTG--EGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVV-----PVASPS----------DDARRLTVASLQESGLKVNQPASFAVSLNG-AKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2553          
BLAST of Filamin vs. Ensembl Zebrafish
Match: CR352234.3 (filamin A, alpha (actin binding protein 280) [Source:NCBI gene;Acc:562529])

HSP 1 Score: 1860.5 bits (4818), Expect = 0.000e+0
Identity = 1081/2563 (42.18%), Postives = 1532/2563 (59.77%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV-APYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQ-LDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE----TYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNE---FEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPET--ETPLLISADYAIDNKAYNKPSIPVQSAKLT-PVERS---NVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKA---------ELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE---------VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYS------IERTTHHYTTEQ------SKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXX---------XXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLT--QTVHMISGSTQKGP----SKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    FR  ++RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W   D  ++  + K  +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   YS  Y+P + G++++ + FA   I  SPF+V+V  A GD SKVTA GPG+EP GN   + T+F+V+TA AG G V+ VI+D  G+KD+V+  +  +  + +   Y   +EG H + + FAG QI  SP+ V V    + S      A GRG+QP+G+RV++ AEF+V+T+ AG  DL V + GP    E C+ K +   +Y   Y P  PG Y++ I +G   I  SPF V + +     +++A+GPGL  G+V K A F VE  G + G LGFS++GPS AKI+C D GDGS +V YWPT PGEYAVH+LC +E+I  SP+MA+I     K F P KV AYGPGL  SG+S  KPA+F V+ K  G  + +K +  D  G  + VQ++DN +GTYSC YTP+ P KHTV+VS+G VNIPESPF++N+    +   +KV GPG+  AKT ++    TYF VDC  AG GDI I +          E   D  ++ +DN   T            +YTI + F++  IP +P ++ ++  +D  K K      +    +LN+   F + T   G K + +     PN           +N        +TP   G   + V   G+PI  SP+ V     ++  +       + + +  D  I  K+          AK+T P  +S    V+   +P   +  F P ++  Y V+ T + A         E   P     V   G GL +     P  F++D T   PA L + I  +   EA++   DNGDGT ++ Y+P  PG+Y + + Y D+ + + P  + + P  ++S        V  +GPG+   GVF+++ + FTV+A+ +   G   +K  I NP   R+   + +  DGTY   Y+P  +G H +++ YD  PV KSP+ VPV +G DP+R+R +GPGL+ GIT +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+C V+Y+P +PG+Y++++ +  + I GSPF+VP+HD VD +KVKC G GL  N  R   P  F+VDASKAG APL+V V       V+PA+++         V+Y+P   G   I VLY + ++P SP+   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P+ +    ++ ++ DGT+   Y  D+ G YT+ + YG   +P SP+ +         +C +   I            + +G+   I V+ + AG G ++     P G  V   +     G   + Y   + G Y + + F  E+IPN   +         +       I  +    T  Q          +R    V+ F    G +   VR     PS +   P + +N DGT+TV+Y P+E+GLHE+++ Y+G  I GSP +FYVD  + SG VTAYGPGL +G  +  A FT+ TKDAG GGLSLA+EGPSKA+I C DN++GTC VSYLP+ PGDY+I +K+ DK+I GSPF +KI G+   R S + VG+ +D+PL I E D++ L A + +P+GREE C LK L+NG++GISF PKE+GEHLVN+ ++GRHIP+SP  + + ++EIG+ASRV++ G GL++    E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGS F V + G     + E I R + AA V+ +G+ C+L+L IP  +  + TA V SPSG     EI+   +N + IRF+P E+GVHTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER  A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGS GV+Y V EPGDY  SIKFNDEH+P SPF++     P +S S          +D+R +++A+LQ+ G  +   A+F ++ +G   G I A V SPS   +   +++ID ++Y+V F+P ENG++ + V  N S IPGSPF++ VGE          +  G G+  G TG   EF V+TS+AG GAL VTIDGPSKV+++CQE   GY  TY P APG+Y ISIKYGG  HI+GSPF   I+G+   ++ S+ ET S+        ++ S Q  P    S    V  +G GL    IG++N F VD   AG ++L VGV GP  PCEE+ +KHLGN  + V+Y ++EKG ++L+V+WG+  +PGSP+ I V
Sbjct:   33 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIANLQTDLSDGLRLIALLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLD-IENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMW---DEEEESEESKQKTPKQRLLGWIQNKLPELPITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKPVDNAREAMQQADDWLGVPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPS---LCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGK-APLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGV--AKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTV---KYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAG-KAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSG-------VKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNN-VRANIPQVFSVDASKAGMAPLQVRV-QGPKGVVEPAEVVDNGDQ-THTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRM----PSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVD-YVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTG--EGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVV-----PVASPS----------DDARRLTVASLQESGLKVNQPASFAVSLNG-AKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          
BLAST of Filamin vs. Ensembl Zebrafish
Match: CR352234.2 (filamin A, alpha (actin binding protein 280) [Source:NCBI gene;Acc:562529])

HSP 1 Score: 1860.5 bits (4818), Expect = 0.000e+0
Identity = 1081/2563 (42.18%), Postives = 1532/2563 (59.77%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV-APYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQ-LDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE----TYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNE---FEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPET--ETPLLISADYAIDNKAYNKPSIPVQSAKLT-PVERS---NVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKA---------ELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE---------VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYS------IERTTHHYTTEQ------SKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXX---------XXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLT--QTVHMISGSTQKGP----SKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    FR  ++RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W   D  ++  + K  +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   YS  Y+P + G++++ + FA   I  SPF+V+V  A GD SKVTA GPG+EP GN   + T+F+V+TA AG G V+ VI+D  G+KD+V+  +  +  + +   Y   +EG H + + FAG QI  SP+ V V    + S      A GRG+QP+G+RV++ AEF+V+T+ AG  DL V + GP    E C+ K +   +Y   Y P  PG Y++ I +G   I  SPF V + +     +++A+GPGL  G+V K A F VE  G + G LGFS++GPS AKI+C D GDGS +V YWPT PGEYAVH+LC +E+I  SP+MA+I     K F P KV AYGPGL  SG+S  KPA+F V+ K  G  + +K +  D  G  + VQ++DN +GTYSC YTP+ P KHTV+VS+G VNIPESPF++N+    +   +KV GPG+  AKT ++    TYF VDC  AG GDI I +          E   D  ++ +DN   T            +YTI + F++  IP +P ++ ++  +D  K K      +    +LN+   F + T   G K + +     PN           +N        +TP   G   + V   G+PI  SP+ V     ++  +       + + +  D  I  K+          AK+T P  +S    V+   +P   +  F P ++  Y V+ T + A         E   P     V   G GL +     P  F++D T   PA L + I  +   EA++   DNGDGT ++ Y+P  PG+Y + + Y D+ + + P  + + P  ++S        V  +GPG+   GVF+++ + FTV+A+ +   G   +K  I NP   R+   + +  DGTY   Y+P  +G H +++ YD  PV KSP+ VPV +G DP+R+R +GPGL+ GIT +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+C V+Y+P +PG+Y++++ +  + I GSPF+VP+HD VD +KVKC G GL  N  R   P  F+VDASKAG APL+V V       V+PA+++         V+Y+P   G   I VLY + ++P SP+   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P+ +    ++ ++ DGT+   Y  D+ G YT+ + YG   +P SP+ +         +C +   I            + +G+   I V+ + AG G ++     P G  V   +     G   + Y   + G Y + + F  E+IPN   +         +       I  +    T  Q          +R    V+ F    G +   VR     PS +   P + +N DGT+TV+Y P+E+GLHE+++ Y+G  I GSP +FYVD  + SG VTAYGPGL +G  +  A FT+ TKDAG GGLSLA+EGPSKA+I C DN++GTC VSYLP+ PGDY+I +K+ DK+I GSPF +KI G+   R S + VG+ +D+PL I E D++ L A + +P+GREE C LK L+NG++GISF PKE+GEHLVN+ ++GRHIP+SP  + + ++EIG+ASRV++ G GL++    E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGS F V + G     + E I R + AA V+ +G+ C+L+L IP  +  + TA V SPSG     EI+   +N + IRF+P E+GVHTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER  A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGS GV+Y V EPGDY  SIKFNDEH+P SPF++     P +S S          +D+R +++A+LQ+ G  +   A+F ++ +G   G I A V SPS   +   +++ID ++Y+V F+P ENG++ + V  N S IPGSPF++ VGE          +  G G+  G TG   EF V+TS+AG GAL VTIDGPSKV+++CQE   GY  TY P APG+Y ISIKYGG  HI+GSPF   I+G+   ++ S+ ET S+        ++ S Q  P    S    V  +G GL    IG++N F VD   AG ++L VGV GP  PCEE+ +KHLGN  + V+Y ++EKG ++L+V+WG+  +PGSP+ I V
Sbjct:   33 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIANLQTDLSDGLRLIALLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLD-IENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMW---DEEEESEESKQKTPKQRLLGWIQNKLPELPITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKPVDNAREAMQQADDWLGVPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPS---LCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGK-APLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGV--AKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTV---KYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAG-KAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSG-------VKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGLGNN-VRANIPQVFSVDASKAGMAPLQVRV-QGPKGVVEPAEVVDNGDQ-THTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRM----PSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVD-YVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTG--EGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVV-----PVASPS----------DDARRLTVASLQESGLKVNQPASFAVSLNG-AKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          
BLAST of Filamin vs. Ensembl Zebrafish
Match: flnca (filamin C, gamma a (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-070503-1])

HSP 1 Score: 1064.29 bits (2751), Expect = 0.000e+0
Identity = 767/2146 (35.74%), Postives = 1097/2146 (51.12%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKT-NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES---KIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNTTPIGQL-NEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV----------IATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIY---------PVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQ-PQKFTVDLEGAG--QGG--LGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTP-GLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIV---PVHSEAKPEQCYIEGPILNEVPVGKT--VTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTH---HYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFK-FYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCI--DNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSP--FTAKIFGEPKKRSQ---ICVGTTSDVPLRISETDIN----NLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSS-SLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTV 6370
            E++LAEDA WK IQ+NTFTRW N+HLK  N  + DLQ DL DGLKLI+L++ LS    +R  H RPNFR  KLENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W+ ED    D + K  +PKQRLLGWI +K+P  P+ NF  DW DG A+GALVD CAPGLCP+W  WDP Q ++NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   AP+ PK     + +AYGPG+E +GN +  PA FTV+T  AG G + + V +P+G  E  ++  + +K+  +S +Y+P +EG +++ + FA  +I  SPF VNV  A GDP+KV A GPG+EP GN   + T+F+++TA AG G V  VI+D + + ++V+  +  + +N F   Y    EG H+++V FAG  I SSPF V +S     S+A    ATGRG+QP+GVRV++VA+F V T+ AG  +L V+V GPG      ++  V   +++C Y P +PG Y V+I +G  PI  SPF V+V+  KE+   K++A+GPGL  G+V K A F VE  G E G LGFSI+GPS+AKI+C D GDGS +V YWPT PG+YAVH++CDDE+I  SP+MA I        P KV A+GPGL  +G++ NK   F V+ + AG    +K    D  G  I +QI D  DGT+ C Y P  P KHT+I+++G VNIP+SPF+V V E  +   +KVYGPG+E+   K N  TYF VDC  AG GD+ I +          E   D  ++ +DN   T             YTI + F++ EIP SPFKV ++  +D  K +     +N T    ++   F I T   G K +PE+  K+          +  +N    +   +T    G   + V   G+PI  SP+K+          +    +N K     +   +++   A      N  SI   S +  P +  + KT          + P EE  Y         PV  +    E   P     V AYG GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV YLP E G Y +N+LY + HI  SPF   + P         D  KVTA GPGL          + FTV+          +   I+++   Q   C + NN DGT+S +Y+P   G H I I Y G  V KSP  V V    D S I+ YGPG+E +G+ ++    F VD       +GG  + + I  P+ A    +  D  DGT  V+Y   + G + + + ++E  +P SPF V + +  D ++V+ YGPGLE  G  V  P+ FTV+   AG A L + +     +    A++L K    G   V Y+P   G+ +I + Y    +PGSPF   V +  +  KV  +G G+     + +   VP  FT++   AG + LE+ + GP      + V N+ DGT T  Y     G +TV V Y N+ VP SP+ V   P H  +K       GP L+   V  +  V   ++ ++AG G+L+ + + P G     SI + R G  TVSYVP   G Y + + +  +NIP       AF   +      T     H   E   P I+     V            V   V  P+  +    +  N DGT  + Y   E G + + + + GQ I  SPF+    D  +     T         +P       ++      G LS  V  PS    +    DNK+GT  V + P   G + + IK+   HI GSP  F   +       +    +C GT +  P   +    N     L+  V  P+  E SC  K  ++G   +S+ P   G++ + V     HIP SPF   +  ++        L    LN G   +    + +T +  Y  L+ SI+ PS  E  C      + H G   +++ P E G + ++V+ +  +V  SPF + +G  PS      R+         +    V E  +            S+  PS     C+ +   D    + + P E G + +++K  ++H+ GSPF   V
Sbjct:   32 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKGVTDLQKDLGDGLKLISLLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLDR-ERIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDED----DEEVKKLTPKQRLLGWIQNKVPELPINNFNKDWRDGKALGALVDNCAPGLCPDWQTWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPKQLYPKKAKAYGPGIEPQGNMVLKPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEA---SNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVS--KEAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGK-GGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTV---KYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAG-KAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNV-SITSPSGRPIPCKLESDKT---KEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPAL-------DAGKVTASGPGLERAKA--GEVASFTVDCS--RAGEAELTIEIVSDSGAQAEVC-IQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLE--GGIVNKPNCFTVETRGAGTAGLGLTI-----EGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGL----ANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASK---VRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDT---------KPMFQPLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNK-PASFTVVTKNAGQGGLSLAVEGPSKAEISC--KDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDD-------SLRRSQLNVGTAADVSLKITET-DLSY--LTASIKAPSGKEEPCLLKRLPNRHIG---LSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVG--PSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDV--EDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKV 2103          

HSP 2 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 761/2301 (33.07%), Postives = 1125/2301 (48.89%), Query Frame = 2
Query:  941 RVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE----SKIKAFGPGL--TGGIVSKPAFFEVETNGETGALGFSIKGPSEA----KIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPS-TVKAECF-DVTGQT---IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE--TYFVVDCKLAGSGD----IGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQ--ETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV---IATDRVNTKEYPETETPLLIS--ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN-FEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKP-IDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE---------VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPK-KRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPG------YNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSK--AEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIH----HGHTGRINE--FFVDTSNAGNGALTVTIDGPSKVQLNC--QENESGYN-FTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            +V+A GPGLE EGN    P  F + T  AG G++ +++++P+ +    E+      +  + C+Y P +EG + I + FA   IP+SPFKVN+  A+ + +   A+G G++P G  V     F VFT  AG G +   +    G +  V  K+    +  F  +Y   + G ++VN+ + G  I  SPF V VS +   +  ++  A G G++     V   A+F V         LG ++ GP ++  +C  K    C  +  Y P  PG Y V +   +  I  SPF   + P        K+KAFGPGL  TG  V+K   F V+   E G  G  I           I   D GDG+    Y PT P ++ + I   + NIPKSP+     L  +   P KV  YGPG+  +G+  N+P  F V+   AG    ++  +C   V G     I   I  N++ T++ +YTP  PG++T++V + +  IP SPFKV V  + +A  ++  GPGI +    +E  T+F +  K AG          +     ++D  ++  DN D ++T+KYT    G    + +      IP+SPFK+ +    D  K K+  LN    +G+  EF + T   G + +  + + SP+G  +P KL+  +T       + P   G + V +   GNP+  SP+ V   +  D    + Y       ++   A ++ID K             L     + ++   N +   S  + P E   Y +              +   K  L    VTA G GL +  A   ASF +D +    A L + I  +   +A++   +N DGT SV Y P   G + + + Y  + +  SP +V + P         D + +  YGPG+ P GV ++  + F V+A+      G   VK  I NP    +   + +  DGTY   Y+   DG H I++ YD V V KSP+ V V +G DP+R+RAYGPGLE GI  +P  FTV+  GAG  GLGL+IEG ++A++ C DNKDG+CSV+Y+P   G YD++I +  + IPGSPF V + D+VDVSKVKC GPGL  N      P  FTVD SKAG APL+V +     K      ++  +  G   V Y P   G   + V Y N +VP SP+  N   S +  KV  +G G+       +A  +P  FTI+ RDAG+  L + +  P  +     + ++ DGT+T  Y  D+ G YT+ + YG  N+P SP+ V         +C +   I            + + +   I V+ + AG G ++     P G  +   +     G   + Y   + G Y + + F  ++IP    +  A    +Q    R       + +KP+ +    V+ F    G +   VR     PS +   P + +N DGT+TVQ+QP+E GLHE+++ Y+G  I GSP +FYVD T  SG VTAYGPGL +G  +  A FT+VTK+AG GGLSLAVEGPSKAEI C DNK+GTC VSYLP  PGDY+I +KF + HI GSPFTAKI G+   +RSQ+ VGT +DV L+I+ETD++ L A + +P+G+EE C LKRL N ++G+SFTPKEVGEH V+V +SG+H+ NSPFKI VG +EIG ASRVK +G GL +    E  +F VDTRNAGYGGL LSIEGPSKV+I C D  DGTC VTY PTEPG YIIN+K+AD ++PGSPF V + G     + + I R + AA ++ +G+ C+LNL IPG        Q   T +    S ++   E   +S           +  VH V   +      G PF+      +  G  ++   G+  + G             E G   ++  +  P    A+ +  D+ + +  V +   E G +  ++K+  EHVPGSPF   +       + K              +       +       A F I       G +S  V  PS  E   +     +    V +V  E G + V +  NN  IP SPF V V  ++     +          ++N+   F    N   G +   +  PS V   C   E +S  N   ++P   G ++I +K+ G +HI GSPF V +            E +S+                 P  V   G GL+    G  +EF+V+   AG   L V + GP +   + N    G   ++++Y     G +L+ +++G    + GSPF+  V
Sbjct:  384 KVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAS-NANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVE--VPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKE---AGTQKVRAWGPGLKTG--MVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSC--DVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAR-EAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRV---LVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEII--DNHDYSYTVKYTALHQGEMAIV-VTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGG---LGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSV-------DTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLA-NKVTAHVPQTFTVDCSKAGVAPLEVQLY--GPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTG---VAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMA---TDQPVAPR-------DDTKPMFQPLNLVIPFTVQQGELSGEVRM----PSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVT-NSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTG--EGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGG----ETKREVH-VEESTQVGGGGGDPFRDVFESFL--GRDRLGSFGTIRQEG-------------ETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHK--------------VRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAE--INFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDDARRLTVTSLQEKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNG-SHIPGSPFKVRVG-----------EAESV---------------GDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEG---YKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKV 2568          

HSP 3 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 478/1529 (31.26%), Postives = 741/1529 (48.46%), Query Frame = 2
Query: 3215 VTAYGEGLV-KGVANTPAS-FIIDSTEEPPAPLG----VTIEGPMEAKID-YI-DNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQ-PQKFTVDLEGAGQGGLGLSIEGPADAQ--IQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVT----GEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIR------TEYSVVDFKFPVGPVFDYV----RAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPF--KFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNK--NGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI----FGEPKKRSQICVGTTSDVPLRISETDINNLNA-------IVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFV-GENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXX---------XIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-----LTQTVHMISGSTQKGPSKPYN----VKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            +  YG G+  KGV     + FI+D+        G    + I  P  A  D YI D GDGT  V Y   E G +++ V Y++  +  SPF V++           D  +V AYGPGL   G   +  + FTV  +     G G+    I      +  C   +N DG+ S  Y P   G + I+I Y G P+  SP+ V V    D S+++  GPGL   +T   PQ FTVD   AG   L + + GP      +   +N+DGT +V Y P + G + VS+K+  + +P SP+ V      D SKV+  GPGL+  G     P +FT+DA  AG+  L V ++D   K  K +  +  +  G + V+Y+P+  G   I + Y    +P SP+      + +  K ++T    G GV    G  I     ++ T++ + AG+  +   V  PN   +++DV  + DGTF   Y    PG Y + + +G +++P SPF V    +    +   + P+   +     + IP   Q    G LS +   P G      I + + G  TV + P + G +E+ + ++  +IP   +         Q+ ++ T     T     +          ++VV      G +   V    +A ++C  N+          DGT TV Y P+  G + + V ++   I GSPF  K   D ++   Q+               A  ++   +     L+ +++ PS  E  C+  +  N    +S+ P   G++ + ++   KH+  SPF   +     GE  +      G        ++E  ++  NA        +  P+  + +C    +++G   +++ P E G +++N+  + +HIP SPF + V GE  +  +   K     +    V  TC   +      +  LS   E  ++        +  T       T  G     V   +S   G       GG P   + E  L          I    E  +       +  TA V SP G+    EI+   ++ + +RF+P E+G HTV+VK    HV GSPFQFTVGPL +GG HKV   G+G+ER +A    +F+I+TREAGAG LSIA+EGPSKAEI+F+D KDGSCGV+Y V EPGDY  SIKFN+EH+P SPF++     P ++ S          +D+R +++ +LQ++   +  +A+F +  +G   G I A V +PS   +   ++++D+++ ++ F+P ENG+H++ V  N S IPGSPF+V VGE    G+         G+  G TG  +EF V+T  AG+GAL+VTIDGPSKV+++C E + GY  +Y P APG+Y I IKYGG  HI+GSPF   + G       S+ ET S     +T++  M    +    S P +    V C G GL  A +G++N F VD   AG ++L VGV GP  PCE+V +KH+GN  + V Y V+EKG ++++V+WG+  +PGSPF +  P
Sbjct: 1260 IKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGC-------DPTRVRAYGPGLE--GGIVNKPNCFTVETRGAGTAGLGLT---IEGASEAKMLC--KDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKAS--IHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDTK-PMFQPL----NLVIPFTVQQ---GELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPL---------QFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNK----------DGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNV----------GTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINC--DDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQSITRKRQAASI--ASVGSTCDLNLKIPGNWFQMLSAQ-ERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGG-----GGDPFRDVFESFLGRDRLGSFGTIRQEGETGI-------QGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIV-----PVATLS----------DDARRLTVTSLQEKDLKVNQEASFAVQRNG-ARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHVSAP 2702          

HSP 4 Score: 438.343 bits (1126), Expect = 3.757e-123
Identity = 416/1546 (26.91%), Postives = 669/1546 (43.27%), Query Frame = 2
Query: 3164 IYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPM----EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFN------GKGIVKAIITNPFNQRSTCTV--DNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGI-TKQPQKFTVDLEGAGQGGLGLSIEGPADAQ--IQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVL---NSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSA------KNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYG--PGLSYGRPDMHAHFTIVTKDAGA-GGLSLAVEGPSKAEIQCI----DNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAK--IFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQ-----NGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSI--EGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTAS------VISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIG-SKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG----HTGRIN----EFFVDTSNAGNGALTVTIDGPSK--VQLNCQENESG-YNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIV 7618
            + P Q   +KA+   P +   G  ++K     PA F +++ E     + V +E P     EAK+   ++   T SV Y+PK  G + V VL+  + I  SPF V +      +  + D  KV A GPGL P G          V  KP  F+      G G V  +I +P N+ +T  V  +N  D  + C+Y P ++G H I +T+ G P+  SP+ V + + S+ +  RA G GL+ +G+  K+   FTV  +GAG G L +S++GP   +  ++  D  DG     Y P KPG Y V+I +  + IP SPF V +       KV+ +GPGL+     V   + F V+A       L  ++   +   ++          G  DV Y P   G+  + V+ ++  +  SPF+ ++L   N   PEKV   G G+ P    +  NK  + FT++ R+AG+  L++         +++ + + GDGTF C Y    P  +T+ + +G  N+P SPF V V     P++  + GP + +  +   +     V+   AG G +S         VGP    +   I        TV Y P   G Y + ++F D+ IP+   +       +   +            +  I T +++  F    G     V        N      +I+N D + TV+Y     G   + V + G PI  SPFK  V  ++  G+V   G    +  G+      F + TK AG  G +++++  PS   I C       K  TC V Y+P   G Y + I +    +  SPF+ +  +  +P K      G    +  + ++  I+   A         E     +++     +G   + + P E G++ +N+L    HIP SPFK  V      +A +V   G GL      E   F VD   AG   L++ I  +  ++ E+   +N DGT  VTY P   G + I +KY    VP SP  V +     S  T  I  +    E   +      + I+       T         +I+PSG+     I    D  + + +   E G+H + V  D   V  SPF+ +V    D  P +V   G G+E G+ N  N FT+ TR AG   L + IEG S+A++  +DNKDGSC V Y     GDY  +I +  + +PGSPF +Q              ++           + A   Q F +  SKA             +   +  P    +   +    +  ++V++ P + G H V V   N  +P SP++V       + +    G     TG       EF +D  +AG G LTV I  P     + +  +N  G Y  +YVP+  G YTI+IKYGG+N I  SP+ V      + + D+ +   +++   H ++ S   GP+               ++ +     VDA  AG   +   V  P     ++++    +  F + Y   E G++++ +R+G   +P SPF+++
Sbjct:  275 VKPKQLYPKKAKAYGPGIEPQGNMVLK-----PAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNV------AKALGDPNKVQARGPGLEPEG---------NVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTG--MVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIE----CDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPT--GVTVNK-STQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTI--FTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGK---DQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATC-VKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVV--KPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKV---EPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCD--PTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQ-------VKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVA---------PLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDN-IPYSPYNV----QAFPTGDASKCLLTVSIGGHGVAESL--GPN--------------IQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVM 1741          

HSP 5 Score: 224.557 bits (571), Expect = 6.913e-58
Identity = 190/602 (31.56%), Postives = 281/602 (46.68%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSK----VTASGPGI-EPVGN--EVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSK--TSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKK 2701
            ++ +VRA GPGL+  G     P  FT+D  +AGKG L + +L+P+G+ +   I D  N++  Y+ SY+P M G Y I IK+    IP SP+ V      GD SK    V+  G G+ E +G   ++   T   V    AG G V C +    G +  +   +T+  +  F I YT  E G + + + F G  I  SPF VM + +      D K  +      QP  +    V  F V        +L   V  P     +  I+          + P   G + +DIKY  N I  SP    V       + A+GPGL  G V+KPA F V T N   G L  +++GPS+A+I C DN DG+  V+Y PT PG+Y + +  D+ +IP SP+ A+I  D    D L+ +    G  + +S       I  T  +   +++KA     +G+  P  ++   +      +TPK  G+H V V     ++  SPFK+ V   E G A+ +K +G G+  A T     F VD + AG G +G+S+  E    V +  DD  DGT        T    Y I I F++  IP SPF V +  +   K+
Sbjct: 1546 DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHD--NRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQA-FPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGME--LDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDTKPMF------QPLNL----VIPFTVQQ-----GELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGD----DSLRRSQLNVGTAADVSLK-----ITETDLSYLTASIKAP----SGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSI--EGPSKVDINCDDVEDGT-CKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQ 2111          

HSP 6 Score: 132.88 bits (333), Expect = 4.739e-30
Identity = 138/501 (27.54%), Postives = 212/501 (42.32%), Query Frame = 2
Query: 1052 VLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKN-AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDA-GFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE----SKIKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAV--------HILCDD------------------------ENIPKSPYMA----QIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTV------KAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVN 2386
            V +P G     EI DS N    Y   ++PT  G + + +K+    +P SPF+  V     G   KV A G G+E    +V     F+++T EAG G +   +       ++ + RKD               + Y  +E G + V++ F    I  SPF V V+  T + DA++   T   +Q + ++V   A F V    A G  D    V+ P   +E+C + ++        +IP+  G + +D+K+  + I  SPF V V   +       + AFGPGL GG    P+ F V T    +GAL  +I GPS+ K+DC +  +G   ++Y P  PG Y +        HI+                           E + KS  MA     +       D  KV  +G GL       K + F V+   AG+   +      +  C DVT       ++   +  Y+  YT K  G + VIV +G+  IP SPF V+
Sbjct: 2230 VTSPGGNLADAEIVDSGNS--TYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAE--FSIWTREAGAGGLSIAVEGPSKAEINFEDRKD-----------GSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVA--TLSDDARRLTVT--SLQEKDLKVNQEASFAVQRNGARGVID--AKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGY-KISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNS-FSVDCSKAGTNMLMVGVHGPRTPCEDVT-------VKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHVS 2700          

HSP 7 Score: 117.857 bits (294), Expect = 1.493e-25
Identity = 124/426 (29.11%), Postives = 174/426 (40.85%), Query Frame = 2
Query:  941 RVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHL--SPFNVDVAPYK---------------------------------------ESKIKAFGPGLTGGIVSKPAFFEVE-TNGETGALGFSIKGPSEAKIDCVD-----NGDGSANVTYWPTVPGEYAVHILCDDENIPKSPY 2077
            +VRA G GLE     +  PA F++ T  AG G L I V  P       EI     K+ +   SY+    G+Y + IKF N  IP+SPF V V   + D  ++T +   ++    +V +   F V       G +D  +    G  +     +T+   +K  I +  +E G+HS++V F G  I  SPF V V    S  D     A G G+  EG R    +EF V+T  AG   L V + GP +    C   +     Y+ SY P  PG Y++ IKYG  P H+  SPF   V   +                                        SK+   G GL+   V +   F V+ +   T  L   + GP   +  C D      G+   NVTY     G Y V +   DE IP SP+
Sbjct: 2292 KVRAGGTGLERAVAKV--PAEFSIWTREAGAGGLSIAVEGP----SKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDDARRLTVT--SLQEKDLKVNQEASFAV-QRNGARGVIDAKVHAPSGVVEEC--YVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGL--EGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEG---YKISYTPMAPGNYLICIKYG-GPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGP---RTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPF 2697          

HSP 8 Score: 90.8929 bits (224), Expect = 2.701e-17
Identity = 92/304 (30.26%), Postives = 129/304 (42.43%), Query Frame = 2
Query:  998 APFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA--AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLI-------------EYTTKEEG--------LHSVNVFFAGVQIQSSPFGVMVSSKTSN---SDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNV 1810
            A F V   N  +G +D  V  P G  E C + +  + + A    +IP   G + I +KF  S IP SPFKV V  A   GDP  V+A GPG+E  G   G  + F V T +AG G++   I       +D    ++  K   T  +   +LI              +  K  G        LH  +        +SS      SS TS+   SDA +    G G+    V  ++   F V    AG   L V V+GP    E   +K +   LY  +Y  +  G YVV +K+G+  I  SPF+V
Sbjct: 2403 ASFAVQR-NGARGVIDAKVHAPSGVVEECYVTELDSDKNA--IRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLE--GGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKN--SFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHV 2699          
BLAST of Filamin vs. Ensembl Zebrafish
Match: flnca (filamin C, gamma a (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-070503-1])

HSP 1 Score: 1059.67 bits (2739), Expect = 0.000e+0
Identity = 767/2160 (35.51%), Postives = 1098/2160 (50.83%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKT-NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVS---------------SKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES---KIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNTTPIGQL-NEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV----------IATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIY---------PVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQ-PQKFTVDLEGAG--QGG--LGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTP-GLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIV---PVHSEAKPEQCYIEGPILNEVPVGKT--VTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTH--HYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFK-FYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCI--DNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSP--FTAKIFGEPKKRSQ---ICVGTTSDVPLRISETDIN----NLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSS-SLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTV 6370
            E++LAEDA WK IQ+NTFTRW N+HLK  N  + DLQ DL DGLKLI+L++ LS    +R  H RPNFR  KLENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W+ ED    D + K  +PKQRLLGWI +K+P  P+ NF  DW DG A+GALVD CAPGLCP+W  WDP Q ++NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   AP+ PK     + +AYGPG+E +GN +  PA FTV+T  AG G + + V +P+G  E  ++  + +K+  +S +Y+P +EG +++ + FA  +I  SPF VNV  A GDP+KV A GPG+EP GN   + T+F+++TA AG G V  VI+D + + ++V+  +  + +N F   Y    EG H+++V FAG  I SSPF V +S                K   S+A    ATGRG+QP+GVRV++VA+F V T+ AG  +L V+V GPG      ++  V   +++C Y P +PG Y V+I +G  PI  SPF V+V+  KE+   K++A+GPGL  G+V K A F VE  G E G LGFSI+GPS+AKI+C D GDGS +V YWPT PG+YAVH++CDDE+I  SP+MA I        P KV A+GPGL  +G++ NK   F V+ + AG    +K    D  G  I +QI D  DGT+ C Y P  P KHT+I+++G VNIP+SPF+V V E  +   +KVYGPG+E+   K N  TYF VDC  AG GD+ I +          E   D  ++ +DN   T             YTI + F++ EIP SPFKV ++  +D  K +     +N T    ++   F I T   G K +PE+  K+          +  +N    +   +T    G   + V   G+PI  SP+K+          +    +N K     +   +++   A      N  SI   S +  P +  + KT          + P EE  Y         PV  +    E   P     V AYG GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV YLP E G Y +N+LY + HI  SPF   + P         D  KVTA GPGL          + FTV+          +   I+++   Q   C + NN DGT+S +Y+P   G H I I Y G  V KSP  V V    D S I+ YGPG+E +G+ ++    F VD       +GG  + + I  P+ A    +  D  DGT  V+Y   + G + + + ++E  +P SPF V + +  D ++V+ YGPGLE  G  V  P+ FTV+   AG A L + +     +    A++L K    G   V Y+P   G+ +I + Y    +PGSPF   V +  +  KV  +G G+     + +   VP  FT++   AG + LE+ + GP      + V N+ DGT T  Y     G +TV V Y N+ VP SP+ V   P H  +K       GP L+   V  +  V   ++ ++AG G+L+ + + P G     SI + R G  TVSYVP   G Y + + +  +NIP       AF   +      T     +  E   P I+     V            V   V  P+  +    +  N DGT  + Y   E G + + + + GQ I  SPF+    D  +     T         +P       ++      G LS  V  PS    +    DNK+GT  V + P   G + + IK+   HI GSP  F   +       +    +C GT +  P   +    N     L+  V  P+  E SC  K  ++G   +S+ P   G++ + V     HIP SPF   +  ++        L    LN G   +    + +T +  Y  L+ SI+ PS  E  C      + H G   +++ P E G + ++V+ +  +V  SPF + +G  PS      R+         +    V E  +            S+  PS     C+ +   D    + + P E G + +++K  ++H+ GSPF   V
Sbjct:   32 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKGVTDLQKDLGDGLKLISLLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLDR-ERIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDED----DEEVKKLTPKQRLLGWIQNKVPELPINNFNKDWRDGKALGALVDNCAPGLCPDWQTWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPKQLYPKKAKAYGPGIEPQGNMVLKPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHLKPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVS--KEAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGK-GGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTV---KYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAG-KAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNV-SITSPSGRPIPCKLESDKT---KEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPAL-------DAGKVTASGPGLERAKA--GEVASFTVDCS--RAGEAELTIEIVSDSGAQAEVC-IQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLE--GGIVNKPNCFTVETRGAGTAGLGLTI-----EGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGL----ANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASK---VRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDT---------KPMFQPLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNK-PASFTVVTKNAGQGGLSLAVEGPSKAEISC--KDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDD-------SLRRSQLNVGTAADVSLKITET-DLSY--LTASIKAPSGKEEPCLLKRLPNRHIG---LSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVG--PSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDV--EDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKV 2120          

HSP 2 Score: 1000.35 bits (2585), Expect = 0.000e+0
Identity = 762/2317 (32.89%), Postives = 1125/2317 (48.55%), Query Frame = 2
Query:  941 RVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNV-----------------KNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE----SKIKAFGPGL--TGGIVSKPAFFEVETNGETGALGFSIKGPSEA----KIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPS-TVKAECF-DVTGQT---IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE--TYFVVDCKLAGSGD----IGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQ--ETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV---IATDRVNTKEYPETETPLLIS--ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN-FEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKP-IDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--------VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPK-KRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPG------YNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSK--AEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIH----HGHTGRINE--FFVDTSNAGNGALTVTIDGPSKVQLNC--QENESGYN-FTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            +V+A GPGLE EGN    P  F + T  AG G++ +++++P+ +    E+      +  + C+Y P +EG + I + FA   IP+SPFKVN+                 K  A + +   A+G G++P G  V     F VFT  AG G +   +    G +  VK  +    +  F  +Y   + G ++VN+ + G  I  SPF V VS +   +  ++  A G G++     V   A+F V         LG ++ GP ++  +C  K    C  +  Y P  PG Y V +   +  I  SPF   + P        K+KAFGPGL  TG  V+K   F V+   E G  G  I           I   D GDG+    Y PT P ++ + I   + NIPKSP+     L  +   P KV  YGPG+  +G+  N+P  F V+   AG    ++  +C   V G     I   I  N++ T++ +YTP  PG++T++V + +  IP SPFKV V  + +A  ++  GPGI +    +E  T+F +  K AG          +     ++D  ++  DN D ++T+KYT    G    + +      IP+SPFK+ +    D  K K+  LN    +G+  EF + T   G + +  + + SP+G  +P KL+  +T       + P   G + V +   GNP+  SP+ V   +  D    + Y       ++   A ++ID K             L     + ++   N +   S  + P E   Y +              +   K  L    VTA G GL +  A   ASF +D +    A L + I  +   +A++   +N DGT SV Y P   G + + + Y  + +  SP +V + P         D + +  YGPG+ P GV ++  + F V+A+      G   VK  I NP    +   + +  DGTY   Y+   DG H I++ YD V V KSP+ V V +G DP+R+RAYGPGLE GI  +P  FTV+  GAG  GLGL+IEG ++A++ C DNKDG+CSV+Y+P   G YD++I +  + IPGSPF V + D+VDVSKVKC GPGL  N      P  FTVD SKAG APL+V +     K      ++  +  G   V Y P   G   + V Y N +VP SP+  N   S +  KV  +G G+       +A  +P  FTI+ RDAG+  L + +  P  +     + ++ DGT+T  Y  D+ G YT+ + YG  N+P SP+ V         +C +   I           + + +   I V+ + AG G ++     P G  +   +     G   + Y   + G Y + + F  ++IP    +  A    +Q    R       + +KP+ +    V+ F    G +   VR     PS +   P + +N DGT+TVQ+QP+E GLHE+++ Y+G  I GSP +FYVD T  SG VTAYGPGL +G  +  A FT+VTK+AG GGLSLAVEGPSKAEI C DNK+GTC VSYLP  PGDY+I +KF + HI GSPFTAKI G+   +RSQ+ VGT +DV L+I+ETD++ L A + +P+G+EE C LKRL N ++G+SFTPKEVGEH V+V +SG+H+ NSPFKI VG +EIG ASRVK +G GL +    E  +F VDTRNAGYGGL LSIEGPSKV+I C D  DGTC VTY PTEPG YIIN+K+AD ++PGSPF V + G     + + I R + AA ++ +G+ C+LNL IPG        Q   T +    S ++   E   +S           +  VH V   +      G PF+      +  G  ++   G+  + G             E G   ++  +  P    A+ +  D+ + +  V +   E G +  ++K+  EHVPGSPF   +       + K              +       +       A F I       G +S  V  PS  E   +     +    V +V  E G + V +  NN  IP SPF V V  ++     +          ++N+   F    N   G +   +  PS V   C   E +S  N   ++P   G ++I +K+ G +HI GSPF V +            E +S+                 P  V   G GL+    G  +EF+V+   AG   L V + GP +   + N    G   ++++Y     G +L+ +++G    + GSPF+  V
Sbjct:  384 KVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHLKPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVK--VCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKE---AGTQKVRAWGPGLKTG--MVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSC--DVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAR-EAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRV---LVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEII--DNHDYSYTVKYTALHQGEMAIV-VTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGG---LGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSV-------DTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLA-NKVTAHVPQTFTVDCSKAGVAPLEVQLY--GPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTG---VAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMA---TDQPVAPR-------DDTKPMFQPLNLVIPFTVQQGELSGEVRM----PSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVT-NSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTG--EGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGG----ETKREVH-VEESTQVGGGGGDPFRDVFESFL--GRDRLGSFGTIRQEG-------------ETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHK--------------VRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAE--INFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDDARRLTVTSLQEKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNG-SHIPGSPFKVRVG-----------EAESV---------------GDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEG---YKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKV 2585          

HSP 3 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 478/1529 (31.26%), Postives = 741/1529 (48.46%), Query Frame = 2
Query: 3215 VTAYGEGLV-KGVANTPAS-FIIDSTEEPPAPLG----VTIEGPMEAKID-YI-DNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQ-PQKFTVDLEGAGQGGLGLSIEGPADAQ--IQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVT----GEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIR------TEYSVVDFKFPVGPVFDYV----RAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPF--KFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNK--NGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI----FGEPKKRSQICVGTTSDVPLRISETDINNLNA-------IVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFV-GENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXX---------XIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-----LTQTVHMISGSTQKGPSKPYN----VKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            +  YG G+  KGV     + FI+D+        G    + I  P  A  D YI D GDGT  V Y   E G +++ V Y++  +  SPF V++           D  +V AYGPGL   G   +  + FTV  +     G G+    I      +  C   +N DG+ S  Y P   G + I+I Y G P+  SP+ V V    D S+++  GPGL   +T   PQ FTVD   AG   L + + GP      +   +N+DGT +V Y P + G + VS+K+  + +P SP+ V      D SKV+  GPGL+  G     P +FT+DA  AG+  L V ++D   K  K +  +  +  G + V+Y+P+  G   I + Y    +P SP+      + +  K ++T    G GV    G  I     ++ T++ + AG+  +   V  PN   +++DV  + DGTF   Y    PG Y + + +G +++P SPF V    +    +   + P+   +     + IP   Q    G LS +   P G      I + + G  TV + P + G +E+ + ++  +IP   +         Q+ ++ T     T     +          ++VV      G +   V    +A ++C  N+          DGT TV Y P+  G + + V ++   I GSPF  K   D ++   Q+               A  ++   +     L+ +++ PS  E  C+  +  N    +S+ P   G++ + ++   KH+  SPF   +     GE  +      G        ++E  ++  NA        +  P+  + +C    +++G   +++ P E G +++N+  + +HIP SPF + V GE  +  +   K     +    V  TC   +      +  LS   E  ++        +  T       T  G     V   +S   G       GG P   + E  L          I    E  +       +  TA V SP G+    EI+   ++ + +RF+P E+G HTV+VK    HV GSPFQFTVGPL +GG HKV   G+G+ER +A    +F+I+TREAGAG LSIA+EGPSKAEI+F+D KDGSCGV+Y V EPGDY  SIKFN+EH+P SPF++     P ++ S          +D+R +++ +LQ++   +  +A+F +  +G   G I A V +PS   +   ++++D+++ ++ F+P ENG+H++ V  N S IPGSPF+V VGE    G+         G+  G TG  +EF V+T  AG+GAL+VTIDGPSKV+++C E + GY  +Y P APG+Y I IKYGG  HI+GSPF   + G       S+ ET S     +T++  M    +    S P +    V C G GL  A +G++N F VD   AG ++L VGV GP  PCE+V +KH+GN  + V Y V+EKG ++++V+WG+  +PGSPF +  P
Sbjct: 1278 IKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGC-------DPTRVRAYGPGLE--GGIVNKPNCFTVETRGAGTAGLGLT---IEGASEAKMLC--KDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKAS--IHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVE-SLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDTK-PMFQPL----NLVIPFTVQQ---GELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPL---------QFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNK----------DGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNV----------GTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINC--DDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQSITRKRQAASI--ASVGSTCDLNLKIPGNWFQMLSAQ-ERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGG-----GGDPFRDVFESFLGRDRLGSFGTIRQEGETGI-------QGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIV-----PVATLS----------DDARRLTVTSLQEKDLKVNQEASFAVQRNG-ARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHVSAP 2719          

HSP 4 Score: 427.943 bits (1099), Expect = 6.946e-120
Identity = 417/1564 (26.66%), Postives = 664/1564 (42.46%), Query Frame = 2
Query: 3164 IYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPM----EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFN------GKGIVKAIITNPFNQRSTCTV--DNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQ------------------GSDPSRIRAYGPGLE-EGI-TKQPQKFTVDLEGAGQGGLGLSIEGPADAQ--IQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVL---NSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSA------KNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYG--PGLSYGRPDMHAHFTIVTKDAGA-GGLSLAVEGPSKAEIQCI----DNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAK--IFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQ-----NGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSI--EGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTAS------VISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIG-SKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG----HTGRIN----EFFVDTSNAGNGALTVTIDGPSK--VQLNCQENESG-YNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIV 7618
            + P Q   +KA+   P +   G  ++K     PA F +++ E     + V +E P     EAK+   ++   T SV Y+PK  G + V VL+  + I  SPF V +      +  + D  KV A GPGL P G          V  KP  F+      G G V  +I +P N+ +T  V  +N  D  + C+Y P ++G H I +T+ G P+  SP+ V + +                   S+ +  RA G GL+ +G+  K+   FTV  +GAG G L +S++GP   +  ++  D  DG     Y P KPG Y V+I +  + IP SPF V +       KV+ +GPGL+     V   + F V+A       L  ++   +   ++          G  DV Y P   G+  + V+ ++  +  SPF+ ++L   N   PEKV   G G+ P    +  NK  + FT++ R+AG+  L++         +++ + + GDGTF C Y    P  +T+ + +G  N+P SPF V V     P++  + GP + +  +   +     V+   AG G +S         VGP    +   I        TV Y P   G Y + ++F D+ IP+   +       +   +            +  I T +++  F    G     V        N      +I+N D + TV+Y     G   + V + G PI  SPFK  V  ++  G+V   G    +  G+      F + TK AG  G +++++  PS   I C       K  TC V Y+P   G Y + I +    +  SPF+ +  +  +P K      G    +  + ++  I+   A         E     +++     +G   + + P E G++ +N+L    HIP SPFK  V      +A +V   G GL      E   F VD   AG   L++ I  +  ++ E+   +N DGT  VTY P   G + I +KY    VP SP  V +     S  T  I  +    E   +      + I+       T         +I+PSG+     I    D  + + +   E G+H + V  D   V  SPF+ +V    D  P +V   G G+E G+ N  N FT+ TR AG   L + IEG S+A++  +DNKDGSC V Y     GDY  +I +  + +PGSPF +Q              ++           + A   Q F +  SKA             +   +  P    +   +    +  ++V++ P + G H V V   N  +P SP++V       + +    G     TG       EF +D  +AG G LTV I  P     + +  +N  G Y  +YVP+  G YTI+IKYGG+N I  SP+       N Q+  +   +K L        G    GP+               ++ +     VDA  AG   +   V  P     ++++    +  F + Y   E G++++ +R+G   +P SPF+++
Sbjct:  275 VKPKQLYPKKAKAYGPGIEPQGNMVLK-----PAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNV------AKALGDPNKVQARGPGLEPEG---------NVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHLKPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTG--MVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIE----CDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPT--GVTVNK-STQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTI--FTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGK---DQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATC-VKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVV--KPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKV---EPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCD--PTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQ-------VKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVA---------PLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDN-IPYSPY-------NVQAFPTGDASKCLLTVSIGGHGVESLGPN--------------IQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVM 1758          

HSP 5 Score: 229.565 bits (584), Expect = 2.373e-59
Identity = 189/599 (31.55%), Postives = 279/599 (46.58%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSK----VTASGPGIEPVGN--EVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKK 2701
            ++ +VRA GPGL+  G     P  FT+D  +AGKG L + +L+P+G+ +   I D  N++  Y+ SY+P M G Y I IK+    IP SP+ V      GD SK    V+  G G+E +G   ++   T   V    AG G V C +    G +  +   +T+  +  F I YT  E G + + + F G  I  SPF VM +         Q  A     +P    +  V  F V        +L   V  P     +  I+          + P   G + +DIKY  N I  SP    V       + A+GPGL  G V+KPA F V T N   G L  +++GPS+A+I C DN DG+  V+Y PT PG+Y + +  D+ +IP SP+ A+I  D    D L+ +    G  + +S       I  T  +   +++KA     +G+  P  ++   +      +TPK  G+H V V     ++  SPFK+ V   E G A+ +K +G G+  A T     F VD + AG G +G+S+  E    V +  DD  DGT        T    Y I I F++  IP SPF V +  +   K+
Sbjct: 1564 DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHD--NRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQA-FPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGME--LDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATD--------QPVAPRDDTKPMFQPLNLVIPFTVQQ-----GELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGD----DSLRRSQLNVGTAADVSLK-----ITETDLSYLTASIKAP----SGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSI--EGPSKVDINCDDVEDGTC-KVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGEGRMKQ 2128          

HSP 6 Score: 132.88 bits (333), Expect = 4.708e-30
Identity = 138/501 (27.54%), Postives = 212/501 (42.32%), Query Frame = 2
Query: 1052 VLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKN-AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDA-GFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE----SKIKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAV--------HILCDD------------------------ENIPKSPYMA----QIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTV------KAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVN 2386
            V +P G     EI DS N    Y   ++PT  G + + +K+    +P SPF+  V     G   KV A G G+E    +V     F+++T EAG G +   +       ++ + RKD               + Y  +E G + V++ F    I  SPF V V+  T + DA++   T   +Q + ++V   A F V    A G  D    V+ P   +E+C + ++        +IP+  G + +D+K+  + I  SPF V V   +       + AFGPGL GG    P+ F V T    +GAL  +I GPS+ K+DC +  +G   ++Y P  PG Y +        HI+                           E + KS  MA     +       D  KV  +G GL       K + F V+   AG+   +      +  C DVT       ++   +  Y+  YT K  G + VIV +G+  IP SPF V+
Sbjct: 2247 VTSPGGNLADAEIVDSGNS--TYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAVAKVPAE--FSIWTREAGAGGLSIAVEGPSKAEINFEDRKD-----------GSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVA--TLSDDARRLTVT--SLQEKDLKVNQEASFAVQRNGARGVID--AKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGY-KISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNS-FSVDCSKAGTNMLMVGVHGPRTPCEDVT-------VKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHVS 2717          

HSP 7 Score: 118.242 bits (295), Expect = 1.297e-25
Identity = 124/426 (29.11%), Postives = 174/426 (40.85%), Query Frame = 2
Query:  941 RVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHL--SPFNVDVAPYK---------------------------------------ESKIKAFGPGLTGGIVSKPAFFEVE-TNGETGALGFSIKGPSEAKIDCVD-----NGDGSANVTYWPTVPGEYAVHILCDDENIPKSPY 2077
            +VRA G GLE     +  PA F++ T  AG G L I V  P       EI     K+ +   SY+    G+Y + IKF N  IP+SPF V V   + D  ++T +   ++    +V +   F V       G +D  +    G  +     +T+   +K  I +  +E G+HS++V F G  I  SPF V V    S  D     A G G+  EG R    +EF V+T  AG   L V + GP +    C   +     Y+ SY P  PG Y++ IKYG  P H+  SPF   V   +                                        SK+   G GL+   V +   F V+ +   T  L   + GP   +  C D      G+   NVTY     G Y V +   DE IP SP+
Sbjct: 2309 KVRAGGTGLERAVAKV--PAEFSIWTREAGAGGLSIAVEGP----SKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDDARRLTVT--SLQEKDLKVNQEASFAV-QRNGARGVIDAKVHAPSGVVEEC--YVTELDSDKNAIRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGL--EGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEG---YKISYTPMAPGNYLICIKYG-GPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGP---RTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPF 2714          

HSP 8 Score: 90.8929 bits (224), Expect = 2.704e-17
Identity = 92/304 (30.26%), Postives = 129/304 (42.43%), Query Frame = 2
Query:  998 APFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA--AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLI-------------EYTTKEEG--------LHSVNVFFAGVQIQSSPFGVMVSSKTSN---SDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNV 1810
            A F V   N  +G +D  V  P G  E C + +  + + A    +IP   G + I +KF  S IP SPFKV V  A   GDP  V+A GPG+E  G   G  + F V T +AG G++   I       +D    ++  K   T  +   +LI              +  K  G        LH  +        +SS      SS TS+   SDA +    G G+    V  ++   F V    AG   L V V+GP    E   +K +   LY  +Y  +  G YVV +K+G+  I  SPF+V
Sbjct: 2420 ASFAVQR-NGARGVIDAKVHAPSGVVEECYVTELDSDKNA--IRFIPRENGVHSIDVKFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLE--GGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKN--SFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHV 2716          

HSP 9 Score: 60.8474 bits (146), Expect = 2.759e-8
Identity = 76/310 (24.52%), Postives = 124/310 (40.00%), Query Frame = 2
Query: 6740 ALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQ--YSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTGRINE---------FFVDTSNAGNGALTVTIDGPSKVQLNCQ---ENESG--YNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
             ++ QG  +   A F +       G +  YV  P    + A +   ++ +  +SV +VP   G H V VL     I  SPF V V +       +     G   E         F + T+ AG G ++V I  P       +   EN+    +  TY P   G +TI + + G   I  SPF V IS  + +   + ++     +     +     G         +  G++V E+    +F V    AG   L V V GP      V +  +G+  F+ +Y   + G++ + + WG   +P SPFE+ V
Sbjct:  291 GIEPQGNMVLKPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQP-IPSSPFKVNISEAHLKPPGAPKQIPPQKKKASNANACRATGRG------LQPKGVRVKEVA---DFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEV 590          
BLAST of Filamin vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 1734.92 bits (4492), Expect = 0.000e+0
Identity = 1053/2625 (40.11%), Postives = 1497/2625 (57.03%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVA-PYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINN---LNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYK--VIATDRVNTKEYPETETPLLISAD--YAID-NKAYNKPSIPVQSAKLTPVERSNVKTFSNP----NKQRSNFEPNEEIIY---------PVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNID---DVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEE-GITKQP-QKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVN----TQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIR-------------------QYAFQPQEQ--YSIERTTH-------------------------------HYTTEQSKP-IIRTEYSVVD-----FKFPVGPVFDYVRAVV-------------NCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXX---------XXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGSTQ-----KGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            + E++LA+DA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    +R  H+RP F   +LENV++ L FLE  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+WE    ++ D + K  +PKQRLLGWI +K+P  P+ NF+ +W DG A+GALVD+CAPGLCP+W  WDPK+ ++NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +   APFTV+T +AG G + + + +P+G +E  ++  + +K   +S  Y+P + G +++ + FA   I  SPF+VNV+ A GD SKVTA GPG+EP+GN   + T+F+++TA AG G +   ++D +GR ++V+  +  +    +   Y   + G H+V + F G     SP+ V +  +  N +A    A GRG+QP+GVR+R+ A+F+V T+ AG  DL V+V GP    E  +  +    L+   Y P  PG YVV I +G + I  SPF V VA      K++A+GPGL  G+  K A F VE+ G E G+LGF+I+GPS+AKI+C D GDGS +V YWP  PGEYA+HI+CDDE+I  SPYMA IQ  +   DP KV AYGPGL  +G   + PA+F V+  +AG  + +K    DV G  + +  ++  DGTY+C YTP  P KHTV V++G V++P SPF+VN+ +  +   +KV+GPG+E+   K N  T+F VDC  AG GD+ +       V+ ++  D+      N + TF            YTI++ F+  EIP+SPF++ ++  +D  K +        +    G+ + F + T   G K   ++    P         +  +N        +TP   G   V V   G+PI  SP+   V A   +N       E+ + +  D  + +D N A  +  + V   K++   R +V     P          + P EE +Y         PV  +    E   P     V AYG GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP  PG Y VN+L+ + HI  SPF           +N++   D +KV A GPGL    V +        +       G G +     +    ++   V +N DGTY+ +Y P   G + + + Y G  V K P  V V    D S+I+ +GPG+EE G+ ++    FTVD   L   G   +   I  P+ A       DN DGT  V+Y P + G++ + + ++++ +P SPF V + +     +VK  G GL    +    P+ F+V    AG   L + V   +   +        +  G   V Y P   G+ ++ + Y+   +PGSPF   V +  +P KV ++G G+    G  +  K+P  FT++T  AG + L + VTGP      +D+ ++GDGT T  Y   + G YTV V Y ++ +P SPF V V       +    GP L     G + ++PVN     +NAG G LS +     G      I++   G  +VSY+P + G Y V + +  ++IP    R                   Q A +  E+  + ++ TT                                +YTT ++ P +I   +   D     F     P F     V+             + PS +     +++N DGT++++Y P+E+GLHEL +  NG  I  SP +F+V+    +G V+AYGPGL YG  +  A FTI+T+DAG GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY+I +K+ D HI GSPF AKI  + ++RSQ+ +G+T+D  L I+ETD++ L+A + +P+GR+E C LKRL N ++GISF P+EVGEHLV++ ++GRHIPNSP  I V ++EIG+AS+VK +G GL +G   E   F+VDTR AGYGGLSL++EGPSKV+I+  D  DGTC V+Y PTEPG YI+++K+AD +VPGSPF   + G     + E I R + A  V+ +G +CELNL IP  ++   TA V+SPSG  +  EI+ L  N   +RF+P+E G+HTVSVK    HV GSPFQFTVGPL +GG  KV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGS GV+Y V EPGDY   IKFNDEH+P SPF++ I                   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +++++ ++Y+V F+P ENGIH + V  N S +PGSPF+V VGE          T  G+G+  G TG+ +EF ++TS AG GAL+VTI+GPSKV + C+E   GY   Y P APG Y I +KYGG NHI+GSPF   ++G          ET S + Q+V   S  T      +  S    V  +G GL  A +G+++ F VD   AG ++L VGV GP  PCEEV+IKHLGN  + V+Y+V+E+G ++L+V+WG   +PGSPF I VP
Sbjct:    3 VTEKDLAQDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFSQMQLENVSVALEFLER-ENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPVWE----DEGDEETKNQTPKQRLLGWIQNKIPQLPITNFSQNWQDGKALGALVDSCAPGLCPDWESWDPKKPVENAREAMQQADDWLGVPQVIAPEEIIDPNVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGLGVEPTGNMVKRSAPFTVETISAGTGEVLVYIEDPEGNREEAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAKGPGLEPIGNIANKPTYFDIYTAGAGVGDIGIEVIDPQGRNNTVELALEDKGNCVYRCTYKPIKAGPHNVAINFGGEATPKSPYLVSI-GEACNPNA--CRANGRGLQPKGVRIRETADFRVDTKAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKSPFEVQVALEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECEDQGDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAGK-AALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGSHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTF-TVKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAG-KAPVDVSFTGPAPGDAVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRINGLESRVEVGKDQQFIVDPNGAGGQGKLEV---KISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVSYDGNPVPGSPYVVEATLPPDPSKVKAYGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQ----------ANVEMPFDPSKVIATGPGLEHGKVGEAGLIHVDCSQA-----GPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFKVGVTEGCYPDRVKAQGAGLTE--ALTNKPNLFSVITRGAGIGGLGITVEGPSESKMS----CKDNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGL----GTAVRAKIPQQFTVDTSKAGIAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTYDASKVTASGPGL--CAQGISASLPVNFAVDAKNAGLGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRAMSIGDASKCTVAGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSILGPDGLENEADVIENVDGTYDIYYTTAKTGPYVIHVRFGGADIPNSPFTVMGAPCFRPFDLVIPFAIRTGEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELAIKCNGAHIPESPLQFFVNYP-NTGSVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPFIAKITDDSRRRSQVKLGSTADFLLDITETDLSLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAVEGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKFADEHVPGSPFTAKVMG--EGRVKESITRRRKAPSVASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVPQETGIHTVSVKYRGEHVPGSPFQFTVGPLGEGGAEKVKAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSSGVSYVVQEPGDYDVIIKFNDEHIPQSPFLVPIVATS---------------DDARRLTVTSLQESGLKVNQPASFAIRLNG-ARGKIDAKVHSPSGAVEECFVTELEPDKYAVRFMPRENGIHMIDVKFNGSHVPGSPFKVRVGEAGQEGDPGLVTAYGDGLETGTTGKQSEFIINTSKAGPGALSVTIEGPSKVTMECKECPEGYRVLYTPMAPGIYMIGVKYGGPNHIVGSPFKAKVTGQRLVGIGGTSETSSIIVQSVTRASTETTYSALPRFASDATKVTSKGAGLSKAFLGQKSTFTVDCSKAGSNILLVGVHGPTLPCEEVSIKHLGNKHYTVHYHVKERGDYMLVVKWGEEHIPGSPFHITVP 2567          
BLAST of Filamin vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 1556.96 bits (4030), Expect = 0.000e+0
Identity = 1001/2626 (38.12%), Postives = 1429/2626 (54.42%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVA-PYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINN---LNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYK--VIATDRVNTKEYPETETPLLISAD--YAID-NKAYNKPSIPVQSAKLTPVERSNVKTFSNP----NKQRSNFEPNEEIIY---------PVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNID---DVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEE-GITKQP-QKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVN----TQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE--YSVVDFKFPVGPVFDYVRA---VVNC----PSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIP--------SGQVTAYGP--------------GLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT----------------AKIFGEPKKRSQICVGTTS----------DVPLRISETDINNLNA---IVISPTGREESCTLKRLQNGYL----------GISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXX---------XXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGSTQ-----KGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            + E++LA+DA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    +R  H+RP F   +LENV++ L FLE  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+WE    ++ D + K  +PKQRLLGWI +K+P  P+ NF+ +W DG A+GALVD+CAPGLCP+W  WDPK+ ++NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +   APFTV+T +AG G + + + +P+G +E  ++  + +K   +S  Y+P + G +++ + FA   I  SPF+VNV+ A GD SKVTA GPG+EP+GN   + T+F+++TA AG G +   ++D +GR ++V+  +  +    +   Y   + G H+V + F G     SP+ V +  +  N +A    A GRG+QP+GVR+R+ A+F+V T+ AG  DL V+V GP    E  +  +    L+   Y P  PG YVV I +G + I  SPF V VA      K++A+GPGL  G+  K A F VE+ G E G+LGF+I+GPS+AKI+C D GDGS +V YWP  PGEYA+HI+CDDE+I  SPYMA IQ  +   DP KV AYGPGL  +G   + PA+F V+  +AG  + +K    DV G  + +  ++  DGTY+C YTP  P KHTV V++G V++P SPF+VN+ +  +   +KV+GPG+E+   K N  T+F VDC  AG GD+ +       V+ ++  D+      N + TF            YTI++ F+  EIP+SPF++ ++  +D  K +        +    G+ + F + T   G K   ++    P         +  +N        +TP   G   V V   G+PI  SP+   V A   +N       E+ + +  D  + +D N A  +  + V   K++   R +V     P          + P EE +Y         PV  +    E   P     V AYG GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP  PG Y VN+L+ + HI  SPF           +N++   D +KV A GPGL    V +        +       G G +     +    ++   V +N DGTY+ +Y P   G + + + Y G  V K P  V V    D S+I+ +GPG+EE G+ ++    FTVD   L   G   +   I  P+ A       DN DGT  V+Y P + G++ + + ++++ +P SPF V + +     +VK  G GL    +    P+ F+V    AG   L + V   +   +        +  G   V Y P   G+ ++ + Y+   +PGSPF   V +  +P KV ++G G+    G  +  K+P  FT++T  AG + L + VTGP      +D+ ++GDGT T  Y   + G YTV V Y ++ +P SPF V V       +    GP L     G + ++PVN     +NAG G LS +     G      I++   G  +VSY+P + G Y V + +  ++IP              YS  R       + SK  +      + V     VG V D   A    V C    P   ++   +I N DGT  + Y  +++G + + V + G  I  SPF       +P        S     Y P              GLS+   D+   F I T     G ++  V  PS   A    +DNK+GT  + Y+P   G + + IK    HI  SP                    I+G   K +   + T            + P +   + I+N +    +   PT   +   L +  + ++          GISF P+EVGEHLV++ ++GRHIPNSP  I V ++EIG+AS+VK +G GL +G   E   F+VDTR AGYGGLSL++EGPSKV+I+  D  DGTC V+Y PTEPG YI+++K+AD +VPGSPF   + G     + E I R + A  V+ +G +CELNL IP  ++   TA V+SPSG  +  EI+ L  N   +RF+P+E G+HTVSVK    HV GSPFQFTVGPL +GG  KV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGS GV+Y V EPGDY   IKFNDEH+P SPF++ I                   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +++++ ++Y+V F+P ENGIH + V  N S +PGSPF+V VGE          T  G+G+  G TG+ +EF ++TS AG GAL+VTI+GPSKV + C+E   GY   Y P APG Y I +KYGG NHI+GSPF   ++G          ET S + Q+V   S  T      +  S    V  +G GL  A +G+++ F VD   AG ++L VGV GP  PCEEV+IKHLGN  + V+Y+V+E+G ++L+V+WG   +PGSPF I VP
Sbjct:    3 VTEKDLAQDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFSQMQLENVSVALEFLER-ENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPVWE----DEGDEETKNQTPKQRLLGWIQNKIPQLPITNFSQNWQDGKALGALVDSCAPGLCPDWESWDPKKPVENAREAMQQADDWLGVPQVIAPEEIIDPNVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGLGVEPTGNMVKRSAPFTVETISAGTGEVLVYIEDPEGNREEAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAKGPGLEPIGNIANKPTYFDIYTAGAGVGDIGIEVIDPQGRNNTVELALEDKGNCVYRCTYKPIKAGPHNVAINFGGEATPKSPYLVSI-GEACNPNA--CRANGRGLQPKGVRIRETADFRVDTKAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKSPFEVQVALEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECEDQGDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAGK-AALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGSHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTF-TVKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAG-KAPVDVSFTGPAPGDAVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRINGLESRVEVGKDQQFIVDPNGAGGQGKLEV---KISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVSYDGNPVPGSPYVVEATLPPDPSKVKAYGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQ----------ANVEMPFDPSKVIATGPGLEHGKVGEAGLIHVDCSQA-----GPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFKVGVTEGCYPDRVKAQGAGLTE--ALTNKPNLFSVITRGAGIGGLGITVEGPSESKMS----CKDNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGL----GTAVRAKIPQQFTVDTSKAGIAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTYDASKVTASGPGL--CAQGISASLPVNFAVDAKNAGLGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIP--------------YSPYRIRAMSIGDASKCTVAGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSILGPDGLENEADVIENVDGTYDIYYTTAKTGPYVIHVRFGGADIPNSPFTVMATDEVPVQVQQQSLSACPPGYQPLVSETDYAQVGSMNGLSFRPFDLVIPFAIRT-----GEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELAIKCNGAHIPESPLQFFVNYPNTGSVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPFIAKITGISFIPREVGEHLVSIKKNGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAVEGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKFADEHVPGSPFTAKVMG--EGRVKESITRRRKAPSVASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVPQETGIHTVSVKYRGEHVPGSPFQFTVGPLGEGGAEKVKAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSSGVSYVVQEPGDYDVIIKFNDEHIPQSPFLVPIVATS---------------DDARRLTVTSLQESGLKVNQPASFAIRLNG-ARGKIDAKVHSPSGAVEECFVTELEPDKYAVRFMPRENGIHMIDVKFNGSHVPGSPFKVRVGEAGQEGDPGLVTAYGDGLETGTTGKQSEFIINTSKAGPGALSVTIEGPSKVTMECKECPEGYRVLYTPMAPGIYMIGVKYGGPNHIVGSPFKAKVTGQRLVGIGGTSETSSIIVQSVTRASTETTYSALPRFASDATKVTSKGAGLSKAFLGQKSTFTVDCSKAGSNILLVGVHGPTLPCEEVSIKHLGNKHYTVHYHVKERGDYMLVVKWGEEHIPGSPFHITVP 2550          
BLAST of Filamin vs. Ensembl Xenopus
Match: coq2 (coenzyme Q2 4-hydroxybenzoate polyprenyltransferase [Source:Xenbase;Acc:XB-GENE-967037])

HSP 1 Score: 1419.06 bits (3672), Expect = 0.000e+0
Identity = 962/2614 (36.80%), Postives = 1352/2614 (51.72%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKT-NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP-YKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVP--VKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNK---AYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIY---------PVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQ-PQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLE---------------------------------------RNGSRV-----FTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIE--------GPILN-EVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAF-------QPQEQYSIERTTHHYTTEQSKPI------IRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPG------YNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPS--KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPF------RXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  N  I DLQ DL+DGLKLI L++ LS    +R  H RPNFR  KLENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+WE ED      Q    +PKQRLLGWI +K+P  P+ NF  DW DG A+GALVD CAPGLCP+W  WDP Q ++NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   APL  K  +  +  AYGPG+E  GN +  PA FTV+T NAG G + + V +P+G  E  ++  + +K   YS SY+P + G +++ + FA   I  SPF VNV  A GD +KVTA GPG+EPVGN   + T+F+++TA AG G V  +I+D +  +D+V+  +  + +N +   Y    EG H V + FAG QI   P+ V + S+  N +A    ATGRG+QP+GVRV++VA+F+V T+ A   +L   + G G + E  +I+     +YEC Y P                    PF V V+P     K++A+GPGL  G+V K A F VE  G E G LGFSI+GPS+AKI+C D GDGS +V YWPT PGEYAVH++CDDE+I  SP++A I   +    P KV AYG GL  +G     PA+F ++ + AG+ + +K    D  G  I ++I+DN D TY C Y P  P KHT+I+++G VNIP SP++V+V E  +   +KVYGPG+E+   K N  TYF VDC  AG GD+ I +          E   D  ++ +DN   T             YTI + F++ EIP SPF+V ++  +D  K +     LN T   +G+   F + T   G          S  G  V     +   +  +   +T    G  TV+V   G+PI  SP+ V     ++  +        +  +    +++ID        K  + + S    P+    V+T    +     + P EE  Y         PV  +    E   P     V AYG GL  G    PA F ID+       LG+T+EGP EAKI+  DNGDG+CSV+YLP EPG Y +N+L+ + HI  SPF   I P       + D +KVTA GPGL          + FTV+       G   +   I +    ++   + NN DGTYS +Y PA  G + I I Y G  V K P  V V    D S ++ +GPG+E  G+ ++   +FTVD   L   G   +   I GP+ A  + F  DN DGT  VQY   + G + + + +++  +P SPF VP+ +  D S+V+ YGPGLE                                       ++GS       FTP  + V+ +  G     +            A+ L  +  G   V Y P   G   + V Y + +VP SPF   VL + +  KV  +G G+       I   +P  FTI+ RDAGE  L + +  P  +    ++  +GDGT+T  Y  D+ G YT+ + YG   +P SPF +         +C +         G  L   + +G+   I V+ + AG G ++ K   P G  +   +   + G   + Y   + G Y + + F  E+IPN      A        +P +   + +  +  T E   P+      +R    V+ F    G +   VR     PS +   P + +N DGT+TV++ P E GLHE+++ Y+G  I GSP +FYVD+ I S  V+AYGPGLS+G  +  A FTIVTKDAG GGLSLAVEGPSKAEI C DNK+GTC VSY+P APGDY+I ++F DKHI GSPFT+KI G+   R SQ+ VGT++DV L+I+E+D++ L A + +P+G EE C LKRL N ++GISFTPKEVGEH+V+V ++G+H+ NSPFKI VG +EIG+AS+VK+ G GL +G+  E  +F+VDTRNAGYGGL LSIEGPSKV+I C D  DGTC V+Y PTEPGTYIIN+K+A+ +VPGSPF V + G     + E I R + A  ++ IG+ C+LNL IPG        Q   T +    S ++   E   +S  +       +E+ V       ++  V G PF    G  +  G   +   GS             T    EAGA  ++  +  PS   A+ +  D +D +  V +   E G +  S+K+  +HVPGSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     +    V ++  E G + V +  N+  IP SPF      R               G        F    N   G +   +  PS +   C  +E     Y+  ++P   G ++I +K+ G  HI GSPF + + G   Q+ D                         P  V   G GL+    G+ +EFIV    AG   L V + GP +   +      G   ++V+Y     G +L+ +++G    + GSPF+  V
Sbjct:   26 EKDLAEDAPWKKIQQNTFTRWCNEHLKCMNKRIGDLQKDLSDGLKLIGLLEVLSQKKMYRKYHSRPNFRQMKLENVSVALEFLDR-EHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDEEDAKKQ----TPKQRLLGWIQNKIPQLPITNFHRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRSKQLHPKKANAYGPGIEPHGNMVLKPAYFTVETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNI-SEACNPNA--CRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQG-TEEPVKIRDAGDGVYECDYYP-------------------VPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGT-AELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTV---KYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIP-CKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRP-------VFDPSKVTASGPGLEKGKA--GEVATFTVDCSKA---GDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGIPCSSDFHSGFAGARTLRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAG---IPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVACDTIPIIEEPCDTVQLHQ-PYPATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVR----MPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDA-INSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTG--EGRMKESITRRRQAPSIASIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGG--ETKREVRVE------ESTQVGGDPFHNVFGEFL--GRESLGTFGS------------ITRQEGEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTV--GPMGE------------GGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTSLQETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNG-RHIPGSPFKIRV-GEQSQAGD-------------------------PGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEG---YKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARV 2515          

HSP 2 Score: 952.97 bits (2462), Expect = 0.000e+0
Identity = 748/2394 (31.24%), Postives = 1155/2394 (48.25%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES----KIKAFGPGL--TGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCV--DNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPS-TVKAECF-DVTGQT---IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGI----SVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQE--TNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEYPETETPLLIS--ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQ---------RTNEKAELRK----PNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYI--DNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPG--------------------------------------------------SPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVT----GEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPF------IVPVHSE-AKPEQCYIEGPILNE--VPVGK--------TVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQY----------AFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPV-GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPF--KFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNK--NGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI----FGEPKKRSQICVGTTSDVPLRISETDINNLNA-------IVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFV-GENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADS-NVPGSPFAVNIG---GYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXX---------XXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRET-----KSLTQTVHMISGSTQKGP---SKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G++ +I+++P+  ++  E+      +  Y C+Y P MEG +++ I FA S+IP  P+ VN+  A  +P+   A+G G++P G  V     F VFT  A   ++   +L  +G ++ VK +                 +G++  + +    ++Q SP              ++  A G G+  E   V   A+F V         LG ++ GP ++  +C  K    C  +  Y P  PG Y V +   +  I  SPF   + P        K+KA+G GL  TG IV  PA F ++     T  L    +    + ID    DNGD +    Y PT P ++ + I     NIP SPY   +   +    P KV  YGPG+  +G+  N+P  F V+   AG    ++  +C   V G     I   I  N++ T++ +YTP   GK+T++V + +  IP SPF+V V  + +A+ ++  GPG+ R    +   T+F V  K AG   + +    S+  E ++D  ++  DN D ++T+KYT    G      + +    IP+SPF V +    D  K K+  LNN   +G+  EF I T   G + + ++ + SP+   +P K++   T++     + P   GP+ V +   G+P+  SP+ V A    D    + Y        +   A +AID K      + +      P E + ++   N +   S ++ P E   Y +           +  KA++R       VTA G GL KG A   A+F +D ++   A L + I     +K + +  +N DGT S+ Y+P  PG+Y + + Y    +   P  V + P         D + V  +GPG+ P GV ++  ++FTV+A+ +   G   V   I  P    +   + +N DGTY   Y+   DG H I++ YD VPV KSP+ VPV +G DPSR+RAYGPGLE G+  +  +FTV+  GAG GGLGL+IEGP++A++ C DNKDG+CSV+Y+P  PG YDV+I F  + IPG                                                  SPF + +    D SKV+  GPGL   G     P +FT+DA  AGE  L V ++D   K  K A I      G + V+Y+P+  G   I + Y   ++P SPF  + + + +  K +VT    G G+    G  I     ++ T++ + AG+  +   V+ P+   +++DV  + DGTF   Y    PG Y + + +G +++P SPF       +P+  E     Q +   P   E  VPV           + IP   Q    G ++ +   P G     +I + + G  TV + P + G +E+ + ++  +IP   ++ Y          A+ P   + +      +T      I+  +         V GP     +A + C  N+          DGT TV Y P+  G + + V ++ + I GSPF  K   D ++ + Q+     G S           I   D     L+ ++  PS  E  C+  +  N    +S+ P   G++ + +K   KH+  SPF   +     G+  K      G    V   ++E  ++  NA        +  P+  + +C  + +++G   +S+ P E G +++N+  + +H+P SPF + V GE  +  +   +     +    +  TC   +      +  +S   E  ++        +  T       T  G     V+  +S  V G PF    G   G  S      I R +  A   ++                  TA V SPSG     EII   DN +S+RF+P+E+G HTVSVK   +HV GSPFQFTVGP+ +GG HKV   G G+ERG+A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGSCGV+Y V E GDY  SIKFNDEH+P SPF++     P +S S          +D+R +++ +LQ+ G  +   A+F +  +G   G I A V +PS   +   +S++D+++YS+ F+P ENG+H++ V  N   IPGSPF++ VGE + +         G G+  G TGR +EF V T NAG G+L+VTIDGPSKV+L+CQ++  GY  +Y P APG+Y ISIKYGG  HI+GSPF   ++G       S+ ET     +++T++   + G     P   S    V   G GL  A +G++N F VD   AG ++L VGV GP  PCEEV +KH+GN  + V Y V++KG ++L+V+WG+ +VPGSPF++ VP
Sbjct:  375 DANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEAC-NPNACRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKS-LLKGQGTEEPVKIR--------------DAGDGVYECDYYPVPFEVQVSP----------EVGLQKVRAWGPGL--ETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSC--DVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSH---PNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEII--DNHDYSYTVKYTAVQQGTLTV-SVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEG--PCE-AKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAV-------DTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGIPCSSDFHSGFAGARTLRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKP-KKANIRGNGD-GTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVACDTIPIIEEPCDTVQLHQPYPATEEPVVPVENLDTMLRPFNLVIPFTVQK---GEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFT------IVTKDAGEGGLSLAVEGPS----KAEITCKDNK----------DGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNV---GTS-----TDVSLKITESDLSL--LTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINC--EDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGEGRMKESITRRRQAPSI--ASIGSTCDLNLKIPGNWFQMVSAQ-ERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFHNVFGEFLGRESLGTFGSITRQEGEAGAQEM------------------TAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVV-----PVASRS----------DDARRLTVTSLQETGIIVNQPASFAVQLNG-ARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGYKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTGVRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAVP 2648          
BLAST of Filamin vs. Ensembl Xenopus
Match: coq2 (coenzyme Q2 4-hydroxybenzoate polyprenyltransferase [Source:Xenbase;Acc:XB-GENE-967037])

HSP 1 Score: 1418.29 bits (3670), Expect = 0.000e+0
Identity = 907/2311 (39.25%), Postives = 1298/2311 (56.17%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVIL-DTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES----KIKAFGPGL--TGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCV--DNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPS-TVKAECF-DVTGQT---IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGI----SVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQE--TNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEYPETETPLLIS--ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQ---------RTNEKAELRK----PNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYI--DNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIE--------GPILN-EVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTH--HYTTEQSKPI------IRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXX---------XXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRET-----KSLTQTVHMISGSTQKGP---SKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G++ +I+++P+  ++  E+      +  Y C+Y P MEG +++ I FA S+IP  P+ VN+  A  +P+   A+G G++P G  V     F VFT  A   ++  ++    KG ++ VK  I    +  +  +Y     G ++V + + G  I  SPF V VS +      ++  A G G+  E   V   A+F V         LG ++ GP ++  +C  K    C  +  Y P  PG Y V +   +  I  SPF   + P        K+KA+G GL  TG IV  PA F ++     T  L    +    + ID    DNGD +    Y PT P ++ + I     NIP SPY   +   +    P KV  YGPG+  +G+  N+P  F V+   AG    ++  +C   V G     I   I  N++ T++ +YTP   GK+T++V + +  IP SPF+V V  + +A+ ++  GPG+ R    +   T+F V  K AG   + +    S+  E ++D  ++  DN D ++T+KYT    G      + +    IP+SPF V +    D  K K+  LNN   +G+  EF I T   G + + ++ + SP+   +P K++   T++     + P   GP+ V +   G+P+  SP+ V A    D    + Y        +   A +AID K      + +      P E + ++   N +   S ++ P E   Y +           +  KA++R       VTA G GL KG A   A+F +D ++   A L + I     +K + +  +N DGT S+ Y+P  PG+Y + + Y    +   P  V + P         D + V  +GPG+ P GV ++  ++FTV+A+ +   G   V   I  P    +   + +N DGTY   Y+   DG H I++ YD VPV KSP+ VPV +G DPSR+RAYGPGLE G+  +  +FTV+  GAG GGLGL+IEGP++A++ C DNKDG+CSV+Y+P  PG YDV+I F  + IPGSPF VP+ +IVD SKVKC GPGL  +G R   P  FTVD SKAG APL+V ++   +   +P  I      G   V Y P   G   + V Y + +VP SPF   VL + +  KV  +G G+       I   +P  FTI+ RDAGE  L + +  P  +    ++  +GDGT+T  Y  D+ G YT+ + YG   +P SPF +         +C +         G  L   + +G+   I V+ + AG G ++ K   P G  +   +   + G   + Y   + G Y + + F  E+IPN S        QE   I  + H    T E   P+      +R    V+ F    G +   VR     PS +   P + +N DGT+TV++ P E GLHE+++ Y+G  I GSP +FYVD+ I S  V+AYGPGLS+G  +  A FTIVTKDAG GGLSLAVEGPSKAEI C DNK+GTC VSY+P APGDY+I ++F DKHI GSPFT+KI G+   R SQ+ VGT++DV L+I+E+D++ L A + +P+G EE C LKRL N ++GISFTPKEVGEH+V+V ++G+H+ NSPFKI VG +EIG+AS+VK+ G GL +G+  E  +F+VDTRNAGYGGL LSIEGPSKV+I C D  DGTC V+Y PTEPGTYIIN+K+A+ +VPGSPF V + G     + E I R + A  ++ IG+ C+LNL IP    +  TA V SPSG     EII   DN +S+RF+P+E+G HTVSVK   +HV GSPFQFTVGP+ +GG HKV   G G+ERG+A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGSCGV+Y V E GDY  SIKFNDEH+P SPF++     P +S S          +D+R +++ +LQ+ G  +   A+F +  +G   G I A V +PS   +   +S++D+++YS+ F+P ENG+H++ V  N   IPGSPF++ VGE + +         G G+  G TGR +EF V T NAG G+L+VTIDGPSKV+L+CQ++  GY  +Y P APG+Y ISIKYGG  HI+GSPF   ++G       S+ ET     +++T++   + G     P   S    V   G GL  A +G++N F VD   AG ++L VGV GP  PCEEV +KH+GN  + V Y V++KG ++L+V+WG+ +VPGSPF++ VP
Sbjct:  354 DANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEAC-NPNACRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVK--IRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVG---LQKVRAWGPGL--ETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSC--DVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSH---PNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEII--DNHDYSYTVKYTAVQQGTLTV-SVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEG--PCE-AKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAV-------DTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGL-GSGVRAHVPQTFTVDCSKAGLAPLEV-LVQGPSGLAEPVDIRDNGD-GTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAG---IPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPN-SPFHVVVSKQEVMKIFLSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVR----MPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDA-INSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTG--EGRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVV-----PVASRS----------DDARRLTVTSLQETGIIVNQPASFAVQLNG-ARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGYKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTGVRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAVP 2608          

HSP 2 Score: 1112.06 bits (2875), Expect = 0.000e+0
Identity = 853/2588 (32.96%), Postives = 1249/2588 (48.26%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKT-NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEK-CQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP-YKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVP--VKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNK---AYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIY---------PVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQ-PQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPF---IVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTT----HHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRL----INNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRP--------DMHAHFTIVTK-DAGAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF--------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGY--NQRNT-----TASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTR--EAGAGSLSIAIEGPS--KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPF------RXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  N  I DLQ DL+DGLKLI L++ LS    +R  H RPNFR  KLENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+WE ED      Q    +PKQRLLGWI +K+P  P+ NF  DW DG A+GALVD CAPGLCP+W  WDP Q ++NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   APL  K  +  +  AYGPG+E  GN +  PA FTV+T NAG G + + V +P+G  E  ++  + +K   YS SY+P + G +++ + FA   I  SPF VNV  A GD +KVTA GPG+EPVGN   + T+F+++TA AG G V  +I+D +  +D+V+  +  + +N +   Y    EG H V + FAG QI   P+ V + S+  N +A    ATGRG+QP+GVRV++VA+F+V T+ A   +L   + G  +  E+  +I+     +YEC Y P  PG Y V I +G   I  SPF V V+P     K++A+GPGL  G+V K A F VE  G E G LGFSI+GPS+AKI+C D GDGS +V YWPT PGEYAVH++CDDE+I  SP++A I   +    P KV AYG GL  +G     PA+F ++ + AG+ + +K    D  G  I ++I+DN D TY C Y P  P KHT+I+++G VNIP SP++V+V E  +   +KVYGPG+E+   K N  TYF VDC  AG GD+ I +          E   D  ++ +DN   T             YTI + F++ EIP SPF+V ++  +D  K +     LN T   +G+   F + T   G          S  G  V     +   +  +   +T    G  TV+V   G+PI  SP+ V     ++  +        +  +    +++ID        K  + + S    P+    V+T    +     + P EE  Y         PV  +    E   P     V AYG GL  G    PA F ID+       LG+T+EGP EAKI+  DNGDG+CSV+YLP EPG Y +N+L+ + HI  SPF   I P       + D +KVTA GPGL          + FTV+       G   +   I +    ++   + NN DGTYS +Y PA  G + I I Y G  V K P  V V    D S ++ +GPG+E  G+ ++   +FTVD   L   G   +   I GP+ A  + F  DN DGT  VQY   + G + + + +++  +P SPF VP+ +  D S+V+ YGPGLE  G  +   ++FTV+   AG   L + +   +   +        +  G   V YIP   G+ ++ + +    +PGSPF   V    +P KV  +G G+    G  +   VP  FT++   AG + LE++V GP+  +  +D+ ++GDGT T  Y     G YTV V Y ++ VP SPF   ++P H  +K       GP LN   +P    V   ++ ++AG+G+L+ + + P G     +I     G  TVSYVP   G Y + + +  + IP    R +A    +      T     H   T     I   E +V+             +  V C  +  D   L    + N DGT  + Y   E G + + + + G+ I  SPF   V          ++ P  +   P         M   F +V       G ++  V  PS   A     DNK+GT  V + P+  G + + IK+   HI GSP         +  +       S   V   +   +   +     L+  V  P+  E +C  K  ++G   +S+ P   G++ + V    +HIP SPF   +  ++    S+       LN G   +    + ++       L+ SI  PS  E  C      + H G   +++ P E G ++++VK    +V  SPF + +G  PS       +      +VS  G +  +   +  +  + RN        S+  PS     CE   + D    + + P E G + +++K   +HV GSPF   V      G  K  I        +A+  +   +  +  EAGA  ++  +  PS   A+ +  D +D +  V +   E G +  S+K+  +HVPGSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     +    V ++  E G + V +  N+  IP SPF      R               G        F    N   G +   +  PS +   C  +E     Y+  ++P   G ++I +K+ G  HI GSPF + + G   Q+ D                         P  V   G GL+    G+ +EFIV    AG   L V + GP +   +      G   ++V+Y     G +L+ +++G    + GSPF+  V
Sbjct:    5 EKDLAEDAPWKKIQQNTFTRWCNEHLKCMNKRIGDLQKDLSDGLKLIGLLEVLSQKKMYRKYHSRPNFRQMKLENVSVALEFLDR-EHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDEEDAKKQ----TPKQRLLGWIQNKIPQLPITNFHRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRSKQLHPKKANAYGPGIEPHGNMVLKPAYFTVETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNI-SEACNPNA--CRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGT-AELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTV---KYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIP-CKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRP-------VFDPSKVTASGPGLEKGKA--GEVATFTVDCSKA---GDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLE--GGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMS----CKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGL----GSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASK---VRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAG-----KGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKIFLSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITC--KDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQ-------LNVGTSTDVSLKITESD---LSLLTASIRAPSGNEEPCLLKRLPNRHIG---ISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVG--PSE------IGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCE--DMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKV---TGEGRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTV--GPMGE------------GGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTSLQETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNG-RHIPGSPFKIRV-GEQSQAGD-------------------------PGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEG---YKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARV 2475          
BLAST of Filamin vs. Ensembl Xenopus
Match: coq2 (coenzyme Q2 4-hydroxybenzoate polyprenyltransferase [Source:Xenbase;Acc:XB-GENE-967037])

HSP 1 Score: 1405.96 bits (3638), Expect = 0.000e+0
Identity = 897/2295 (39.08%), Postives = 1281/2295 (55.82%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVIL-DTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES----KIKAFGPGL--TGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCV--DNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFD-PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGI----SVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQE--TNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEYPETETPLLIS--ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQ---------RTNEKAELRK----PNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYI--DNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPI------IRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXX---------XXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRET-----KSLTQTVHMISGSTQKGP---SKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G++ +I+++P+  ++  E+      +  Y C+Y P MEG +++ I FA S+IP  P+ VN+  A  +P+   A+G G++P G  V     F VFT  A   ++  ++    KG ++ VK  I    +  +  +Y     G ++V + + G  I  SPF V VS +      ++  A G G+  E   V   A+F V         LG ++ GP ++  +C  K    C  +  Y P  PG Y V +   +  I  SPF   + P        K+KA+G GL  TG IV  PA F ++     T  L    +    + ID    DNGD +    Y PT P ++ + I     NIP SPY     L    F  PL       G+        PA+  ++              FD+        I+++ND T++ +YTP   GK+T++V + +  IP SPF+V V  + +A+ ++  GPG+ R    +   T+F V  K AG   + +    S+  E ++D  ++  DN D ++T+KYT    G      + +    IP+SPF V +    D  K K+  LNN   +G+  EF I T   G + + ++ + SP+   +P K++   T++     + P   GP+ V +   G+P+  SP+ V A    D    + Y        +   A +AID K        +      P E + ++   N +   S ++ P E   Y +           +  KA++R       VTA G GL KG A   A+F +D ++   A L + I     +K + +  +N DGT S+ Y+P  PG+Y + + Y    +   P  V + P         D + V  +GPG+ P GV ++  ++FTV+A+ +   G   V   I  P    +   + +N DGTY   Y+   DG H I++ YD VPV KSP+ VPV +G DPSR+RAYGPGLE G+  +  +FTV+  GAG GGLGL+IEGP++A++ C DNKDG+CSV+Y+P  PG YDV+I F  + IPGSPF VP+ +IVD SKVKC GPGL  +G R   P  FTVD SKAG APL+V ++   +   +P  I      G   V Y P   G   + V Y + +VP SPF   VL + +  KV  +G G+       I   +P  FTI+ RDAGE  L + +  P  +    ++  +GDGT+T  Y  D+ G YT+ + YG   +P SPF +         +C + G    E  +G+   I V+ + AG G ++ K   P G  +   +   + G   + Y   + G Y + + F  E+IPN S        QE           T E   P+      +R    V+ F    G +   VR     PS +   P + +N DGT+TV++ P E GLHE+++ Y+G  I GSP +FYVD+ I S  V+AYGPGLS+G  +  A FTIVTKDAG GGLSLAVEGPSKAEI C DNK+GTC VSY+P APGDY+I ++F DKHI GSPFT+KI G+   R SQ+ VGT++DV L+I+E+D++ L A + +P+G EE C LKRL N ++GISFTPKEVGEH+V+V ++G+H+ NSPFKI VG +EIG+AS+VK+ G GL +G+  E  +F+VDTRNAGYGGL LSIEGPSKV+I C D  DGTC V+Y PTEPGTYIIN+K+A+ +VPGSPF V + G     + E I R + A  ++ IG+ C+LNL IP    +  TA V SPSG     EII   DN +S+RF+P+E+G HTVSVK   +HV GSPFQFTVGP+ +GG HKV   G G+ERG+A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGSCGV+Y V E GDY  SIKFNDEH+P SPF++     P +S S          +D+R +++ +LQ+ G  +   A+F +  +G   G I A V +PS   +   +S++D+++YS+ F+P ENG+H++ V  N   IPGSPF++ VGE + +         G G+  G TGR +EF V T NAG G+L+VTIDGPSKV+L+CQ++  GY  +Y P APG+Y ISIKYGG  HI+GSPF   ++G       S+ ET     +++T++   + G     P   S    V   G GL  A +G++N F VD   AG ++L VGV GP  PCEEV +KH+GN  + V Y V++KG ++L+V+WG+ +VPGSPF++ VP
Sbjct:  354 DANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEAC-NPNACRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVK--IRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVG---LQKVRAWGPGL--ETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSC--DVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSYSLIGLCFSSPLFFRDVSIGIKCAPGVVGPAEADID--------------FDI--------IKNDND-TFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEII--DNHDYSYTVKYTAVQQGTLTV-SVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGG--LGLTVEGPCE-AKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAV-------DTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGL-GSGVRAHVPQTFTVDCSKAGLAPLEV-LVQGPSGLAEPVDIRDNGD-GTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAG---IPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTG----EPAIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPN-SPFHVVVSKQEVMKSASKAPAATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVR----MPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDA-INSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTG--EGRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVV-----PVASRS----------DDARRLTVTSLQETGIIVNQPASFAVQLNG-ARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGYKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTGVRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAVP 2568          

HSP 2 Score: 1066.99 bits (2758), Expect = 0.000e+0
Identity = 834/2574 (32.40%), Postives = 1229/2574 (47.75%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKT-NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEK-CQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP-YKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVP--VKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNK---AYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIY---------PVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQ-PQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPF---IVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRL----INNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVD--------STIPSGQVTAYGPGLSYGRPDMHAHFTIVTK-DAGAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR--------SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGY--NQRNT-----TASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTR--EAGAGSLSIAIEGPS--KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPF------RXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  N  I DLQ DL+DGLKLI L++ LS    +R  H RPNFR  KLENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+WE ED      Q    +PKQRLLGWI +K+P  P+ NF  DW DG A+GALVD CAPGLCP+W  WDP Q ++NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   APL  K  +  +  AYGPG+E  GN +  PA FTV+T NAG G + + V +P+G  E  ++  + +K   YS SY+P + G +++ + FA   I  SPF VNV  A GD +KVTA GPG+EPVGN   + T+F+++TA AG G V  +I+D +  +D+V+  +  + +N +   Y    EG H V + FAG QI   P+ V + S+  N +A    ATGRG+QP+GVRV++VA+F+V T+ A   +L   + G  +  E+  +I+     +YEC Y P  PG Y V I +G   I  SPF V V+P     K++A+GPGL  G+V K A F VE  G E G LGFSI+GPS+AKI+C D GDGS +V YWPT PGEYAVH++CDDE+I  SP++A I   +    P KV AYG GL  +G     PA+F ++ + AG+ + +K    D  G  I ++I+DN D TY C Y P  P KHT+I+++G VNIP SP++V+    G   +                  F  D  +      G+    E   D  ++ +DN   T             YTI + F++ EIP SPF+V ++  +D  K +     LN T   +G+   F + T   G          S  G  V     +   +  +   +T    G  TV+V   G+PI  SP+ V     ++  +        +  +    +++ID        K  + + S    P+    V+T    +     + P EE  Y         PV  +    E   P     V AYG GL  G    PA F ID+       LG+T+EGP EAKI+  DNGDG+CSV+YLP EPG Y +N+L+ + HI  SPF   I P       + D +KVTA GPGL          + FTV+       G   +   I +    ++   + NN DGTYS +Y PA  G + I I Y G  V K P  V V    D S ++ +GPG+E  G+ ++   +FTVD   L   G   +   I GP+ A  + F  DN DGT  VQY   + G + + + +++  +P SPF VP+ +  D S+V+ YGPGLE  G  +   ++FTV+   AG   L + +   +   +        +  G   V YIP   G+ ++ + +    +PGSPF   V    +P KV  +G G+    G  +   VP  FT++   AG + LE++V GP+  +  +D+ ++GDGT T  Y     G YTV V Y ++ VP SPF   ++P H  +K       GP LN   +P    V   ++ ++AG+G+L+ + + P G     +I     G  TVSYVP   G Y + + +  + IP    R +A                T + SK ++  E ++ +            +  V C  +  D   L    + N DGT  + Y   E G + + + + G+ I  SPF   V         S  P+       P  +     M   F +V       G ++  V  PS   A     DNK+GT  V + P+  G + + IK+   HI GSP    +     +         S   V   +   +   +     L+  V  P+  E +C  K  ++G   +S+ P   G++ + V    +HIP SPF   +  ++    S+       LN G   +    + ++       L+ SI  PS  E  C      + H G   +++ P E G ++++VK    +V  SPF + +G  PS       +      +VS  G +  +   +  +  + RN        S+  PS     CE   + D    + + P E G + +++K   +HV GSPF   V      G  K  I        +A+  +   +  +  EAGA  ++  +  PS   A+ +  D +D +  V +   E G +  S+K+  +HVPGSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     +    V ++  E G + V +  N+  IP SPF      R               G        F    N   G +   +  PS +   C  +E     Y+  ++P   G ++I +K+ G  HI GSPF + + G   Q+ D                         P  V   G GL+    G+ +EFIV    AG   L V + GP +   +      G   ++V+Y     G +L+ +++G    + GSPF+  V
Sbjct:    5 EKDLAEDAPWKKIQQNTFTRWCNEHLKCMNKRIGDLQKDLSDGLKLIGLLEVLSQKKMYRKYHSRPNFRQMKLENVSVALEFLDR-EHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDEEDAKKQ----TPKQRLLGWIQNKIPQLPITNFHRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRSKQLHPKKANAYGPGIEPHGNMVLKPAYFTVETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNI-SEACNPNA--CRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGT-AELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSYSLIGLCFS---------------SPLFFRDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTV---KYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIP-CKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRP-------VFDPSKVTASGPGLEKGKA--GEVATFTVDCSKA---GDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLE--GGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMS----CKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGL----GSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASK---VRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVP--------------TGDASKCLVTGEPAIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKSASKAPAATEEPVVPVENLDT--MLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITC--KDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQ-------LNVGTSTDVSLKITESD---LSLLTASIRAPSGNEEPCLLKRLPNRHIG---ISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVG--PSE------IGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCE--DMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKV---TGEGRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTV--GPMGE------------GGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTSLQETGIIVNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNG-RHIPGSPFKIRV-GEQSQAGD-------------------------PGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEG---YKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARV 2435          
BLAST of Filamin vs. Ensembl Mouse
Match: Flnb (filamin, beta [Source:MGI Symbol;Acc:MGI:2446089])

HSP 1 Score: 1340.87 bits (3469), Expect = 0.000e+0
Identity = 869/2335 (37.22%), Postives = 1250/2335 (53.53%), Query Frame = 2
Query:  842 PKVD--EKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP----YKESKIKAFGPGL--TGGIVSKPAFFEVETNGETGALGFSIKGPSEAK---IDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPST-----VKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS----VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQET--NNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSV------------VDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX---------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGST-----QKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            PKV    K ++ +  Q  +           + ++ +V A GPGLE  GN    P  F + T  AG G++ I V +P+G K   E+         Y C Y P   G + + + FA   IP SPF V +  A  +P+   ASG G++P G  +     F V T  AG G +   +   KG ++ VK K     +  +  EY     G +SV V + G  I  SPF V V  +   +  ++  A G G+   G  V   A+F V +  +    LG  + GP ++  +   +    C  +  Y P+ PG Y V I   +  I  SP+   + P    Y    ++A+GPGL  +G  ++ PA F V+      A    +    E +   I      DG+   +Y P    ++ + ++    NIP SPY   I   +    P KV  +GPG+  SG+  N+P  F V+   AG           A       + +   I  N + T++ +Y P  PG++T+ V + +  IP SPF+V V  + +A+ +K  GPG+ +A  +    T+F V  K AG   + +     +  E ++D+ ++  DN D + T+KYTP   G    + + +    IP+SPF V + +  D  K KIN L N   +G+  EF I T   G + + ++ + SP+   VP  +          A F P   G   V V   G+P+  SPY V A+   D    K + P  E  L+   A++ ID K        +      P E + ++   N +   S ++ P +   Y V    E         KA++  P     V A G GL  G    P    +D +E  P  LG+    +   +A++   +N DGT +V Y+P   G Y + + Y  E +   P  V + P         D + + A+GPG+    VF+++ + FTV+++P+   G   +KA ITNP    + C V +N DGTY   Y+P   G H +++TYD VP+  SP+ V V +G  PSR+ A GPGL+E  T +   FTV   GAG GGLG+++EGP++++I C DNKDG+CS +Y+P  PG YDV+I +   HIPGSPF VP  D+VD SKVK  GPGL  +  R   P  FTVD+SKAG APL+V V+      V+P  ++     G   VTY P   G   + V Y + ++P SPF   VL + +  KV  +G G+     + +   +P  F I+ RDAGE  L + +T    +     V ++ DGT+   Y  D  G Y + V YG  N+P SP+ +         +C   GP I   V  G+ V   V+ + AG G ++   + P G      +     G   + Y   K G Y + + F   +IPN      A    E  ++E    +      +P +  E  V             D   P       +   V+ PS +K  P +++N DGT+TV+Y P+E GLHE+ + Y G  I  SP +FYV+    SG V+AYGPGL YG  +  A FTIVT+DAG GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY I +K+ DKHI GSPFTAKI  + ++ SQ+ +G+ +D  L ISETD++ L A + +P+GR+E C LKRL N ++GISF P+EVGEHLV++ ++G H+ NSP  I V ++EIG+A R K+YG GL++G   E   F+VDTR+AGYGG+SL++EGPSKV+I+  D  DGTC V+Y PT PG YI++ K+AD +VPGSPF V I G     + E I R   A  V+ +G++C+LNL IP  N  + +A V SPSG     EI+ +  N   +RF+P+E+GVHTVSVK   +HVTGSPFQFTVGPL +GG HKV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F D+K+GSCGV+Y   EPG+Y  SIKFNDEH+P SP+++            PV   +   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +S+++ ++Y+V F+P ENGIH + V  N S + GSPF+V V           V+  G G+  G TG  +EFF++T+ AG G L+VTI+GPSKV+++CQE   GY   Y P APG+Y I +KYGG NHI  SPF   ++G    S  S  ET S L ++V   S  T      K  S    V  +G GL  A +G+++ F+VD   AG ++L +GV GP  PCEEV++KH+G  ++ V Y V+E+G ++L V+WG   +PGSPF + VP
Sbjct:  321 PKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQG-KNSVELLVEDRGNQVYRCVYKPVQPGPHVVKVSFAGDAIPKSPFGVQIGEAC-NPNACRASGRGLQPKGVRIRETADFKVDTKAAGSGELGVTVKGPKGLEELVKQK--GFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGPE---AGMQKVRAWGPGLH--GGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQNDGSC--DVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGSH---PQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGEAVKDLDII--DNYDYSHTVKYTPTQQGNMQVL-VTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGKDQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGG--LGLTVEGPCE-AKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPAWVKVEPAI-------DTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLS-SCVRACIPQSFTVDSSKAGLAPLEVRVLG-PRGLVEPVNVVDNGD-GTHTVTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLS---AYGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATD-GEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESPLQFYVNYP-NSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISG--EGRVRESITRTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLV------------PVIAPS---DDARCLTVLSLQESGLKVNQPASFAIRLNG-AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTGIQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEIPEGYKVMYTPMAPGNYLIGVKYGGPNHISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP 2602          

HSP 2 Score: 1080.86 bits (2794), Expect = 0.000e+0
Identity = 854/2602 (32.82%), Postives = 1248/2602 (47.96%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHT-HKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK-ESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNT---TPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAID-NKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQR----SNFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE--EGITKQPQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLER---NGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYS---VVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVD----STIPSGQVTAYGPGLSYGRP-----------DMHAH----FTIVTKDA-GAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVG---------TTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLII-----PGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLA----NDANQFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRX---XXXXXXXXXXXIHHGHTG-RINE--FFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWG--NHDVPGSPFEIVV 7621
            + E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS     H  H+RP FR  KLENV++ L FL+  E ++LV+IDS  I D  LKLILGL+WTLILHYSI+MP+WE    ++ D   K  +PKQRLLGWI +K+P+ P+ NF  +W DG A+GALVD+CAPGLCP+W  WDP++ + NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +  PA FTVDT +AG+G++ + V +P+G KE   +    +K   YS  Y+P + G +++I+ FA   I  SPF+VNV  A GD SKVTA GPG+E  GN   + T+F+++TA AG G +   + D +G K+SV+  +  +    +   Y   + G H V V FAG  I  SPFGV +  +  N +A    A+GRG+QP+GVR+R+ A+F+V T+ AG  +LGV V GP    E  + K     +Y   Y P  PG Y V + +G + I  SPF V V P     K++A+GPGL GGIV + A F VE+ G E G LGF+I+GPS+AKI+  D  DGS +V YWP  PGEYAVHI+CDDE+I  SPYMA I   T  ++P  V AYGPGL  SG + N PA+FIV+ K+AGS + +K    D  GQ I +Q++   DGTY+C YTP    KHT+ V +G VNIP SP++VN+ +  +   +KV+GPG+ER+  K N  T+F VDC  AG GD+ +       VL +   DV      N + TF            YTI++ F+  EIP SPF+V ++  +D  K K      +      G+   F + T   G K    +   SP        L   +N        +TPT  G   V V   G+PI  SP+ V     ++  +      E    +    ++AID N A  +  + V    L+P  R  V     P   R    + F P EE ++ V  T +           E   P     V A+G GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP +PG Y VN+L+ + HI  SPF   I           D +KV A GPGL    V +        +       G G +     +    ++  ++ NN DGTY+ +Y P   G + + + Y G  V   P +V V    D S I+A+GPG+E  +   +    FTVD   L   G   +   I  P+ A  +CF  DN DGT  V+Y P + G + V + +++  IP SPF V + +    S+V   GPGL+    N S V     FTV    AG   L + V   +   +        +  G     YIP   G+ ++ + Y  + +PGSPF     +  +P KV + G G+       +   +P  FT+++  AG + LE+ V GP      ++V ++GDGT T  Y     G Y V V Y ++ +P SPF V V       +    GP L+   VP    V   ++ ++AG+G+L+ +     G     ++ + + G   V+Y+P K G Y + + +  +NIP    R  A Q     + + +    T     P ++T      VVD K         V  V+  P   +    +I N DGT  + Y  ++ G + + V + G  I  SPF         + +    V A  PG    RP           DM+      F +V   A   G ++  V  PS  KA  + +DNK+GT  V Y P   G + + IK+   HI  SP    +   P   S    G          T+   +   +     L+  +  P+  E SC   +  +G   +++ P   G++ + V  + +HIP SPF   + ++     S+VKL               F++D        L+ SI+ PS  +  C      +NH G   +++ P E G +++++K   ++V  SP ++ +            +  Q  +E    G   E++  I      GY     + +V  PS      E   L D    + + P   GV+ VS K  + HV GSPF   +      G  +V    +   R  A           +   E  +  +S  +  PS    +AEI     K+  C V +   E G +  S+K+  +HV GSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     N    V ++  E G + V +  N+  IP SP+ V      +       +    +G ++N+   F    N   G +   +  PS     C  +E     Y   ++P+  G +TI +K+ G +H++GSPF V +       N                          P  V   G GL+    G ++EF ++   AG   L V + GP +    C+E+         ++V Y     G +L+ V++G  NH +  SPF+  V
Sbjct:    3 VTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMHHKYHQRPTFRQMKLENVSVALEFLDH-ESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQG-KNSVELLVEDRGNQVYRCVYKPVQPGPHVVKVSFAGDAIPKSPFGVQI-GEACNPNA--CRASGRGLQPKGVRIRETADFKVDTKAAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGS-APLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSDDEEDVDFDIIHNANDTF-TVKYVPPAPGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAG-KAPLNVQFSSPLPGEAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGKDQEFAIDTNGAGGQGKLDV--TILSP-SRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADI-------EMPFDPSKVVASGPGLEHGKVGEPGILCVDCSEA-----GPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPAWVKVEPAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVHAQGPGLKEAFTNKSNV-----FTVVTRGAGIGGLGITVEGPSESKIN----CRDNKDGSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLS----SCVRACIPQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQ-----TGDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGK---GKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGF---RPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESPLQFYV-NYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNK--DGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDN-RRCSQVKL----------GSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIG---ISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSE----GRTFEMSDFIVDTRDAGYG--GISLAVEGPSKVDIQTE--DLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKI-----SGEGRVRESITRTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEI-VPMGKNSHC-VRFVPQEMGVHTVSVKYRGQHVTGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPVIAPSDDARCLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNG-SHVVGSPFKVRVGEPGQAGN--------------------------PALVSAYGAGLETGTTGIQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEI------PEGYKVMYTPMAPGNYLIGVKYGGPNH-ISRSPFKAKV 2471          
BLAST of Filamin vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 1162.13 bits (3005), Expect = 0.000e+0
Identity = 653/1512 (43.19%), Postives = 922/1512 (60.98%), Query Frame = 2
Query: 3212 NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAF---QPQEQYSI--ERTTHHYTTEQ--------SKPIIR------TEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXX---------XXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETK-----SLTQTV----HMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
             V   G GL +  A     F +D +    A L + I  E  + A++   D+GDGT ++ Y+P  PG+Y V + Y  + + + P  + + P         D + V  YGPG+   GVF+++ ++F+V+A+ +   G   VKA + NP    +   V +  DGTY   Y+P  +G H +D+TYDG PV  SP+ VPV +G DPSR+R +GPG++ G T +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+CSV+Y+P + G+Y +++ +    +PGSPF VP+HD+ D SKVKC GPGL     R   P  F VD SKAG APL+V V       V+P  ++  +  G   V Y+P   G+  I VLY   +VP SPF   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P  +     + ++ DGT+T  Y  DVPG YT+ + YG   +P SP+ V         +C + G  I   + +G+   I V+T+ AG G ++     P G+ V   +     G   + Y   + G Y + + F  E++PN   +  A    QP  Q  +  ++    Y   Q         +P++       T     D   P       +   V  PS +   P + +N DGT+TV+Y PSE+GLHE+++ Y+   I GSP +FYVD  +  G +TAYGPGL++G  +  A FT+ TKDAG GGLSLA+EGPSKAEI C DN++GTC VSYLP+ PGDY I +K+ D+HI GSPFTA++ G+   R S + VG+ +D+P+ ISETD++ L A V+ P+GREE C LKRL+NG++GISF PKE GEHLV+V ++G+H+ +SP  + + ++EIG+ASRV++ G GL++G   E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGSPF+V + G     + E I R + A  V+ IG+ C+L+L IP  + ++ TA V SPSG     EI+   ++ + IRF+P E+G+HTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER       +F I+TREAGAG L+IA+EGPSKAEI F+D KDGSCGV Y V EPGDY  S+KFN+EH+P SPF++     P +S S           D+R +++++LQ+ G  +   A+F ++ +G   G+I A V SPS   +   +++ID ++Y+V F+P ENGI+ + V  N + IPGSPF++ VGE         V+  G G+  G TG   EF V+TSNAG GAL+VTIDGPSKV+++CQE   GY  TY P APG Y ISIKYGG  HI GSPF   ++G    SN S+ ET      SLT+      H  SG    GP+    V  +G GL  A +G+++ F VD   AG ++L VGV GP  PCEE+ +KH+G+  + V+Y +++KG + L+V+WG+  +PGSP+ I+VP
Sbjct: 1162 KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAV-------DTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKV-QGPKGLVEPVDVVDNAD-GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVD-YVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTG--EGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVV-----PVASPS----------GDARRLTVSSLQESGLKVNQPASFAVSLNG-AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGP---GPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMVP 2639          

HSP 2 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 822/2607 (31.53%), Postives = 1245/2607 (47.76%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTH-KRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP-YKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGS---KVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETET--PLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNEK-------------AELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP-QKFTVDLEGAGQGG---LGLSIEGPA----DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----------GEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRT-EYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKF--------YVDSTIPSGQ---------------------VTAYGPGLSYGRP-DMHAHFTIVTKDAGAGGLSLAVEGPSK--AEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF--------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIEC--HDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCE-LNLII----PGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQ--FTIYTREAGAGSLSIAIEGPSKA--EIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTG----RINE--FFVDTSNAGNGALTVTIDGPSKVQLNC---QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  +  I +LQ DL+DGL+LI L++ LS       H +RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W+ E+  +   Q    +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A++ L +  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   +S  Y+P + G +++ + FA   I  SPF+V V  + GD SKVTA GPG+EP GN   + T+F +FTA AG G V+ VI D  G+K +V+P++  + ++ +   Y    EG+H+V+V FAGV I  SP+ V V    + +  +   A GRG+QP+GVRV++ A+F+V+T+ AG  +L V V GP +  E+ + K +   +Y   Y P  PG Y V I +G   I  SPF V V       K++A+GPGL GGIV K A F VE  G + G LGFS++GPS+AKI+C D GDGS +V YWP   GEYAVH+LC+ E+I  SP+MA I+   + F P +V A GPGL  +G++ NKPA+F V+ K+AG  + ++ +  D  G ++   ++DN +GTYSC Y P+ P KHT +VS+G V+IP SPF+VNV    +   +KVYGPG+ +   K +  TYF VDC  AG GD+ I +          E   D  ++ +DN   T            +YTI + F++   P SP +V +E  +D  K K     LN T   +G+   F +     G     V+   + K      V + +   +N +   + P   GP  V V   G+ I  SP+ V  +  ++  +   +     + +  D     K+         ++K+     + V     P     N    F P EE  Y V+ T +              A  +   V A+G GL  G A +PA F ID+       LG+T+EGP EA+++ +DNGDGTCSV+Y+P EPG Y +N+L+ D HI  SPF   + P         D +KV   GPGL           +F V+       G   +   I +     +   + ++ DGT++ +Y P   G + + I Y G PV   P  + V    D S ++ YGPG+E +G+ ++   +F+VD     Q G   +   +  P+    D  +Q  D  DGT  V+Y P + G + V + ++   +P SPF VP+ +  D S+V+ +GPG++   +    P++FTV+   A          G +  K++ +D                 G   V YIP   G   + V Y   QVPGSPF   V +  +  KV  +G G+ P  G + AN +P  F ++T  AG + L++ V GP      +DV ++ DGT T  Y     G+Y++ VLYG + VP SPF V V       +    GP LN   VP    V   ++ ++AG+G+L+ +   P G      I++   G  TV+YVP   G Y + + +  + IP    R  A       + + +    T     P I+  E +V+               V     +  DV  ++ N DGT  + Y   + G + + V + G+ +  SPF+          V + + S Q                     V   G  ++  RP D+   FTI       G ++  V  PS   A+    DNK+GT  V Y P   G + + I++ + HI GSP            I       +   V   +   +   +     L+  +  P+  E SCT    Q+G   +S+ P   G++ + V  + +HIP SPF   V  ++    S +K          V       ++        L+ ++  PS  E  C      +G   +++ P E G ++++VK    +V  SP  V I    S S      R + + +    G+  E    II     GY     + S+  PS      E   L D    + + P E G + +++K  ++HV GSPF   V      G  K  I        +AN  +    ++   E     ++  +  PS    E +  + ++ +  + +   E G +  S+K+  +HVPGSPF   +   P                 +  +       +   +G  A F I       G ++  V  PS  E   S     +    V +V  E G + V V  N   IP SPF V V   +     +          ++N+   F  + N   GA+   +  PS     C   + ++  Y   ++P   G Y I +K+ G  HI GSPF + +    +  +                          P  V   G GL+    G   EFIV+   AG   L V + GP +    C+E          ++V Y     G +L+ +++G  + + GSPF+  V
Sbjct:   32 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQ----TPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACR---AIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGK-APLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTV---KYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDI-IDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAP-------CFDASKVKCSGPGLE--RATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQ--DCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTN--KPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKD--------------GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRAN-LPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVP-----TGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDV-DVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTI-----KKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDN--QDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLK----------VGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVI----SQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYG--GLSLSIEGPSKVDINTE--DLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV---TGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAE--ISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNG-THIPGSPFKIRVGEPGHGGD--------------------------PGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQEC------PEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV 2508          

HSP 3 Score: 150.599 bits (379), Expect = 1.821e-35
Identity = 138/493 (27.99%), Postives = 219/493 (44.42%), Query Frame = 2
Query: 1037 NLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKN-AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESK----IKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHI-LCDDENIPKSPYMAQI------------QLDTKLFDPL--------------------KVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQ---IRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV 2389
            ++   V +P G+    EI +  N    Y   ++P   G + + +K+    +P SPF+  V     G   KV A GPG+E    EVG    F ++T EAG G +   +      + S +     + +    + Y  +E G + V+V F    I  SPF V V+S +   DA++   T   +Q  G++V   A F V    A  A +   V+ P  +LE+C + ++    Y   +IP+  G Y++D+K+    I  SPF + V           + A+G GL GG+   PA F V T N   GAL  +I GPS+ K+DC +  +G   VTY P  PG Y + I      +I  SP+ A++            +  +   D L                    KV A G GL S     + ++F V+   AG+   +      V G   P +   ++      YS  Y  K  G++T++V +G+ +IP SP+++ V
Sbjct: 2165 DMTAQVTSPSGKTHEAEIVEGENH--TYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERA--EVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFE----DRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSG--DARRL--TVSSLQESGLKVNQPASFAVSLNGAKGA-IDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGY-RVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGL-SKAYVGQKSNFTVDCSKAGNNMLL----VGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          

HSP 4 Score: 91.6633 bits (226), Expect = 1.330e-17
Identity = 88/318 (27.67%), Postives = 134/318 (42.14%), Query Frame = 2
Query:  965 LELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA--GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAG-VQIQSSPF-------------------GVMVSSKTSNSDAKQAYATG-----------RGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV 1816
            L+  G  +  PA F V + N  KG +D  V +P G  E C + +    +  Y+  +IP   G Y I +KF  + IP SPFK+ V      GDP  V+A G G+E  G   G    F V T+ AG G++   I   +K + D       ++    + + YT    G + +++ + G   I  SPF                    V V S T  +   Q   +G           +G+      V   + F V    AG   L V V+GP    E+  +K +   LY  SY+ +  G Y + +K+G+  I  SP+ + V
Sbjct: 2332 LQESGLKVNQPASFAV-SLNGAKGAIDAKVHSPSGALEECYVTEIDQDK--YAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLE--GGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDC------QECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          

HSP 5 Score: 62.003 bits (149), Expect = 1.636e-8
Identity = 61/227 (26.87%), Postives = 94/227 (41.41%), Query Frame = 2
Query:  944 VRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANS-EIPNSPFKVNVKN----------------------------------AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENK-FLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMV 1516
            V AYG GLE  G   G+PA F V+T NAG G L + +  P   K  C+  + P     Y  +Y P   G Y I IK+     I  SPFK  V                                       D SKV A G G+      VG+++ F V  ++AG    + +++   G +   +  + K   ++ + + Y  K++G +++ V +    I  SP+ +MV
Sbjct: 2424 VSAYGAGLE--GGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQ--ECPE---GYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKA--YVGQKSNFTVDCSKAGN---NMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          
BLAST of Filamin vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 1162.13 bits (3005), Expect = 0.000e+0
Identity = 653/1512 (43.19%), Postives = 922/1512 (60.98%), Query Frame = 2
Query: 3212 NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAF---QPQEQYSI--ERTTHHYTTEQ--------SKPIIR------TEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXX---------XXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETK-----SLTQTV----HMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
             V   G GL +  A     F +D +    A L + I  E  + A++   D+GDGT ++ Y+P  PG+Y V + Y  + + + P  + + P         D + V  YGPG+   GVF+++ ++F+V+A+ +   G   VKA + NP    +   V +  DGTY   Y+P  +G H +D+TYDG PV  SP+ VPV +G DPSR+R +GPG++ G T +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+CSV+Y+P + G+Y +++ +    +PGSPF VP+HD+ D SKVKC GPGL     R   P  F VD SKAG APL+V V       V+P  ++  +  G   V Y+P   G+  I VLY   +VP SPF   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P  +     + ++ DGT+T  Y  DVPG YT+ + YG   +P SP+ V         +C + G  I   + +G+   I V+T+ AG G ++     P G+ V   +     G   + Y   + G Y + + F  E++PN   +  A    QP  Q  +  ++    Y   Q         +P++       T     D   P       +   V  PS +   P + +N DGT+TV+Y PSE+GLHE+++ Y+   I GSP +FYVD  +  G +TAYGPGL++G  +  A FT+ TKDAG GGLSLA+EGPSKAEI C DN++GTC VSYLP+ PGDY I +K+ D+HI GSPFTA++ G+   R S + VG+ +D+P+ ISETD++ L A V+ P+GREE C LKRL+NG++GISF PKE GEHLV+V ++G+H+ +SP  + + ++EIG+ASRV++ G GL++G   E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGSPF+V + G     + E I R + A  V+ IG+ C+L+L IP  + ++ TA V SPSG     EI+   ++ + IRF+P E+G+HTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER       +F I+TREAGAG L+IA+EGPSKAEI F+D KDGSCGV Y V EPGDY  S+KFN+EH+P SPF++     P +S S           D+R +++++LQ+ G  +   A+F ++ +G   G+I A V SPS   +   +++ID ++Y+V F+P ENGI+ + V  N + IPGSPF++ VGE         V+  G G+  G TG   EF V+TSNAG GAL+VTIDGPSKV+++CQE   GY  TY P APG Y ISIKYGG  HI GSPF   ++G    SN S+ ET      SLT+      H  SG    GP+    V  +G GL  A +G+++ F VD   AG ++L VGV GP  PCEE+ +KH+G+  + V+Y +++KG + L+V+WG+  +PGSP+ I+VP
Sbjct: 1162 KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAV-------DTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKV-QGPKGLVEPVDVVDNAD-GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVD-YVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTG--EGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVV-----PVASPS----------GDARRLTVSSLQESGLKVNQPASFAVSLNG-AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGP---GPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMVP 2639          

HSP 2 Score: 1047.34 bits (2707), Expect = 0.000e+0
Identity = 822/2607 (31.53%), Postives = 1245/2607 (47.76%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTH-KRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP-YKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGS---KVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETET--PLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNEK-------------AELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP-QKFTVDLEGAGQGG---LGLSIEGPA----DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----------GEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRT-EYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKF--------YVDSTIPSGQ---------------------VTAYGPGLSYGRP-DMHAHFTIVTKDAGAGGLSLAVEGPSK--AEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF--------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIEC--HDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCE-LNLII----PGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQ--FTIYTREAGAGSLSIAIEGPSKA--EIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTG----RINE--FFVDTSNAGNGALTVTIDGPSKVQLNC---QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  +  I +LQ DL+DGL+LI L++ LS       H +RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W+ E+  +   Q    +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A++ L +  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   +S  Y+P + G +++ + FA   I  SPF+V V  + GD SKVTA GPG+EP GN   + T+F +FTA AG G V+ VI D  G+K +V+P++  + ++ +   Y    EG+H+V+V FAGV I  SP+ V V    + +  +   A GRG+QP+GVRV++ A+F+V+T+ AG  +L V V GP +  E+ + K +   +Y   Y P  PG Y V I +G   I  SPF V V       K++A+GPGL GGIV K A F VE  G + G LGFS++GPS+AKI+C D GDGS +V YWP   GEYAVH+LC+ E+I  SP+MA I+   + F P +V A GPGL  +G++ NKPA+F V+ K+AG  + ++ +  D  G ++   ++DN +GTYSC Y P+ P KHT +VS+G V+IP SPF+VNV    +   +KVYGPG+ +   K +  TYF VDC  AG GD+ I +          E   D  ++ +DN   T            +YTI + F++   P SP +V +E  +D  K K     LN T   +G+   F +     G     V+   + K      V + +   +N +   + P   GP  V V   G+ I  SP+ V  +  ++  +   +     + +  D     K+         ++K+     + V     P     N    F P EE  Y V+ T +              A  +   V A+G GL  G A +PA F ID+       LG+T+EGP EA+++ +DNGDGTCSV+Y+P EPG Y +N+L+ D HI  SPF   + P         D +KV   GPGL           +F V+       G   +   I +     +   + ++ DGT++ +Y P   G + + I Y G PV   P  + V    D S ++ YGPG+E +G+ ++   +F+VD     Q G   +   +  P+    D  +Q  D  DGT  V+Y P + G + V + ++   +P SPF VP+ +  D S+V+ +GPG++   +    P++FTV+   A          G +  K++ +D                 G   V YIP   G   + V Y   QVPGSPF   V +  +  KV  +G G+ P  G + AN +P  F ++T  AG + L++ V GP      +DV ++ DGT T  Y     G+Y++ VLYG + VP SPF V V       +    GP LN   VP    V   ++ ++AG+G+L+ +   P G      I++   G  TV+YVP   G Y + + +  + IP    R  A       + + +    T     P I+  E +V+               V     +  DV  ++ N DGT  + Y   + G + + V + G+ +  SPF+          V + + S Q                     V   G  ++  RP D+   FTI       G ++  V  PS   A+    DNK+GT  V Y P   G + + I++ + HI GSP            I       +   V   +   +   +     L+  +  P+  E SCT    Q+G   +S+ P   G++ + V  + +HIP SPF   V  ++    S +K          V       ++        L+ ++  PS  E  C      +G   +++ P E G ++++VK    +V  SP  V I    S S      R + + +    G+  E    II     GY     + S+  PS      E   L D    + + P E G + +++K  ++HV GSPF   V      G  K  I        +AN  +    ++   E     ++  +  PS    E +  + ++ +  + +   E G +  S+K+  +HVPGSPF   +   P                 +  +       +   +G  A F I       G ++  V  PS  E   S     +    V +V  E G + V V  N   IP SPF V V   +     +          ++N+   F  + N   GA+   +  PS     C   + ++  Y   ++P   G Y I +K+ G  HI GSPF + +    +  +                          P  V   G GL+    G   EFIV+   AG   L V + GP +    C+E          ++V Y     G +L+ +++G  + + GSPF+  V
Sbjct:   32 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQ----TPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACR---AIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGK-APLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTV---KYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDI-IDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAP-------CFDASKVKCSGPGLE--RATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQ--DCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTN--KPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKD--------------GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRAN-LPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVP-----TGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDV-DVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTI-----KKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDN--QDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLK----------VGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVI----SQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYG--GLSLSIEGPSKVDINTE--DLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV---TGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAE--ISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNG-THIPGSPFKIRVGEPGHGGD--------------------------PGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQEC------PEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV 2508          

HSP 3 Score: 150.599 bits (379), Expect = 1.821e-35
Identity = 138/493 (27.99%), Postives = 219/493 (44.42%), Query Frame = 2
Query: 1037 NLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKN-AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESK----IKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHI-LCDDENIPKSPYMAQI------------QLDTKLFDPL--------------------KVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQ---IRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV 2389
            ++   V +P G+    EI +  N    Y   ++P   G + + +K+    +P SPF+  V     G   KV A GPG+E    EVG    F ++T EAG G +   +      + S +     + +    + Y  +E G + V+V F    I  SPF V V+S +   DA++   T   +Q  G++V   A F V    A  A +   V+ P  +LE+C + ++    Y   +IP+  G Y++D+K+    I  SPF + V           + A+G GL GG+   PA F V T N   GAL  +I GPS+ K+DC +  +G   VTY P  PG Y + I      +I  SP+ A++            +  +   D L                    KV A G GL S     + ++F V+   AG+   +      V G   P +   ++      YS  Y  K  G++T++V +G+ +IP SP+++ V
Sbjct: 2165 DMTAQVTSPSGKTHEAEIVEGENH--TYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERA--EVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFE----DRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSG--DARRL--TVSSLQESGLKVNQPASFAVSLNGAKGA-IDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGY-RVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGL-SKAYVGQKSNFTVDCSKAGNNMLL----VGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          

HSP 4 Score: 91.6633 bits (226), Expect = 1.330e-17
Identity = 88/318 (27.67%), Postives = 134/318 (42.14%), Query Frame = 2
Query:  965 LELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA--GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAG-VQIQSSPF-------------------GVMVSSKTSNSDAKQAYATG-----------RGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV 1816
            L+  G  +  PA F V + N  KG +D  V +P G  E C + +    +  Y+  +IP   G Y I +KF  + IP SPFK+ V      GDP  V+A G G+E  G   G    F V T+ AG G++   I   +K + D       ++    + + YT    G + +++ + G   I  SPF                    V V S T  +   Q   +G           +G+      V   + F V    AG   L V V+GP    E+  +K +   LY  SY+ +  G Y + +K+G+  I  SP+ + V
Sbjct: 2332 LQESGLKVNQPASFAV-SLNGAKGAIDAKVHSPSGALEECYVTEIDQDK--YAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLE--GGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDC------QECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          

HSP 5 Score: 62.003 bits (149), Expect = 1.636e-8
Identity = 61/227 (26.87%), Postives = 94/227 (41.41%), Query Frame = 2
Query:  944 VRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANS-EIPNSPFKVNVKN----------------------------------AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENK-FLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMV 1516
            V AYG GLE  G   G+PA F V+T NAG G L + +  P   K  C+  + P     Y  +Y P   G Y I IK+     I  SPFK  V                                       D SKV A G G+      VG+++ F V  ++AG    + +++   G +   +  + K   ++ + + Y  K++G +++ V +    I  SP+ +MV
Sbjct: 2424 VSAYGAGLE--GGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQ--ECPE---GYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKA--YVGQKSNFTVDCSKAGN---NMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          
BLAST of Filamin vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 1159.05 bits (2997), Expect = 0.000e+0
Identity = 650/1493 (43.54%), Postives = 915/1493 (61.29%), Query Frame = 2
Query: 3212 NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXX---------XXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETK-----SLTQTV----HMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
             V   G GL +  A     F +D +    A L + I  E  + A++   D+GDGT ++ Y+P  PG+Y V + Y  + + + P  + + P         D + V  YGPG+   GVF+++ ++F+V+A+ +   G   VKA + NP    +   V +  DGTY   Y+P  +G H +D+TYDG PV  SP+ VPV +G DPSR+R +GPG++ G T +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+CSV+Y+P + G+Y +++ +    +PGSPF VP+HD+ D SKVKC GPGL     R   P  F VD SKAG APL+V V       V+P  ++  +  G   V Y+P   G+  I VLY   +VP SPF   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P  +     + ++ DGT+T  Y  DVPG YT+ + YG   +P SP+ V         +C + G  I   + +G+   I V+T+ AG G ++     P G+ V   +     G   + Y   + G Y + + F  E++PN            Q +I               +R    V+ F    G +   VR     PS +   P + +N DGT+TV+Y PSE+GLHE+++ Y+   I GSP +FYVD  +  G +TAYGPGL++G  +  A FT+ TKDAG GGLSLA+EGPSKAEI C DN++GTC VSYLP+ PGDY I +K+ D+HI GSPFTA++ G+   R S + VG+ +D+P+ ISETD++ L A V+ P+GREE C LKRL+NG++GISF PKE GEHLV+V ++G+H+ +SP  + + ++EIG+ASRV++ G GL++G   E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGSPF+V + G     + E I R + A  V+ IG+ C+L+L IP  + ++ TA V SPSG     EI+   ++ + IRF+P E+G+HTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER       +F I+TREAGAG L+IA+EGPSKAEI F+D KDGSCGV Y V EPGDY  S+KFN+EH+P SPF++     P +S S           D+R +++++LQ+ G  +   A+F ++ +G   G+I A V SPS   +   +++ID ++Y+V F+P ENGI+ + V  N + IPGSPF++ VGE         V+  G G+  G TG   EF V+TSNAG GAL+VTIDGPSKV+++CQE   GY  TY P APG Y ISIKYGG  HI GSPF   ++G    SN S+ ET      SLT+      H  SG    GP+    V  +G GL  A +G+++ F VD   AG ++L VGV GP  PCEE+ +KH+G+  + V+Y +++KG + L+V+WG+  +PGSP+ I+VP
Sbjct: 1138 KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAV-------DTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKV-QGPKGLVEPVDVVDNAD-GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPF---------QVTIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRM----PSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVD-YVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTG--EGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVV-----PVASPS----------GDARRLTVSSLQESGLKVNQPASFAVSLNG-AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGP---GPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMVP 2583          

HSP 2 Score: 1057.74 bits (2734), Expect = 0.000e+0
Identity = 822/2579 (31.87%), Postives = 1243/2579 (48.20%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTH-KRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVA-PYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGS---KVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETET--PLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNEK-------------AELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP-QKFTVDLEGAGQGG---LGLSIEGPA----DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----------GEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRT-EYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSG-QVTAYGPGLSYGRP-DMHAHFTIVTKDAGAGGLSLAVEGPSK--AEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF--------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIEC--HDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCE-LNLII----PGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQ--FTIYTREAGAGSLSIAIEGPSKA--EIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTG----RINE--FFVDTSNAGNGALTVTIDGPSKVQLNC---QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  +  I +LQ DL+DGL+LI L++ LS       H +RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W+ E+  +   Q    +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A++ L +  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   +S  Y+P + G +++ + FA   I  SPF+V V  + GD SKVTA GPG+EP GN   + T+F +FTA AG G V+ VI D  G+K +V+P++  + ++ +   Y    EG+H+V+V FAGV I  SP+ V V    + +  +   A GRG+QP+GVRV++ A+F+V+T+ AG  +L V V GP +  E+ + K +   +Y   Y P  PG Y V I +G   I  SPF V V       K++A+GPGL GGIV K A F VE  G + G LGFS++GPS+AKI+C D GDGS +V YWP   GEYAVH+LC+ E+I  SP+MA I+   + F P +V A GPGL  +G++ NKPA+F V+ K+AG  + ++ +  D  G ++   ++DN +GTYSC Y P+ P KHT +VS+G V+IP SPF+VNV    +   +KVYGPG+ +   K +  TYF VDC  AG GD+ I +          E   D  ++ +DN   T            +YTI + F++   P SP +V +E  +D  K K     LN T   +G+   F +     G     V+   + K      V + +   +N +   + P   GP  V V   G+ I  SP+ V  +  ++  +   +     + +  D     K+         ++K+     + V     P     N    F P EE  Y V+ T +              A  +   V A+G GL  G A +PA F ID+       LG+T+EGP EA+++ +DNGDGTCSV+Y+P EPG Y +N+L+ D HI  SPF   + P         D +KV   GPGL           +F V+       G   +   I +     +   + ++ DGT++ +Y P   G + + I Y G PV   P  + V    D S ++ YGPG+E +G+ ++   +F+VD     Q G   +   +  P+    D  +Q  D  DGT  V+Y P + G + V + ++   +P SPF VP+ +  D S+V+ +GPG++   +    P++FTV+   A          G +  K++ +D    S                V YIP   G   + V Y   QVPGSPF   V +  +  KV  +G G+ P  G + AN +P  F ++T  AG + L++ V GP      +DV ++ DGT T  Y     G+Y++ VLYG + VP SPF V V       +    GP LN   VP    V   ++ ++AG+G+L+ +   P G      I++   G  TV+YVP   G Y + + +  + IP    R  A       + + +    T     P I+  E +V+               V     +  DV  ++ N DGT  + Y   + G + + V + G+ +  SPF+     TIP    V   G  ++  RP D+   FTI       G ++  V  PS   A+    DNK+GT  V Y P   G + + I++ + HI GSP            I       +   V   +   +   +     L+  +  P+  E SCT    Q+G   +S+ P   G++ + V  + +HIP SPF   V  ++    S +K          V       ++        L+ ++  PS  E  C      +G   +++ P E G ++++VK    +V  SP  V I    S S      R + + +    G+  E    II     GY     + S+  PS      E   L D    + + P E G + +++K  ++HV GSPF   V      G  K  I        +AN  +    ++   E     ++  +  PS    E +  + ++ +  + +   E G +  S+K+  +HVPGSPF   +   P                 +  +       +   +G  A F I       G ++  V  PS  E   S     +    V +V  E G + V V  N   IP SPF V V   +     +          ++N+   F  + N   GA+   +  PS     C   + ++  Y   ++P   G Y I +K+ G  HI GSPF + +    +  +                          P  V   G GL+    G   EFIV+   AG   L V + GP +    C+E          ++V Y     G +L+ +++G  + + GSPF+  V
Sbjct:    8 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQ----TPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACR---AIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGK-APLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTV---KYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDI-IDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAP-------CFDASKVKCSGPGLE--RATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQ--DCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTN--KPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCS--------------VEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRAN-LPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVP-----TGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDV-DVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQV----TIPERPMVGVNGLDVTSLRPFDLVIPFTI-----KKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDN--QDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLK----------VGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVI----SQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYG--GLSLSIEGPSKVDINTE--DLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV---TGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAE--ISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNG-THIPGSPFKIRVGEPGHGGD--------------------------PGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQEC------PEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV 2452          

HSP 3 Score: 182.956 bits (463), Expect = 3.347e-45
Identity = 211/838 (25.18%), Postives = 349/838 (41.65%), Query Frame = 2
Query: 5276 QVTAYGPGL--SYGRPDMHAHFTIVTKDAGAGGLSLAVEGPS----KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICV------------GTTSDVPLRISETDINNLNAIVISPTGREESC--TLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDG--MVNETCQFVVDTRNAGYGGLSLSIEGPSKVE-IECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPL-IDGGPHKVHIMGSGVER-GLA-NDANQFTIYTREAGAGSLSIAI---EGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDE----NPYSSYSKPVKNENIIFNDSRYISIAALQ-DQG-FNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG--------HTGRINEFFVDTSNAGNGALTVTIDGPSKVQLN-----CQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGD----VLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPF--EIVVPN 7627
            +  AYGPG+  +       A FT+ T+ AG G + + VE P+    +A++   ++KN T  V Y+P   G + + + F  +HI  SPF   +       S++                T+   +  +   +  +  ++  PTG++ +    L+   +     S+ P   G H V+V  +G  IP SP+ + VG+    N +  +  G GL      V ET  F V T+ AG G L ++++GP   E ++  D  DG     Y PT PGTY + + +   N+  SPF V +G   +    +++       E   +G   +  +   G +      SV  PS +   C+     D    +R+ P+E G + V V  ++  +  SPF   +     D  P +V   G G+E+ G+A N   +FT+  + AG   L + +   EG S  E   +DN +G+   +Y   +P  +   + +    +P SPF + +      N    Y   V    +  ++  Y ++   +  QG  +IG K               +  V+ P+  +    I + DN+ ++V + P   G + + VL  +   P SP RV V     + +    G          G+   F V+   AG G L V   G +K            +++ Y   Y+P   G   +++ YGG +HI  SPF V +S        S+  +K                      +K  G G KV ++GK  EF V +  AGG        V  SG   PC+      LG +   V +  +E+G + + V +    VPGSPF  E V P 
Sbjct:  259 KARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQ--ACNPAACRAIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVG---TECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECD--DKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCS-VEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKC--------------APGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGG-DHIPKSPFSVGVS-------PSLDLSK----------------------IKVSGLGDKV-DVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVE--PGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPT 1041          

HSP 4 Score: 150.599 bits (379), Expect = 1.901e-35
Identity = 138/488 (28.28%), Postives = 217/488 (44.47%), Query Frame = 2
Query: 1052 VLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKN-AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESK----IKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHI-LCDDENIPKSPYMAQI------------QLDTKLFDPL--------------------KVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQ---IRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV 2389
            V +P G+    EI +  N    Y   ++P   G + + +K+    +P SPF+  V     G   KV A GPG+E    EVG    F ++T EAG G +   +      + S +     + +    + Y  +E G + V+V F    I  SPF V V+S +   DA++   T   +Q  G++V   A F V    A  A +   V+ P  +LE+C + ++    Y   +IP+  G Y++D+K+    I  SPF + V           + A+G GL GG+   PA F V T N   GAL  +I GPS+ K+DC +  +G   VTY P  PG Y + I      +I  SP+ A++            +  +   D L                    KV A G GL S     + ++F V+   AG+   +      V G   P +   ++      YS  Y  K  G++T++V +G+ +IP SP+++ V
Sbjct: 2114 VTSPSGKTHEAEIVEGENH--TYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERA--EVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFE----DRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSG--DARRL--TVSSLQESGLKVNQPASFAVSLNGAKGA-IDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGY-RVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGL-SKAYVGQKSNFTVDCSKAGNNMLL----VGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2582          

HSP 5 Score: 91.6633 bits (226), Expect = 1.381e-17
Identity = 88/318 (27.67%), Postives = 134/318 (42.14%), Query Frame = 2
Query:  965 LELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA--GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAG-VQIQSSPF-------------------GVMVSSKTSNSDAKQAYATG-----------RGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV 1816
            L+  G  +  PA F V + N  KG +D  V +P G  E C + +    +  Y+  +IP   G Y I +KF  + IP SPFK+ V      GDP  V+A G G+E  G   G    F V T+ AG G++   I   +K + D       ++    + + YT    G + +++ + G   I  SPF                    V V S T  +   Q   +G           +G+      V   + F V    AG   L V V+GP    E+  +K +   LY  SY+ +  G Y + +K+G+  I  SP+ + V
Sbjct: 2276 LQESGLKVNQPASFAV-SLNGAKGAIDAKVHSPSGALEECYVTEIDQDK--YAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLE--GGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDC------QECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2582          

HSP 6 Score: 61.6178 bits (148), Expect = 1.731e-8
Identity = 61/227 (26.87%), Postives = 94/227 (41.41%), Query Frame = 2
Query:  944 VRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANS-EIPNSPFKVNVKN----------------------------------AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENK-FLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMV 1516
            V AYG GLE  G   G+PA F V+T NAG G L + +  P   K  C+  + P     Y  +Y P   G Y I IK+     I  SPFK  V                                       D SKV A G G+      VG+++ F V  ++AG    + +++   G +   +  + K   ++ + + Y  K++G +++ V +    I  SP+ +MV
Sbjct: 2368 VSAYGAGLE--GGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQ--ECPE---GYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKA--YVGQKSNFTVDCSKAGN---NMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2582          
BLAST of Filamin vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 1156.35 bits (2990), Expect = 0.000e+0
Identity = 652/1520 (42.89%), Postives = 921/1520 (60.59%), Query Frame = 2
Query: 3212 NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE---------VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAF---QPQEQYSI--ERTTHHYTTEQ--------SKPIIR------TEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXX---------XXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETK-----SLTQTV----HMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
             V   G GL +  A     F +D +    A L + I  E  + A++   D+GDGT ++ Y+P  PG+Y V + Y  + + + P  + + P         D + V  YGPG+   GVF+++ ++F+V+A+ +   G   VKA + NP    +   V +  DGTY   Y+P  +G H +D+TYDG PV  SP+ VPV +G DPSR+R +GPG++ G T +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+CSV+Y+P + G+Y +++ +    +PGSPF VP+HD+ D SKVKC GPGL     R   P  F VD SKAG APL+V V       V+P  ++  +  G   V Y+P   G+  I VLY   +VP SPF   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P  +     + ++ DGT+T  Y  DVPG YT+ + YG   +P SP+ V         +C +   I            + +G+   I V+T+ AG G ++     P G+ V   +     G   + Y   + G Y + + F  E++PN   +  A    QP  Q  +  ++    Y   Q         +P++       T     D   P       +   V  PS +   P + +N DGT+TV+Y PSE+GLHE+++ Y+   I GSP +FYVD  +  G +TAYGPGL++G  +  A FT+ TKDAG GGLSLA+EGPSKAEI C DN++GTC VSYLP+ PGDY I +K+ D+HI GSPFTA++ G+   R S + VG+ +D+P+ ISETD++ L A V+ P+GREE C LKRL+NG++GISF PKE GEHLV+V ++G+H+ +SP  + + ++EIG+ASRV++ G GL++G   E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGSPF+V + G     + E I R + A  V+ IG+ C+L+L IP  + ++ TA V SPSG     EI+   ++ + IRF+P E+G+HTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER       +F I+TREAGAG L+IA+EGPSKAEI F+D KDGSCGV Y V EPGDY  S+KFN+EH+P SPF++     P +S S           D+R +++++LQ+ G  +   A+F ++ +G   G+I A V SPS   +   +++ID ++Y+V F+P ENGI+ + V  N + IPGSPF++ VGE         V+  G G+  G TG   EF V+TSNAG GAL+VTIDGPSKV+++CQE   GY  TY P APG Y ISIKYGG  HI GSPF   ++G    SN S+ ET      SLT+      H  SG    GP+    V  +G GL  A +G+++ F VD   AG ++L VGV GP  PCEE+ +KH+G+  + V+Y +++KG + L+V+WG+  +PGSP+ I+VP
Sbjct: 1162 KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAV-------DTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKV-QGPKGLVEPVDVVDNAD-GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVD-YVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTG--EGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVV-----PVASPS----------GDARRLTVSSLQESGLKVNQPASFAVSLNG-AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGP---GPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMVP 2647          

HSP 2 Score: 1047.73 bits (2708), Expect = 0.000e+0
Identity = 823/2610 (31.53%), Postives = 1244/2610 (47.66%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTH-KRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP-YKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGS---KVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETET--PLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNEK-------------AELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP-QKFTVDLEGAGQGG---LGLSIEGPA----DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----------GEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTH---HYTTEQSKPIIRT-EYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKF--------YVDSTIPSGQ---------------------VTAYGPGLSYGRP-DMHAHFTIVTKDAGAGGLSLAVEGPSK--AEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF--------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIEC--HDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCE-LNLII----PGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQ--FTIYTREAGAGSLSIAIEGPSKA--EIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTG----RINE--FFVDTSNAGNGALTVTIDGPSKVQLNC---QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  +  I +LQ DL+DGL+LI L++ LS       H +RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W+ E+  +   Q    +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A++ L +  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   +S  Y+P + G +++ + FA   I  SPF+V V  + GD SKVTA GPG+EP GN   + T+F +FTA AG G V+ VI D  G+K +V+P++  + ++ +   Y    EG+H+V+V FAGV I  SP+ V V    + +  +   A GRG+QP+GVRV++ A+F+V+T+ AG  +L V V GP +  E+ + K +   +Y   Y P  PG Y V I +G   I  SPF V V       K++A+GPGL GGIV K A F VE  G + G LGFS++GPS+AKI+C D GDGS +V YWP   GEYAVH+LC+ E+I  SP+MA I+   + F P +V A GPGL  +G++ NKPA+F V+ K+AG  + ++ +  D  G ++   ++DN +GTYSC Y P+ P KHT +VS+G V+IP SPF+VNV    +   +KVYGPG+ +   K +  TYF VDC  AG GD+ I +          E   D  ++ +DN   T            +YTI + F++   P SP +V +E  +D  K K     LN T   +G+   F +     G     V+   + K      V + +   +N +   + P   GP  V V   G+ I  SP+ V  +  ++  +   +     + +  D     K+         ++K+     + V     P     N    F P EE  Y V+ T +              A  +   V A+G GL  G A +PA F ID+       LG+T+EGP EA+++ +DNGDGTCSV+Y+P EPG Y +N+L+ D HI  SPF   + P         D +KV   GPGL           +F V+       G   +   I +     +   + ++ DGT++ +Y P   G + + I Y G PV   P  + V    D S ++ YGPG+E +G+ ++   +F+VD     Q G   +   +  P+    D  +Q  D  DGT  V+Y P + G + V + ++   +P SPF VP+ +  D S+V+ +GPG++   +    P++FTV+   A          G +  K++ +D                 G   V YIP   G   + V Y   QVPGSPF   V +  +  KV  +G G+ P  G + AN +P  F ++T  AG + L++ V GP      +DV ++ DGT T  Y     G+Y++ VLYG + VP SPF V V       +    GP LN   VP    V   ++ ++AG+G+L+ +   P G      I++   G  TV+YVP   G Y + + +  + IP    R  A    +      T     H       P I+  E +V+               V     +  DV  ++ N DGT  + Y   + G + + V + G+ +  SPF+          V + + S Q                     V   G  ++  RP D+   FTI       G ++  V  PS   A+    DNK+GT  V Y P   G + + I++ + HI GSP            I       +   V   +   +   +     L+  +  P+  E SCT    Q+G   +S+ P   G++ + V  + +HIP SPF   V  ++    S +K          V       ++        L+ ++  PS  E  C      +G   +++ P E G ++++VK    +V  SP  V I    S S      R + + +    G+  E    II     GY     + S+  PS      E   L D    + + P E G + +++K  ++HV GSPF   V      G  K  I        +AN  +    ++   E     ++  +  PS    E +  + ++ +  + +   E G +  S+K+  +HVPGSPF   +   P                 +  +       +   +G  A F I       G ++  V  PS  E   S     +    V +V  E G + V V  N   IP SPF V V   +     +          ++N+   F  + N   GA+   +  PS     C   + ++  Y   ++P   G Y I +K+ G  HI GSPF + +    +  +                          P  V   G GL+    G   EFIV+   AG   L V + GP +    C+E          ++V Y     G +L+ +++G  + + GSPF+  V
Sbjct:   32 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQ----TPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACR---AIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGK-APLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTV---KYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDI-IDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAP-------CFDASKVKCSGPGLE--RATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQ--DCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTN--KPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKD--------------GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRAN-LPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDV-DVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTI-----KKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDN--QDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLK----------VGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVI----SQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYG--GLSLSIEGPSKVDINTE--DLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV---TGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAE--ISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNG-THIPGSPFKIRVGEPGHGGD--------------------------PGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQEC------PEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV 2516          

HSP 3 Score: 92.0485 bits (227), Expect = 1.308e-17
Identity = 88/318 (27.67%), Postives = 134/318 (42.14%), Query Frame = 2
Query:  965 LELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA--GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAG-VQIQSSPF-------------------GVMVSSKTSNSDAKQAYATG-----------RGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV 1816
            L+  G  +  PA F V + N  KG +D  V +P G  E C + +    +  Y+  +IP   G Y I +KF  + IP SPFK+ V      GDP  V+A G G+E  G   G    F V T+ AG G++   I   +K + D       ++    + + YT    G + +++ + G   I  SPF                    V V S T  +   Q   +G           +G+      V   + F V    AG   L V V+GP    E+  +K +   LY  SY+ +  G Y + +K+G+  I  SP+ + V
Sbjct: 2340 LQESGLKVNQPASFAV-SLNGAKGAIDAKVHSPSGALEECYVTEIDQDK--YAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLE--GGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMD------CQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2646          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|Q80X90|FLNB_MOUSE (Filamin-B OS=Mus musculus OX=10090 GN=Flnb PE=1 SV=3)

HSP 1 Score: 1340.87 bits (3469), Expect = 0.000e+0
Identity = 869/2335 (37.22%), Postives = 1250/2335 (53.53%), Query Frame = 2
Query:  842 PKVD--EKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP----YKESKIKAFGPGL--TGGIVSKPAFFEVETNGETGALGFSIKGPSEAK---IDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPST-----VKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS----VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQET--NNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSV------------VDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX---------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGST-----QKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            PKV    K ++ +  Q  +           + ++ +V A GPGLE  GN    P  F + T  AG G++ I V +P+G K   E+         Y C Y P   G + + + FA   IP SPF V +  A  +P+   ASG G++P G  +     F V T  AG G +   +   KG ++ VK K     +  +  EY     G +SV V + G  I  SPF V V  +   +  ++  A G G+   G  V   A+F V +  +    LG  + GP ++  +   +    C  +  Y P+ PG Y V I   +  I  SP+   + P    Y    ++A+GPGL  +G  ++ PA F V+      A    +    E +   I      DG+   +Y P    ++ + ++    NIP SPY   I   +    P KV  +GPG+  SG+  N+P  F V+   AG           A       + +   I  N + T++ +Y P  PG++T+ V + +  IP SPF+V V  + +A+ +K  GPG+ +A  +    T+F V  K AG   + +     +  E ++D+ ++  DN D + T+KYTP   G    + + +    IP+SPF V + +  D  K KIN L N   +G+  EF I T   G + + ++ + SP+   VP  +          A F P   G   V V   G+P+  SPY V A+   D    K + P  E  L+   A++ ID K        +      P E + ++   N +   S ++ P +   Y V    E         KA++  P     V A G GL  G    P    +D +E  P  LG+    +   +A++   +N DGT +V Y+P   G Y + + Y  E +   P  V + P         D + + A+GPG+    VF+++ + FTV+++P+   G   +KA ITNP    + C V +N DGTY   Y+P   G H +++TYD VP+  SP+ V V +G  PSR+ A GPGL+E  T +   FTV   GAG GGLG+++EGP++++I C DNKDG+CS +Y+P  PG YDV+I +   HIPGSPF VP  D+VD SKVK  GPGL  +  R   P  FTVD+SKAG APL+V V+      V+P  ++     G   VTY P   G   + V Y + ++P SPF   VL + +  KV  +G G+     + +   +P  F I+ RDAGE  L + +T    +     V ++ DGT+   Y  D  G Y + V YG  N+P SP+ +         +C   GP I   V  G+ V   V+ + AG G ++   + P G      +     G   + Y   K G Y + + F   +IPN      A    E  ++E    +      +P +  E  V             D   P       +   V+ PS +K  P +++N DGT+TV+Y P+E GLHE+ + Y G  I  SP +FYV+    SG V+AYGPGL YG  +  A FTIVT+DAG GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY I +K+ DKHI GSPFTAKI  + ++ SQ+ +G+ +D  L ISETD++ L A + +P+GR+E C LKRL N ++GISF P+EVGEHLV++ ++G H+ NSP  I V ++EIG+A R K+YG GL++G   E   F+VDTR+AGYGG+SL++EGPSKV+I+  D  DGTC V+Y PT PG YI++ K+AD +VPGSPF V I G     + E I R   A  V+ +G++C+LNL IP  N  + +A V SPSG     EI+ +  N   +RF+P+E+GVHTVSVK   +HVTGSPFQFTVGPL +GG HKV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F D+K+GSCGV+Y   EPG+Y  SIKFNDEH+P SP+++            PV   +   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +S+++ ++Y+V F+P ENGIH + V  N S + GSPF+V V           V+  G G+  G TG  +EFF++T+ AG G L+VTI+GPSKV+++CQE   GY   Y P APG+Y I +KYGG NHI  SPF   ++G    S  S  ET S L ++V   S  T      K  S    V  +G GL  A +G+++ F+VD   AG ++L +GV GP  PCEEV++KH+G  ++ V Y V+E+G ++L V+WG   +PGSPF + VP
Sbjct:  321 PKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQG-KNSVELLVEDRGNQVYRCVYKPVQPGPHVVKVSFAGDAIPKSPFGVQIGEAC-NPNACRASGRGLQPKGVRIRETADFKVDTKAAGSGELGVTVKGPKGLEELVKQK--GFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGPE---AGMQKVRAWGPGLH--GGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQNDGSC--DVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGSH---PQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGEAVKDLDII--DNYDYSHTVKYTPTQQGNMQVL-VTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGKDQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGG--LGLTVEGPCE-AKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPAWVKVEPAI-------DTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLS-SCVRACIPQSFTVDSSKAGLAPLEVRVLG-PRGLVEPVNVVDNGD-GTHTVTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLS---AYGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATD-GEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESPLQFYVNYP-NSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISG--EGRVRESITRTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLV------------PVIAPS---DDARCLTVLSLQESGLKVNQPASFAIRLNG-AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTGIQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEIPEGYKVMYTPMAPGNYLIGVKYGGPNHISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP 2602          

HSP 2 Score: 1080.86 bits (2794), Expect = 0.000e+0
Identity = 854/2602 (32.82%), Postives = 1248/2602 (47.96%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHT-HKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK-ESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNT---TPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAID-NKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQR----SNFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE--EGITKQPQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLER---NGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYS---VVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVD----STIPSGQVTAYGPGLSYGRP-----------DMHAH----FTIVTKDA-GAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVG---------TTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLII-----PGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLA----NDANQFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRX---XXXXXXXXXXXIHHGHTG-RINE--FFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWG--NHDVPGSPFEIVV 7621
            + E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS     H  H+RP FR  KLENV++ L FL+  E ++LV+IDS  I D  LKLILGL+WTLILHYSI+MP+WE    ++ D   K  +PKQRLLGWI +K+P+ P+ NF  +W DG A+GALVD+CAPGLCP+W  WDP++ + NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +  PA FTVDT +AG+G++ + V +P+G KE   +    +K   YS  Y+P + G +++I+ FA   I  SPF+VNV  A GD SKVTA GPG+E  GN   + T+F+++TA AG G +   + D +G K+SV+  +  +    +   Y   + G H V V FAG  I  SPFGV +  +  N +A    A+GRG+QP+GVR+R+ A+F+V T+ AG  +LGV V GP    E  + K     +Y   Y P  PG Y V + +G + I  SPF V V P     K++A+GPGL GGIV + A F VE+ G E G LGF+I+GPS+AKI+  D  DGS +V YWP  PGEYAVHI+CDDE+I  SPYMA I   T  ++P  V AYGPGL  SG + N PA+FIV+ K+AGS + +K    D  GQ I +Q++   DGTY+C YTP    KHT+ V +G VNIP SP++VN+ +  +   +KV+GPG+ER+  K N  T+F VDC  AG GD+ +       VL +   DV      N + TF            YTI++ F+  EIP SPF+V ++  +D  K K      +      G+   F + T   G K    +   SP        L   +N        +TPT  G   V V   G+PI  SP+ V     ++  +      E    +    ++AID N A  +  + V    L+P  R  V     P   R    + F P EE ++ V  T +           E   P     V A+G GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP +PG Y VN+L+ + HI  SPF   I           D +KV A GPGL    V +        +       G G +     +    ++  ++ NN DGTY+ +Y P   G + + + Y G  V   P +V V    D S I+A+GPG+E  +   +    FTVD   L   G   +   I  P+ A  +CF  DN DGT  V+Y P + G + V + +++  IP SPF V + +    S+V   GPGL+    N S V     FTV    AG   L + V   +   +        +  G     YIP   G+ ++ + Y  + +PGSPF     +  +P KV + G G+       +   +P  FT+++  AG + LE+ V GP      ++V ++GDGT T  Y     G Y V V Y ++ +P SPF V V       +    GP L+   VP    V   ++ ++AG+G+L+ +     G     ++ + + G   V+Y+P K G Y + + +  +NIP    R  A Q     + + +    T     P ++T      VVD K         V  V+  P   +    +I N DGT  + Y  ++ G + + V + G  I  SPF         + +    V A  PG    RP           DM+      F +V   A   G ++  V  PS  KA  + +DNK+GT  V Y P   G + + IK+   HI  SP    +   P   S    G          T+   +   +     L+  +  P+  E SC   +  +G   +++ P   G++ + V  + +HIP SPF   + ++     S+VKL               F++D        L+ SI+ PS  +  C      +NH G   +++ P E G +++++K   ++V  SP ++ +            +  Q  +E    G   E++  I      GY     + +V  PS      E   L D    + + P   GV+ VS K  + HV GSPF   +      G  +V    +   R  A           +   E  +  +S  +  PS    +AEI     K+  C V +   E G +  S+K+  +HV GSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     N    V ++  E G + V +  N+  IP SP+ V      +       +    +G ++N+   F    N   G +   +  PS     C  +E     Y   ++P+  G +TI +K+ G +H++GSPF V +       N                          P  V   G GL+    G ++EF ++   AG   L V + GP +    C+E+         ++V Y     G +L+ V++G  NH +  SPF+  V
Sbjct:    3 VTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMHHKYHQRPTFRQMKLENVSVALEFLDH-ESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQG-KNSVELLVEDRGNQVYRCVYKPVQPGPHVVKVSFAGDAIPKSPFGVQI-GEACNPNA--CRASGRGLQPKGVRIRETADFKVDTKAAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGS-APLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSDDEEDVDFDIIHNANDTF-TVKYVPPAPGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAG-KAPLNVQFSSPLPGEAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGKDQEFAIDTNGAGGQGKLDV--TILSP-SRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADI-------EMPFDPSKVVASGPGLEHGKVGEPGILCVDCSEA-----GPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPAWVKVEPAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVHAQGPGLKEAFTNKSNV-----FTVVTRGAGIGGLGITVEGPSESKIN----CRDNKDGSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLS----SCVRACIPQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQ-----TGDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGK---GKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGF---RPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESPLQFYV-NYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNK--DGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDN-RRCSQVKL----------GSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIG---ISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSE----GRTFEMSDFIVDTRDAGYG--GISLAVEGPSKVDIQTE--DLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKI-----SGEGRVRESITRTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEI-VPMGKNSHC-VRFVPQEMGVHTVSVKYRGQHVTGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPVIAPSDDARCLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNG-SHVVGSPFKVRVGEPGQAGN--------------------------PALVSAYGAGLETGTTGIQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEI------PEGYKVMYTPMAPGNYLIGVKYGGPNH-ISRSPFKAKV 2471          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|O75369|FLNB_HUMAN (Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2)

HSP 1 Score: 1339.32 bits (3465), Expect = 0.000e+0
Identity = 860/2303 (37.34%), Postives = 1251/2303 (54.32%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP----YKESKIKAFGPGL--TGGIVSKPAFFEVETN--GETGALGFSIKGPSEA-KIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPST-----VKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS----VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQET--NNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEY-PETETPLLIS-ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSV------------VDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX---------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGST-----QKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G++ + V +P+G K   E+         Y C Y P   G + + I FA   IP SPF V V  A  +P+   ASG G++P G  +   T F V T  AG G +   +   KG ++ VK K     +  +  EY     G +S+ + + G  I  SPF V V  +   +  ++  A G G+   G  V   A+F V +  +    LG  + GP ++  +   +    C  +  Y P+ PG Y V I   +  I  SP+   + P    Y    ++A+GPGL  +G IV+  A F V+    G+     F+  G  +   I   +  DG+   +Y P    ++ + ++    NIP SPY   I   +    P KV  +GPG+  SG+  N+P  F V+   AG           A       + +   I  N + T++ +Y P   G++T+ V + +  IP SPF+V V  + +A+ +K  GPG+ +A  +    T+F V  K AG   + +     +  + ++D+ ++  DN D + T+KYTP   G    + + +    IP+SPF V + +  D  K K+N L N   +G+  EF + T   G + + ++ + SP+   VP  +          A F P   G + V V   G+P+  SPY V A+   D    K + P  E  L+   A++ ID K      + +      P E + ++   N +   S ++ P +   Y V    E         KA++  P     V A G GL  G         +D +E  P  LG+    +   +A++   +N DGT +V Y+P   G Y + + Y  E +   P  V + P         D +++  +GPG+    VF+++ + FTV+++P+   G   +KA I NP    + C V +N DGTY   Y+P   G H +++TYD VP+  SP+ V V +G  PSR++A GPGL+E  T +P  FTV   GAG GGLG+++EGP++++I C DNKDG+CS +Y+P  PG YDV+I +   HIPGSPF VP+ D+VD SKVK  GPGL  +G R      FTVD+SKAG APL+V V+      V+P  ++     G   VTY P   G   + V Y + ++P SPF   VL + +  KV  +G G+  +    +   +P  F I+ RDAGE  L + +T    +     V ++ DGT+   Y  D  G Y + V YG  ++P SP+ +         +C   GP I + V  G+ V   V+ + AG G ++   + P G      +     G   + Y   K G Y + + F   +IPN      A    E  ++E    +      +P +  E  V             D   P       +   V+ PS +   P +++N DGT+TV+Y P+E GLHE+ + Y G  I  SP +FYV+    SG V+AYGPGL YG  +  A FTIVT+DAG GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY I +K+ DKHI GSPFTAKI  + ++ SQ+ +G+ +D  L ISETD+++L A + +P+GR+E C LKRL N ++GISF P+EVGEHLV++ ++G H+ NSP  I V ++EIG+A R K+YG GL++G   E   F+VDTR+AGYGG+SL++EGPSKV+I+  D  DGTC V+Y PT PG YI++ K+AD +VPGSPF V I G     + E I R   A  V+ +G++C+LNL IP  N  + +A V SPSG     EI+ +  N   +RF+P+E+GVHTVSVK   +HVTGSPFQFTVGPL +GG HKV   G G+ERG A    +F+I+TREAGAG LSIA+EGPSKAEI F D+K+GSCGV+Y   EPG+Y  SIKFNDEH+P SP+++            PV   +   +D+R +++ +LQ+ G  +   A+F I  +G   G I A V SPS   +   +S+++ ++Y+V F+P ENG+H + V  N S + GSPF+V V           V+  G G+  G TG  +EFF++T+ AG G L+VTI+GPSKV+++CQE   GY   Y P APG+Y IS+KYGG NHI+GSPF   ++G    S  S  ET S L ++V   S  T      K  S    V  +G GL  A +G+++ F+VD   AG ++L +GV GP  PCEEV++KH+GN ++ V Y V+E+G ++L V+WG   +PGSPF + VP
Sbjct:  353 DASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEAC-NPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQK--DFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPE---AGMQKVRAWGPGLH--GGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSC--DVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSH---PQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDII--DNYDYSHTVKYTPTQQGNMQVL-VTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEG--PCE-AKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAV-------DTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL-GSGVRARVLQSFTVDSSKAGLAPLEVRVLG-PRGLVEPVNVVDNGD-GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG---VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATD-GEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYP-NSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISG--EGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLV------------PVIAPS---DDARRLTVMSLQESGLKVNQPASFAIRLNG-AKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP 2602          

HSP 2 Score: 1066.22 bits (2756), Expect = 0.000e+0
Identity = 850/2604 (32.64%), Postives = 1244/2604 (47.77%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK-ESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS------VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPI---GQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE--EGITKQPQKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFT--PSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE--YSVVDFKFPVGPVFDY-------VRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVD----STIPSGQVTAYGPGLSYGRP-----------DMHAH----FTIVTKDA-GAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVG---------TTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAV-----NIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDAN--QFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRX---XXXXXXXXXXXIHHGHTG-RINE--FFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWG--NHDVPGSPFEIVV 7621
            + E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    +R  H+RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGL+WTLILHYSI+MP+WE    ++ D   K  +PKQRLLGWI +K+P+ P+ NF  +W DG A+GALVD+CAPGLCP+W  WDP++ + NA+EA+  A++ L V  +I P E+I+P VDE ++MTYLSQFP A+L   APL PK N  + RAYG G+E  GN +  PA FTVDT +AG+G++ + V +P+G KE  ++    +K   YS  Y+P + G +++ + FA   I  SPF+V+V  A GD SKVTA GPG+E VGN   + T+F+++TA AG G +   + D +G K++V+  +  +    +   Y   + G H V +FFAG  I  SPF V V  +  N +A    A+GRG+QP+GVR+R+  +F+V T+ AG  +LGV + GP    E  + K     +Y   Y P  PG Y + I +G + I  SPF V V P     K++A+GPGL GGIV + A F VE+ G E G+LGF+I+GPS+AKI+  D  DGS +V YWP  PGEYAVHI+CDDE+I  SPYMA I   T  ++P  V AYGPGL  SG   N  A+F V+ K+AG  + +K    D  GQ I +Q+++  DGTY+C YTP    KHT+ V +G VNIP SP++VN+ +  +   +KV+GPG+ER+  K N  T+F VDC  AG GD+ +       VL E   DV      N + TF            YTI++ F+  EIP SPF+V ++  +D  K K      +      G+   F + T   G K    +   SP        L   +N        +TPT  G   V V   G+PI  SP+ V     ++  +      E    +    ++ +D +        +    L+P  R  V     P   R N    F P EE +Y V  T +           E   P     V A+G GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP +PG Y VN+L+ + HI  SPF   I           D +KV A GPGL    V +        +       G G +     +    ++  ++ NN DGTY+ +Y P   G + + + Y G  V   P  V V    D SRI+ +GPG+E  +   +    FTVD   L   G   +   I  P+ A  +CF  DN DGT  V+Y P + G + V + +++  IP SPF V + +    S+V+  GPGL+      FT  P+ FTV    AG   L + V   +   +        +  G     YIP   G+ ++ + Y    +PGSPF   V +  +P KV + G G+    G  +  +V   FT+++  AG + LE+ V GP      ++V ++GDGT T  Y     G Y V V Y ++ +P SPF V V       +    GP L+   VP    V   ++ ++AG+G+L+ +     G      + + + G   V+Y+P K G Y + + +  ++IP    R  A Q              T + SK +       S V     VG V D        V   V  P   +    +I N DGT  + Y  ++ G + + V + G  I  SPF         + +    V A  PG    RP           DM+      F +V   A   G ++  V  PS   A  + +DNK+GT  V Y P   G + + IK+M  HI  SP    +   P   S    G          T+   +   +     L+  +  P+  E SC   +  +G   +++ P   G++ + V  + +HIP SPF   + ++     S+VKL               F++D        L+ SI+ PS  +  C      +NH G   +++ P E G +++++K   ++V  SP ++      IG    + +  R L      E+S       ++    GY     + +V  PS      E   L D    + + P   GV+ VS K  + HV GSPF   +      G  K  I  +     +A   +     +   E  +  +S  +  PS    +AEI     K+  C V +   E G +  S+K+  +HV GSPF   +   P                 +  +       +    G  A F I       G +S  V  PS  E   +     N    V ++  E G + V +  N+  IP SP+ V      +       +    +G ++N+   F    N   G +   +  PS     C  +E     Y   ++P+  G +TI +K+ G +H++GSPF V +       N                          P  V   G GL+    G ++EF ++   AG   L V + GP +    C+E          ++V Y     G +L+ V++G  NH V GSPF+  V
Sbjct:    3 VTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQV-GEACNPNA--CRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGK-APLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTF-TVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAG-KAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKDQEFTVDTRGAGGQG-KLDVTILSP-SRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADI-------EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEA-----GPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLK----EAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKIN----CRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGL----GSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQ--------------TGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGF---RPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYV-NYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNK--DGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDS-RRCSQVKL----------GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIG---ISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDF----IVDTRDAGYG--GISLAVEGPSKVDIQTE--DLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKIS---GEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEI-VPMGKNSHC-VRFVPQEMGVHTVSVKYRGQHVTGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNG-SHVVGSPFKVRVGEPGQAGN--------------------------PALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQET------PEGYKVMYTPMAPGNYLISVKYGGPNHIV-GSPFKAKV 2471          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|Q8BTM8|FLNA_MOUSE (Filamin-A OS=Mus musculus OX=10090 GN=Flna PE=1 SV=5)

HSP 1 Score: 1156.35 bits (2990), Expect = 0.000e+0
Identity = 652/1520 (42.89%), Postives = 921/1520 (60.59%), Query Frame = 2
Query: 3212 NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE---------VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAF---QPQEQYSI--ERTTHHYTTEQ--------SKPIIR------TEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXX---------XXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETK-----SLTQTV----HMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
             V   G GL +  A     F +D +    A L + I  E  + A++   D+GDGT ++ Y+P  PG+Y V + Y  + + + P  + + P         D + V  YGPG+   GVF+++ ++F+V+A+ +   G   VKA + NP    +   V +  DGTY   Y+P  +G H +D+TYDG PV  SP+ VPV +G DPSR+R +GPG++ G T +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+CSV+Y+P + G+Y +++ +    +PGSPF VP+HD+ D SKVKC GPGL     R   P  F VD SKAG APL+V V       V+P  ++  +  G   V Y+P   G+  I VLY   +VP SPF   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P  +     + ++ DGT+T  Y  DVPG YT+ + YG   +P SP+ V         +C +   I            + +G+   I V+T+ AG G ++     P G+ V   +     G   + Y   + G Y + + F  E++PN   +  A    QP  Q  +  ++    Y   Q         +P++       T     D   P       +   V  PS +   P + +N DGT+TV+Y PSE+GLHE+++ Y+   I GSP +FYVD  +  G +TAYGPGL++G  +  A FT+ TKDAG GGLSLA+EGPSKAEI C DN++GTC VSYLP+ PGDY I +K+ D+HI GSPFTA++ G+   R S + VG+ +D+P+ ISETD++ L A V+ P+GREE C LKRL+NG++GISF PKE GEHLV+V ++G+H+ +SP  + + ++EIG+ASRV++ G GL++G   E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGSPF+V + G     + E I R + A  V+ IG+ C+L+L IP  + ++ TA V SPSG     EI+   ++ + IRF+P E+G+HTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER       +F I+TREAGAG L+IA+EGPSKAEI F+D KDGSCGV Y V EPGDY  S+KFN+EH+P SPF++     P +S S           D+R +++++LQ+ G  +   A+F ++ +G   G+I A V SPS   +   +++ID ++Y+V F+P ENGI+ + V  N + IPGSPF++ VGE         V+  G G+  G TG   EF V+TSNAG GAL+VTIDGPSKV+++CQE   GY  TY P APG Y ISIKYGG  HI GSPF   ++G    SN S+ ET      SLT+      H  SG    GP+    V  +G GL  A +G+++ F VD   AG ++L VGV GP  PCEE+ +KH+G+  + V+Y +++KG + L+V+WG+  +PGSP+ I+VP
Sbjct: 1162 KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAV-------DTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKV-QGPKGLVEPVDVVDNAD-GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVD-YVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTG--EGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVV-----PVASPS----------GDARRLTVSSLQESGLKVNQPASFAVSLNG-AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGP---GPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMVP 2647          

HSP 2 Score: 1047.73 bits (2708), Expect = 0.000e+0
Identity = 823/2610 (31.53%), Postives = 1244/2610 (47.66%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTH-KRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP-YKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGS---KVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETET--PLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNEK-------------AELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP-QKFTVDLEGAGQGG---LGLSIEGPA----DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----------GEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTH---HYTTEQSKPIIRT-EYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKF--------YVDSTIPSGQ---------------------VTAYGPGLSYGRP-DMHAHFTIVTKDAGAGGLSLAVEGPSK--AEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF--------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIEC--HDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCE-LNLII----PGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQ--FTIYTREAGAGSLSIAIEGPSKA--EIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTG----RINE--FFVDTSNAGNGALTVTIDGPSKVQLNC---QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  +  I +LQ DL+DGL+LI L++ LS       H +RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W+ E+  +   Q    +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A++ L +  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   +S  Y+P + G +++ + FA   I  SPF+V V  + GD SKVTA GPG+EP GN   + T+F +FTA AG G V+ VI D  G+K +V+P++  + ++ +   Y    EG+H+V+V FAGV I  SP+ V V    + +  +   A GRG+QP+GVRV++ A+F+V+T+ AG  +L V V GP +  E+ + K +   +Y   Y P  PG Y V I +G   I  SPF V V       K++A+GPGL GGIV K A F VE  G + G LGFS++GPS+AKI+C D GDGS +V YWP   GEYAVH+LC+ E+I  SP+MA I+   + F P +V A GPGL  +G++ NKPA+F V+ K+AG  + ++ +  D  G ++   ++DN +GTYSC Y P+ P KHT +VS+G V+IP SPF+VNV    +   +KVYGPG+ +   K +  TYF VDC  AG GD+ I +          E   D  ++ +DN   T            +YTI + F++   P SP +V +E  +D  K K     LN T   +G+   F +     G     V+   + K      V + +   +N +   + P   GP  V V   G+ I  SP+ V  +  ++  +   +     + +  D     K+         ++K+     + V     P     N    F P EE  Y V+ T +              A  +   V A+G GL  G A +PA F ID+       LG+T+EGP EA+++ +DNGDGTCSV+Y+P EPG Y +N+L+ D HI  SPF   + P         D +KV   GPGL           +F V+       G   +   I +     +   + ++ DGT++ +Y P   G + + I Y G PV   P  + V    D S ++ YGPG+E +G+ ++   +F+VD     Q G   +   +  P+    D  +Q  D  DGT  V+Y P + G + V + ++   +P SPF VP+ +  D S+V+ +GPG++   +    P++FTV+   A          G +  K++ +D                 G   V YIP   G   + V Y   QVPGSPF   V +  +  KV  +G G+ P  G + AN +P  F ++T  AG + L++ V GP      +DV ++ DGT T  Y     G+Y++ VLYG + VP SPF V V       +    GP LN   VP    V   ++ ++AG+G+L+ +   P G      I++   G  TV+YVP   G Y + + +  + IP    R  A    +      T     H       P I+  E +V+               V     +  DV  ++ N DGT  + Y   + G + + V + G+ +  SPF+          V + + S Q                     V   G  ++  RP D+   FTI       G ++  V  PS   A+    DNK+GT  V Y P   G + + I++ + HI GSP            I       +   V   +   +   +     L+  +  P+  E SCT    Q+G   +S+ P   G++ + V  + +HIP SPF   V  ++    S +K          V       ++        L+ ++  PS  E  C      +G   +++ P E G ++++VK    +V  SP  V I    S S      R + + +    G+  E    II     GY     + S+  PS      E   L D    + + P E G + +++K  ++HV GSPF   V      G  K  I        +AN  +    ++   E     ++  +  PS    E +  + ++ +  + +   E G +  S+K+  +HVPGSPF   +   P                 +  +       +   +G  A F I       G ++  V  PS  E   S     +    V +V  E G + V V  N   IP SPF V V   +     +          ++N+   F  + N   GA+   +  PS     C   + ++  Y   ++P   G Y I +K+ G  HI GSPF + +    +  +                          P  V   G GL+    G   EFIV+   AG   L V + GP +    C+E          ++V Y     G +L+ +++G  + + GSPF+  V
Sbjct:   32 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQ----TPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACR---AIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGK-APLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTV---KYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDI-IDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAP-------CFDASKVKCSGPGLE--RATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQ--DCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTN--KPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKD--------------GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRAN-LPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDV-DVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTI-----KKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDN--QDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLK----------VGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVI----SQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYG--GLSLSIEGPSKVDINTE--DLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV---TGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAE--ISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNG-THIPGSPFKIRVGEPGHGGD--------------------------PGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQEC------PEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV 2516          

HSP 3 Score: 92.0485 bits (227), Expect = 9.151e-17
Identity = 88/318 (27.67%), Postives = 134/318 (42.14%), Query Frame = 2
Query:  965 LELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA--GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAG-VQIQSSPF-------------------GVMVSSKTSNSDAKQAYATG-----------RGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV 1816
            L+  G  +  PA F V + N  KG +D  V +P G  E C + +    +  Y+  +IP   G Y I +KF  + IP SPFK+ V      GDP  V+A G G+E  G   G    F V T+ AG G++   I   +K + D       ++    + + YT    G + +++ + G   I  SPF                    V V S T  +   Q   +G           +G+      V   + F V    AG   L V V+GP    E+  +K +   LY  SY+ +  G Y + +K+G+  I  SP+ + V
Sbjct: 2340 LQESGLKVNQPASFAV-SLNGAKGAIDAKVHSPSGALEECYVTEIDQDK--YAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLE--GGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMD------CQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2646          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|P21333|FLNA_HUMAN (Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4)

HSP 1 Score: 1154.04 bits (2984), Expect = 0.000e+0
Identity = 646/1517 (42.58%), Postives = 919/1517 (60.58%), Query Frame = 2
Query: 3212 NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE---------VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAF---QPQEQYSI--ERTTHHYTTEQ--------SKPIIR------TEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXX---------XXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSL------TQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
             V   G GL +  A     F +D +    A L + I  E  + A++   D+GDGT ++ Y+P  PG+Y V + Y  + + + P  + + P         D + V  YGPG+   GVF+++ ++F+V+A+ +   G   VKA + NP    +   V +  DG Y   Y+P  +G H +D+TYDG PV  SP+ VPV +G DPSR+R +GPG++ G T +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+CSV+Y+P + G+Y +++ +    +PGSPF VP+HD+ D SKVKC GPGL     R   P  F VD SKAG APL+V V       V+P  ++  +  G   V Y+P   G   I VLY + +VP SPF   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P  +     + ++ DGT+T  Y  DV G YT+ + YG   +P SP+ V         +C +   I            + +G+   I V+T+ AG G ++     P G+ V   +     G   + Y   + G Y + + F  E++PN   +  A    QP  Q  +  ++    YT  Q         +P++       T     D   P       +   V  PS +   P + +N DGT+TV+Y PSE+GLHE+++ Y+   I GSP +FYVD  +  G VTAYGPGL++G  +  A FT+ TKDAG GGLSLA+EGPSKAEI C DN++GTC VSYLP+ PGDY I +K+ ++H+ GSPFTA++ G+   R S + VG+ +D+P+ ISETD++ L A V+ P+GREE C LKRL+NG++GISF PKE GEHLV+V ++G+H+ +SP  + + ++EIG+ASRV++ G GL++G   E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGSPF+V + G     + E I R + A  V+ +G+ C+L+L IP  + ++ TA V SPSG     EI+   ++ + IRF+P E+G HTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER  A    +F+I+TREAGAG L+IA+EGPSKAEI F+D KDGSCGV Y V EPGDY  S+KFN+EH+P SPF++     P +S S           D+R +++++LQ+ G  +   A+F ++ +G   G+I A V SPS   +   +++ID ++Y+V F+P ENG++ + V  N + IPGSPF++ VGE         V+  G G+  G TG   EF V+TSNAG GAL+VTIDGPSKV+++CQE   GY  TY P APG Y ISIKYGG  HI GSPF   ++G    SN S+ ET S+        T     G+   GP+    V  +G GL  A +G+++ F VD   AG ++L VGV GP  PCEE+ +KH+G+  + V+Y +++KG + L+V+WG+  +PGSP+ +VVP
Sbjct: 1162 KVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAV-------DTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKV-QGPKGLVEPVDVVDNAD-GTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVD-YVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTG--EGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVV-----PVASPS----------GDARRLTVSSLQESGLKVNQPASFAVSLNG-AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP 2647          

HSP 2 Score: 1050.04 bits (2714), Expect = 0.000e+0
Identity = 816/2608 (31.29%), Postives = 1239/2608 (47.51%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTH-KRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVA-PYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGS---KVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETET--PLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN----FEPNEEIIYPVQRTNEK-------------AELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP-QKFTVDLEGAGQGG---LGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKA----------GEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTH---HYTTEQSKPIIRT-EYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYV-----DSTIPSGQVTAYGPGLSYG----------RP---------------DMHAHFTIVTKDAGAGGLSLAVEGPSK--AEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF--------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIEC--HDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCE-LNLII----PGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQ--FTIYTREAGAGSLSIAIEGPSKA--EIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGHTG----RINE--FFVDTSNAGNGALTVTIDGPSKVQLNC---QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  +  I +LQ DL+DGL+LI L++ LS       H +RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W+ E+  +   Q    +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A++ L +  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   +S  Y+P + G +++ + FA   I  SPF+V V  + GD SKVTA GPG+EP GN   + T+F +FTA AG G V+ VI D  G+K +V+P++  + ++ +   Y    EG+H+V+V FAGV I  SP+ V V    + S  +   A GRG+QP+GVRV++ A+F+V+T+ AG  +L V V GP +  E+ + K +   +Y   Y P  PG Y+V I +G   I  SPF V V       K++A+GPGL GG+V K A F VE  G + G LGFS++GPS+AKI+C D GDGS +V YWP   GEYAVH+LC+ E+I  SP+MA I+   + F P +V A GPGL  +G++ NKPA+F V+ K+ G  + ++ +  D  G  +   ++DN +GTYSC Y P+ P KHT +VS+G V+IP SPF+VNV    +   +KVYGPG+ +   K +  TYF VDC  AG GD+ I +          E   D  ++ +DN   T            +YTI + F++   P SP +V +E  +D  K K     L+ T   +G+   F +     G     V+   + K      V + +   +N +   +TP   GP  V V   G+PI  SP+ V  +  ++  +   +     + +  D     K+         ++K+     + V     P     N    F P EE  Y V+ T +              A  +   V A+G GL  G A +PA F ID+       LG+T+EGP EA+++ +DNGDGTCSV+Y+P EPG Y +N+L+ D HI  SPF   + P         D +KV   GPGL           +F V+       G   +   I +     +   + ++ DGT++ +Y P   G + + I Y G PV   P  + V    D S ++ YGPG+E +G+ ++   +F+VD     Q G   +   +  P+    + +  D  DG   V+Y P + G + V + ++   +P SPF VP+ +  D S+V+ +GPG++   +    P++FTV+   A          G +  K++ +D                 G   V YIP   G   + V Y   QVPGSPF   V +  +  KV  +G G+ P  G + AN +P  F ++T  AG + L++ V GP      +DV ++ DGT T  Y     G Y++ VLYG++ VP SPF V V       +    GP LN   VP    V   ++ ++AG+G+L+ +   P G      I++   G  TV+YVP   G Y + + +  + IP    R  A    +      T     H       P I+  E +V+               V     +  DV  ++ N DGT  + Y   + G + + V + G+ +  SPF+         S  P  +     P  +Y           RP               D+   FTI       G ++  V  PS   A+    DNK+GT  V Y P   G + + I++ + HI GSP            +       +   V   +   +   +     L+  +  P+  E SCT    Q+G   +S+ P   G++ + V  + +H+P SPF   V  ++    S +K          V       ++        L+ ++  PS  E  C      +G   +++ P E G ++++VK    +V  SP  V I    S S      R + + +    G+  E    II     GY     + S+  PS      E   L D    + + P E G + +++K  ++HV GSPF   V      G  K  I        +AN  +    ++   E     ++  +  PS    E +  + ++ +  + +   E G +  S+K+  +HVPGSPF   +   P                 +  +       +    G  A F I       G ++  V  PS  E   S     +    V +V  E G + V V  N   IP SPF V V   +     +          ++N+   F  + N   GA+   +  PS     C   + ++  Y   ++P   G Y I +K+ G  HI GSPF + +    +  +                          P  V   G GL+    G   EF+V+   AG   L V + GP +    C+E          ++V Y     G +L+ +++G  + + GSPF+  V
Sbjct:   32 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDR-ESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQ----TPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACR---AVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGK-APLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTV---KYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDI-IDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVP-------CFDASKVKCSGPGLE--RATAGEVGQFQVDCSSA---GSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTN--KPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKD--------------GSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSP--GMVRAN-LPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDV-DVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTI-----KKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDN--QDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLK----------VGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVI----SQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYG--GLSLSIEGPSKVDINTE--DLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV---TGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTV--GPLGE------------GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAE--ISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNG-THIPGSPFKIRVGEPGHGGD--------------------------PGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQEC------PEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKV 2516          

HSP 3 Score: 177.948 bits (450), Expect = 6.732e-43
Identity = 208/837 (24.85%), Postives = 345/837 (41.22%), Query Frame = 2
Query: 5276 QVTAYGPGL--SYGRPDMHAHFTIVTKDAGAGGLSLAVEGPS----KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICV------------GTTSDVPLRISETDINNLNAIVISPTGREESC--TLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDG--MVNETCQFVVDTRNAGYGGLSLSIEGPSKVE-IECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPL-IDGGPHKVHIMGSGVER-GLA-NDANQFTIYTREAGAGSLSIAIEGPSKAEID--FQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDE----NPYSSYSKPVKNENIIFNDSRYISI-AALQDQG-FNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG--------HTGRINEFFVDTSNAGNGALTVTIDGPSKVQLN-----CQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGD----VLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPF--EIVVPN 7627
            +  AYGPG+  +       A FT+ T+ AG G + + VE P+    +A++   ++KN T  V Y+P   G + + + F  +HI  SPF   +       S++                T+   +  +      +  ++  P G++ +    L+   +     S+ P   G H V+V  +G  IP SP+ + VG+    N S  +  G GL      V ET  F V T+ AG G L ++++GP   E ++  D  DG     Y P  PGTYI+ + +   N+  SPF V +G   +    +++       E   +G   +  +   G +      SV  PS +   C+     D    +R+ P+E G + V V  ++  +  SPF   +     D  P +V   G G+E+ G+A N   +FT+  +  G   L + ++      ++   +DN +G+   +Y   +P  +   + +    +P SPF + +      N    Y   V    +  ++  Y ++  A   QG  +IG K               +  V+ P+  +    I + DN+ ++V + P   G + + VL  +   P SP RV V     + +    G          G+   F V+   AG G L V   G +K            +++ Y   Y P   G   +++ YGG+  I  SPF VA+S        S+  +K                      +K  G G KV ++GK  EF V +  AGG        VG SG   PC+      LG +   V +  +E+G + + V +    VPGSPF  E V P 
Sbjct:  283 KARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQ--ACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVG---TECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECD--DKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKC--------------APGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDP-IPKSPFSVAVS-------PSLDLSK----------------------IKVSGLGEKV-DVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVE--PGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPT 1065          

HSP 4 Score: 149.058 bits (375), Expect = 3.966e-34
Identity = 138/493 (27.99%), Postives = 218/493 (44.22%), Query Frame = 2
Query: 1037 NLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKN-AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESK----IKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHI-LCDDENIPKSPYMAQI------------QLDTKLFDPL--------------------KVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQ---IRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV 2389
            ++   V +P G+    EI +  N    Y   ++P   G + + +K+    +P SPF+  V     G   KV A GPG+E    E G    F+++T EAG G +   +      + S +     + +    + Y  +E G + V+V F    I  SPF V V+S +   DA++   T   +Q  G++V   A F V    A  A +   V+ P  +LE+C + ++    Y   +IP+  G Y++D+K+    I  SPF + V           + A+G GL GG+   PA F V T N   GAL  +I GPS+ K+DC +  +G   VTY P  PG Y + I      +I  SP+ A++            +  +   D L                    KV A G GL S     + + F V+   AG+   +      V G   P +   ++      YS  Y  K  G++T++V +G+ +IP SP++V V
Sbjct: 2173 DMTAQVTSPSGKTHEAEIVEGENH--TYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERA--EAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFE----DRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSG--DARRL--TVSSLQESGLKVNQPASFAVSLNGAKGA-IDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGY-RVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGL-SKAYVGQKSSFTVDCSKAGNNMLL----VGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2646          

HSP 5 Score: 95.5153 bits (236), Expect = 7.556e-18
Identity = 92/318 (28.93%), Postives = 135/318 (42.45%), Query Frame = 2
Query:  965 LELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA--GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILD-TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAG-VQIQSSPF-------------------GVMVSSKTSNSDAKQAYATG-----------RGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV 1816
            L+  G  +  PA F V + N  KG +D  V +P G  E C + +    +  Y+  +IP   G Y I +KF  + IP SPFK+ V      GDP  V+A G G+E  G   G    F V T+ AG G++   I   +K + D       ++    + + YT    G + +++ + G   I  SPF                    V V S T  + A Q  A G           +G+      V   + F V    AG   L V V+GP    E+  +K V   LY  SY+ +  G Y + +K+G+  I  SP+ V V
Sbjct: 2340 LQESGLKVNQPASFAV-SLNGAKGAIDAKVHSPSGALEECYVTEIDQDK--YAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLE--GGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMD------CQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2646          

HSP 6 Score: 63.1586 bits (152), Expect = 4.395e-8
Identity = 62/227 (27.31%), Postives = 94/227 (41.41%), Query Frame = 2
Query:  944 VRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANS-EIPNSPFKVNVKN----------------------------------AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENK-FLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMV 1516
            V AYG GLE  G   GNPA F V+T NAG G L + +  P   K  C+  + P     Y  +Y P   G Y I IK+     I  SPFK  V                                       D SKV A G G+      VG+++ F V  ++AG    + +++   G +   +  + K   ++ + + Y  K++G +++ V +    I  SP+ V+V
Sbjct: 2432 VSAYGAGLE--GGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQ--ECPE---GYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKA--YVGQKSSFTVDCSKAGN---NMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2646          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|Q9VEN1|FLNA_DROME (Filamin-A OS=Drosophila melanogaster OX=7227 GN=cher PE=1 SV=2)

HSP 1 Score: 1132.86 bits (2929), Expect = 0.000e+0
Identity = 726/2005 (36.21%), Postives = 1080/2005 (53.87%), Query Frame = 2
Query: 1832 SKIKAFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPS----EAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGS--PSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNG-FVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPE---TETPLLIS--------ADYAID-NKAYNKP-SIPVQSAKLT--PVERSNVKTFSNPN-KQRSNFEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVA-NTPASFIIDSTEEPPAPLGVTI---EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFN-GKGIVKAIITNPFNQ-RSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNC-EIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTE---------YSVVDF-KFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDV--PLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG-------HTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMIS-GSTQKGPSKPY------NVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            ++++A+GPG+   G +V  PA F VET +   G++   I+GP+    +A +   ++ + +  V+Y P   G + V +     +IPKSP+   ++++    D  KV   GPG+  +G++  KP  F +  K+AG   P  +  +  +    ++  ++R   + T+ C Y   + G H+V V Y    IP SPF V V    +A  ++  G G++     +  +  F +  + AG G+  + V+     +  V+     DG     +   T    Y I + F+  E+ +SPF+V +    +          ++  IG    F + T  +G        V  P  S+  ++  +  +G  +  + PT +G + V + C    I  SP+  IA     T  +PE      P L            + +D +KA N P  + VQ    T  PVE  N     NP+  ++  + P   + + V+             R      +    V A+G  L  GV  N    F +D+ E   A L V I   E  +E     IDN D T SV  +P   G+Y   + Y  + +   P    +  +        DV+K+     GL P+ V  ++ + F V+   +  N   G +   I +P      +  V    D  +   Y+P   G+H I++ YD +PV  SP+ V V  G DP+R +AYGPGLE+G+T Q  KFTV+ +GAG GGL L+IEGP++A++ C DN+DG+C V YL   PG YD++I+F +KHIPGSPF V + + VD SKVK YGPG+E    R   P+ F VD  +AG   + V + ++    V   ++  K    ++ V Y+P   G+    +V ++ ++VP SPFV  V    EP KV V G   +          +P+ F I+T+ AG++D+ + +  P  +++   ++    GT+   +  D  G Y   + YG+K + GSPF +      + ++C +          G    + V+ + AGDG ++ K     G+ +      E+ G   + Y     G Y++ + F  ++IPNGS    A +  EQYS       +TT+  +   ++E         Y  V F K P+      V A V  PS + D P + +N DGT++V+Y P E G HEL V YNG+P+ GSPFKF+VDS I SG VTAYGPGL++G     A+FTI TK A AGGL++AVEGPSKA+I   DNK+GT  V YLP APG+Y + ++F DKHI GSP+ AKI GE +KR+QI VG+ S+V  P  I++ D+  LNA + +P+G EE C LKR+  G +GISFTP+E+GEHLV+V R G+HI NSPFK+ V E E+G+A +VK+ G GL +G  +    F VDTRNAG+GGLS+SIEGPSK EI+C D  DGT  ++YKPTEPG YI+N+K+AD +V GSPF V + G  S+   E+I R +DA  +++IG+ C+L   +PG    +  A V SPS   E  EI  + D  +++ F+PKELGVHTVSV+    H+ GSPFQFTVGPL D G H V   GSG+ERG+  +A +F ++TREAG GSL+I++EGPSKA+I+F+D KDGSC V+Y+V EPG+Y   +KFND H+P SPF + +  +                 D+  + +           +   F++  +G   G + A +++PS  +    I  ID   YSV F P ENGIH +HV  N   IP SPFR+ VG+       +H          TG   +F ++T NAG G L V+IDGPSKV ++C E E GY   Y P  PG++ I++KY  N HI+GSPF V  +G+      +   +  + +TV  ++ G    G   P        V  +G GLK A IGK+N+F + A  AG ++LYVG+ GP  PCEE ++KH G+N + V Y V+++G+++L+++WG   +PGSPF+I V
Sbjct:  255 NRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPF--PVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPAN-HKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVM-QSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVET--NGETGALGFTVAGP--SQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF--IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKN-----NPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRV---PLGEKVVVEQTV-----DVSKIKV--DGLEPS-VIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGN-CIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDS-ITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA---------------GDAHKLEVQQFPQGNIQADAPYQFMVRKNG-AKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2210          

HSP 2 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 740/2289 (32.33%), Postives = 1145/2289 (50.02%), Query Frame = 2
Query:  173 AERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAG-SPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIE-RAKTNIETYFVVDCKLAGSGDIGISVLDEKMR-DVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKV---RPEIIVKSPNGSRVPVKLQE--TNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV---IATDRVNTKEY-PETETPLLISAD-YAIDNKAYNKPSIPV-----QSAKLT-----------------PVERSNVKTFSNPNKQRSNFEP-NEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVA--NTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYI---DNGDGTCSVNYLPKEPGSYIV-NVLYNDEHIKDSPFNVTIYPDTKSS----SNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFD--NKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFT----------PSQFTVDASKAGEAPLKVNVIDTATKSVKPAQ-----ILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKT--VTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQ----EQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYV---DSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSK----AEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT-------------AKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNH-DGTCL-VTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQF---------------------TVGPLIDGGPH-------------KVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDG--SCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQI 6655
            AER+LAEDAQWK IQ+NTFTRWAN+HLK  +  I++L+ DL+DGL+LI L++ LS       +KRP FR+QKLENV++ L+FL++ EG+++VNIDSSDI DC+LKLILGLIWTLILHYSI+MP+W+GED  Q +G G   +PKQRLL WI++K+P  P+ NFT DW  G A+GALVDACAPGLCP+W  WDPK A++NA EA+  A++ LNV  LI+P E++NP VDE++MMTYLSQ+PN++L   APL PKTN  RVRAYGPG+E  G  +G PA FTV+TF+AGKG++D+ +  P G+ E  ++  + +K L Y+ SYIP  EG +++ +KF+  +IP SPF V V+  AGD SKV  +GPGI+P G  + + TFF++   +AG G  + +I+D    K SV  K+ +   + +  EY T  +GLHSVNVF+AG  I +SPF V V+     SDA++  A+GRG+Q  GVRV D A+F+++TE AG  +  V V GPG   +     KV    YEC Y P + G YV+ + +    +  SPF V V P KES I A+GPGL+ G++  PA F VETNGETGALGF++ GPS+A+I+C DNGDGSA V Y PT  GEYAVHILCD+E+IPKSP++AQI L    F P  V A GPGL  +G++ N+P  F V+   AG +P  V  +  DV G  +PV++++N DGT    YTP     HTV V+YG V+ P SP +V V    +AA ++ +GP ++   + N  T+F VD + AG  ++ + ++ E+ + +VP    DN D T++++  P + G   T   +  +  +P    KV +E   D  K K++ L  +  +    +F +     GS +   +    +  P G  +P K+ +  T++ F   +TP   G HT+ +     P+  SP+ V      D    K Y P  E  L    + + ++ K      + +       AK+T                 P E      F++ +   S F    EE + P +            V  YG G+  G    + P  F +D  E  P  + V +       +D +   D G+   +V+Y+P + GS +   V +++  +  SPF +T++P ++ +      +++  K  A  P            ++F ++ K     G+  +   I NP  +     ++    GTY  S+ P   G ++  I Y    +  SP+ +  +   +  + +      +   +       VD   AG G +   I   A ++I   D   KDG   + Y    PG YD+++KF  K IP   F++   + ++      Y   +E + ++V             S+ T  +    + PL     +   +   P+      ++  +  G   V Y P   G+ E+ V YN   V GSPF  +V +S     V   G G+     H +  + P+ FTI+T+ A    L + V GP+   +N   DN  DGT + QY    PG Y V V +G+K++ GSP+   +  E +           N++ VG    VT+P +  +     L+A    P G   PC ++    G+  +S+ P++IG + V +    ++I N   +    + +    ++  +  T        +  I   +     F      +    +A + C           +  DGT+ + Y+P+E G + + + +    + GSPF   V    S     ++      +           T       +  L+  V  PS     AEIQ ++  +G   V ++P   G + + +++ + HI GSPF               K  G   +R    VG  ++  +   E    +L   V  P+  +     K  ++G   +S+   E GE+ V +  + RHIP+SPFK++V  +  G+A ++++      +   +   QF+V  +N   G L   I  PS  + +C     DG    V + P E G + I+VK+   ++P SPF + +G      + +    H     + ++    + + II   N    T +V S  G  ++       +  + +R+ P   G H ++VK +N H+ GSPF+                      TV  +  GG +             KV   G G+++      NQF+I   +AG   L + + GP     +F     G  +  V Y V + G YV  IK+ +EH+PGSPF + +
Sbjct:    3 AERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGH--TPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPL---SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQI-LPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQ--DVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQ-RVPLGE-KVVVEQTVDVSKIKVDGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSK------------VKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLP------------AEFEIDTKQA---GQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEY---IEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHV-DSITSGYVTAYGPGLT----HGVTGE-PANFTISTKGASAGGLTMAVEGPSKADINYH-DNK-DGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKR---------NQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQC----------TDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVE--DGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERG--VVGEAAEFNVWTREAGGGSLAISVEGPS--KADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDA-GDAHKLEVQQFPQGNIQADAPYQFMV-RKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVG----KDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAV-SIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2210          

HSP 3 Score: 228.024 bits (580), Expect = 4.566e-58
Identity = 304/1254 (24.24%), Postives = 530/1254 (42.26%), Query Frame = 2
Query: 4064 PIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGL-FDVTYIPENIGNCEIEVLYNNMQVPGSPF-VQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNE--SVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVH--SEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVG---NIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIER----TTHHYTTEQSKPIIRTEYSVVDFKFPV-GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQ-----VTAYGPGLSYGRPDMH--AHFTIVTKDAGAGGLSLAVEG--PSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQI-CVGTTSDVPLRISETDINNLNA-----------IVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMV-NETCQFVVDTRNAG----YGGLSLSIEG------PSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDA--NQFTIYTREAGAGSLSIAIEGPSKAEID-FQDNKDGSC--GVTYRVNEPGDYV-CSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX--XXXXXXXXXIHHG----HTGRINEFFVDTSNAGNGALTVTID---GPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAI-SGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGL--AGGDVLYVGVSGPVR-PCEEVNIKHLGNNR---FQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            P+    + ++V+ YGPG+E  G  V  P+ FTV+   AG+  + V+ I      ++ A +   +   L + V+YIP++ G+ ++ V ++   +P SPF V+   ++ +  KV VTG G++P+    +  K P+ F I  +DAG    E+++  P N   SV   V    + T+ C+Y   + G ++V V Y    +P SPF V V   S+A+  +    G     V VG      + T+ AG+G    + +GP G   N++   ++   Y      Y P K G Y + + F  + +   S  +    P+++ SI       +       +  ++ T        F V GP     +A + C           +NGDG+  V+Y P+  G + + +  + + I  SPF   +   +P        V A GPGL      ++    FT+    AG   L + V+    +K  ++  +N +GT  V+Y P +   + + + +       SP    + G P   +++   G      +R +     N++A           I+   T  E  C +   ++    +   P   G +   +   G+ +P    K+ V   +  + S++K+  DGL   ++ N    F+VD    G     G LS +I        PSK+        D    + Y P E G + I + Y +  VPGSPF VN+    S     R   +    E        +  +   G      + ++  PS +   C      D    + ++  + G + ++++  ++H+ GSPF+  V   +D  P KV + G G+E G   ++    F +   EAG G +++ +       +D  +    G+C   V Y   + G  + C +KF++  VP SPF++ +        S+P K +    N+ +  + A+L          A F I+        I+  + +P  K     + ++    Y V FVP E G +   +   +  I GSPF++           + +        +G  +   VD   AG+GA+T  I    G   V ++  E +  ++  Y  N PGDY I++K+GG +   GS    A+ S   Y  ++ I E      T  ++  +TQ   S+  N K        +EI  R+       L   GG+     V+  VR P  +V+   + +NR     V Y  +E+G H L+V++    V GSPF+  V
Sbjct:  247 PLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVD-IQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNG---VTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTY---ECHYYPTKEGRYVIMVTFAGQEVAK-SPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGP----SQAEIECH----------DNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPF---IAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYV-GVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGE-KVVV--EQTVDVSKIKV--DGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKI---VQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNV---KSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTC--TDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVD--PSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTV-----FPKSEPTKVKVKGVNEKKK-TPASL---------PAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEE-----HTTKVVQQTTQ---SELVNGK--------SEITYRSVAFEKLPLPTTGGN-----VTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHV 1423          
BLAST of Filamin vs. TrEMBL
Match: A0A504ZB76 (Filamin-A OS=Fasciola gigantica OX=46835 GN=FGIG_01162 PE=4 SV=1)

HSP 1 Score: 2853.16 bits (7395), Expect = 0.000e+0
Identity = 1443/2535 (56.92%), Postives = 1811/2535 (71.44%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSN----------------------------------SDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILT----PFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPK-STPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYA-----FQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX-----XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQK-GPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            +AERELAEDA+WK+IQKNTFTRWAN+HL+P NLI+DDLQYD ADGLKLI LV+ LSG  F+H +++P+FRTQKLENVTMVLRFLEE+EGLRLVNIDS+DI DCR KLILGLIWTLILHYSIT+PLWEGE      GQG+GP+PKQRLL W+N+K+  +PVKNFT+DWNDGTAIGALVDACAPGLCP+W QW+PKQ L+NA+EA+N AE+ L+V  LI+P EMINP+VDEKAMMTYLSQFP+A+L   APL PK+    VRAYGPGLE  GNT+GNPA FT+DTF+AG+G +++IVLNPKGQ+EPC+I  + +++  YSC+Y+PT EGEYR+IIKFA  EI NSPFKV V+ A GDPSK +ASGPGIEP GN+ GRRTFFN+FTA AGPG+VDCVILD  G +DS+KP ITKQ E+ +L+EYT K+EGLHSVNVFFAG QI  SPFGVMV  K S                                    D KQAYATGRGIQP+GVRVRD+A+F+VHTEDAG   L V V  P      C ++K    L++C+Y PQR GP+ V ++YG + I LSPFNVDV PYK+S+I+AFGPGLTGG+V+KPA F VETNGETGALGFSI+GPSEA+IDC DNGDGSA V YWPTVPGEYAVHILC+DENIPKSPYM  I+ D    DP +V  +GPG+  +G    +P +F V+ ++AG P+ +  EC D  G+ + +++RDN DGTY+C YTPK+P KHT++VSYG VN+P SPF+V+V E      ++V+GPG+E       T+F VDCKLAG G++GIS+ DE  RDVP+ T D  DGTF + YT  T GPTYT+ +FF+  E+P+SPF+VP++ + D  K  + NL+ + P+G+  EF+++T    P   SK +P ++VK PNG R+P  + E+ +GF   FTPTV+GPH+V V+  G P+  SP++  AT                              P+ PVQ A + PV         +  +Q +   P   I        E A L    V AYG+GL +  A  PA F IDS + PPAPL VTIEGP EAKI+Y+DNGDGTC V YLP EPG Y+VNVLY D HIK SPF V + P  +      DV++V AYGPGL PTGV K+SF+KFTV+AKP+D  G+G+VKAI+ +P  QR+ C V NN DGT+SCSYSP  DG H +++TYDG PV  SP+ V V  G DPSR+RAYGPGLE G+T + Q+FTVDL+GAGQG LGL++EGPADAQIQC DNKDGTC+V YLP K G+YDV +KFN+ +IPGSPF VPI D VD S+V+CYGPGLE  G+R   P+ FTVDAS+AG+AP+ V  +D   +S  PA ++P+   P ++DVTY+P   G C+IEV      V  SPF Q+VL + EP++V VTGEGV P R   +    P+ F ++TR+AG  DLEL V+ P  + + L+V +HGDGT++C Y+  V G +TV+V +G + +P SP++VPV    + + C IE    + +PVG+   I VNT  AG G ++ + + P G      I     G   + Y P   G Y V++ F  + +PNG   Q A       P+     ER  H  T       + T Y  VDFK PVGP F +V  +V+ PS R   P L++NGDGT+T Q+QP+E GLHELE+ YNGQPI GSPF+FYV++ + SG VTAYGPGLSYGR    A FT+VTK+AGAGGLSL+VEGPSKAEIQC DNKNGTC VSYLPL PG+Y I IKFM+ HI GSPFTA I GEP++ +Q+CVGTTS++PLRI+ETDI NL A V SP+G+E+  TLKRL NG+LGISFTP+E+GEH VNV R+GRHI NSPFKI+VGENEIGNASRV++YG+GL +G  N+ CQF VDTRNAGYG LSLSIEGPSK +IECHDNHDGTCLVTY+PTEPGTYIINV+YAD  VPGSPF V IGG PS  + ERI R ++ A+V+ +G+ CELNL IPG N R+  A+V SP+G  + C+++AL D  ++IRF+P+E+GVHTVSV++   H+ GSPFQFTVG + DGG HKVH  G G+++GL    N F+IYTREAGAG LSIAIEGPSKAEIDF+D KDGSCGV+YRV EPG+Y CSI+FNDEH+PGSPF + I+E    ++  P         + R +S+A +QD+G  IG    F +NY G+T G++ AYV+SPS     A + ++D +Q++V F P ENG H VHVL++  PIPGSPFRVV      G VT SGEG+ HG  G  N FFVDT +AG+GAL+VT+DGPSKVQLNC E  +GY F+Y+P  PG+Y I+IKYG   HIIGSPF   ++G+  Q   ++  T  + +T    SG  Q  G S+P  V C G GL+ A + + N F V+A  AG DVLYVGVSGPV  CEEVNIKHLG  ++ VNY V+++GRHL+MV+WG   VPGSPF + V
Sbjct:   26 MAERELAEDAEWKLIQKNTFTRWANEHLRPKNLIVDDLQYDFADGLKLIGLVEALSGQQFKHVNRKPSFRTQKLENVTMVLRFLEENEGLRLVNIDSTDIVDCRSKLILGLIWTLILHYSITIPLWEGE---VDHGQGQGPTPKQRLLSWLNNKLVDRPVKNFTSDWNDGTAIGALVDACAPGLCPDWRQWEPKQNLRNAREAMNAAEQWLDVPQLIRPEEMINPRVDEKAMMTYLSQFPSAKLKEGAPLRPKSTPEMVRAYGPGLERHGNTVGNPARFTIDTFSAGRGGVEVIVLNPKGQREPCDILSNNDRQQTYSCAYVPTQEGEYRVIIKFATKEILNSPFKVMVEGAQGDPSKASASGPGIEPQGNQAGRRTFFNIFTAAAGPGNVDCVILDPHGGRDSIKPVITKQGEDNYLVEYTPKDEGLHSVNVFFAGQQIPKSPFGVMVGPKPSAPLLMQPPTPLMTGSEEPIQAMQAPRKMSAPRRPACDPKQAYATGRGIQPQGVRVRDLADFKVHTEDAGEGPLEVAVIAPDGREIPCNVRKTGAYLFDCNYTPQRAGPHQVHVRYGGDHIMLSPFNVDVGPYKDSRIRAFGPGLTGGVVNKPAVFVVETNGETGALGFSIEGPSEARIDCTDNGDGSATVAYWPTVPGEYAVHILCNDENIPKSPYMVPIEPDMGKCDPERVKVHGPGVQPTGNVAGQPTEFTVDIRDAGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCNYTPKVPRKHTILVSYGAVNVPRSPFRVDVAEPSQPGKVRVFGPGVESVIRGQPTHFTVDCKLAGQGNVGISITDEMGRDVPMDTQDMRDGTFRVAYTAHTPGPTYTVHVFFNNQEVPRSPFRVPVKPNIDMSKIHVENLSPSIPVGKPTEFDVITAGAGPPSNSKPQPNVVVKGPNGMRIPSTMTESVDGFTPSFTPTVVGPHSVAVDVGGVPVKGSPFRTNAT------------------------------PAPPVQDA-ICPV--------VDVPRQHAAITPLSAI--------EAAGL----VRAYGDGLHRATAGRPAQFTIDSRDAPPAPLSVTIEGPAEAKINYMDNGDGTCGVEYLPVEPGPYVVNVLYKDTHIKGSPFPVRVVPPGREHV---DVSRVHAYGPGLQPTGVLKESFAKFTVDAKPVDPQGRGLVKAIVVSPTKQRTACIVKNNGDGTWSCSYSPIDDGLHHVEVTYDGAPVNGSPFPVNVAPGCDPSRVRAYGPGLEGGMTHELQRFTVDLDGAGQGALGLALEGPADAQIQCHDNKDGTCTVDYLPTKAGTYDVFVKFNDMNIPGSPFAVPIKDKVDPSRVRCYGPGLEPRGARAQQPATFTVDASQAGDAPIHVATVDRLGRST-PAHVVPRPGQPNIYDVTYVPATEGPCQIEVRQGQSHVARSPFTQHVLPAYEPQRVRVTGEGVHPSRPLGLPATQPTSFHVDTREAGMGDLELSVSDPEAQPLQLEVVDHGDGTYSCHYRPVVVGRHTVRVKFGGQEIPESPYLVPVAPSGRADLCRIESGNESRIPVGQECVITVNTAQAGIGQVTCRIITPSGAQADVEIHEAGNGRVNIYYTPPIRGDYLVEVRFGGDLVPNGRFNQKAVTADELTPEVVIQEERVQHVSTQSIHSSTLVTGYHPVDFKLPVGPTFSHVDGLVHTPSGRTMRPTLLDNGDGTVTAQFQPNEPGLHELEITYNGQPIPGSPFRFYVEA-VGSGNVTAYGPGLSYGRSGEPADFTLVTKEAGAGGLSLSVEGPSKAEIQCHDNKNGTCSVSYLPLVPGEYTISIKFMENHIPGSPFTAHIAGEPRRFNQVCVGTTSEMPLRITETDIYNLVATVRSPSGQEQPSTLKRLPNGHLGISFTPREIGEHYVNVFRNGRHIANSPFKIYVGENEIGNASRVRIYGNGLREGTANQNCQFTVDTRNAGYGSLSLSIEGPSKADIECHDNHDGTCLVTYRPTEPGTYIINVRYADQTVPGSPFVVQIGGEPSLRMMERITRQRELADVTHVGSQCELNLKIPGINIRDLVATVTSPTGVTQRCDVVALDDVNYTIRFVPQEMGVHTVSVRNRGAHIPGSPFQFTVGAITDGGAHKVHAAGPGLQQGLTYSPNDFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVSYRVTEPGEYQCSIRFNDEHIPGSPFRVVINEAIERTFLSP---------EMRQLSVATVQDRGLMIGRPTAFTVNYTGMT-GALRAYVVSPSGAHTDALVHRVDVDQHAVRFTPSENGPHLVHVLMDERPIPGSPFRVVVGQDDQGLVTASGEGLTHGRVGERNRFFVDTMHAGSGALSVTVDGPSKVQLNCNERPNGYEFSYLPFLPGEYLINIKYGDMQHIIGSPFKAYVTGDAIQETYAVDSTHVVVET--RASGMQQSLGESRPSRVICTGSGLQQAYLNQTNTFTVNATQAGHDVLYVGVSGPVVACEEVNIKHLGQGQYAVNYVVRDRGRHLIMVKWGEQHVPGSPFVVDV 2489          

HSP 2 Score: 157.532 bits (397), Expect = 3.142e-34
Identity = 123/416 (29.57%), Postives = 197/416 (47.36%), Query Frame = 2
Query: 3215 VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNE-KHIPGSPFTVPI--------------HDIVDV--------------SKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVID--TATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVL 4369
            V A G GL +G+  +P  F I + E     L + IEGP +A+ID+ D  DG+C V+Y   EPG Y  ++ +NDEHI  SPF V I    + +    ++ +++     +   G+     + FTVN   +     G ++A + +P    +   V       ++  ++P+ +G H + +  D  P+  SP+ V V Q  D   + A G GL  G   +  +F VD   AG G L ++++GP+  Q+ C +  +G     YLP  PG Y ++IK+ + +HI GSPF   +              H +V+               S+V C G GL++  + +   + FTV+A++AG   L V V     A + V    +      G + V Y+  + G   I V +    VPGSPFV +VL
Sbjct: 2089 VHAAGPGLQQGLTYSPNDFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVSYRVTEPGEYQCSIRFNDEHIPGSPFRVVINEAIERTFLSPEMRQLSVAT--VQDRGLMIGRPTAFTVNYTGM----TGALRAYVVSPSGAHTDALVHRVDVDQHAVRFTPSENGPHLVHVLMDERPIPGSPFRVVVGQ-DDQGLVTASGEGLTHGRVGERNRFFVDTMHAGSGALSVTVDGPSKVQLNCNERPNGY-EFSYLPFLPGEYLINIKYGDMQHIIGSPFKAYVTGDAIQETYAVDSTHVVVETRASGMQQSLGESRPSRVICTGSGLQQ--AYLNQTNTFTVNATQAGHDVLYVGVSGPVVACEEVNIKHL----GQGQYAVNYVVRDRGRHLIMVKWGEQHVPGSPFVVDVL 2490          

HSP 3 Score: 116.701 bits (291), Expect = 8.178e-22
Identity = 125/495 (25.25%), Postives = 210/495 (42.42%), Query Frame = 2
Query: 1037 NLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA-GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNS----DAKQ-AYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDD-ENIPKSPYMAQIQLD----TKLFD---------------------PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIP---VQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVI 2392
            +L   V +P G  + C++      ++ Y+  ++P   G + + ++   + IP SPF+  V     G   KV A+GPG++           F+++T EAG G +   I       +D + RKD               + Y   E G +  ++ F    I  SPF V+++     +    + +Q + AT   +Q  G+ +     F V+      A L   V  P  +     + +V    +   + P   GP++V +     PI  SPF V V    +  + A G GLT G V +   F V+T +  +GAL  ++ GPS+ +++C +  +G    +Y P +PGEY ++I   D ++I  SP+ A +  D    T   D                     P +V   G GL      N+   F VN   AG           V+G  +    V I+    G Y+  Y  +  G+H ++V +G  ++P SPF V+V+
Sbjct: 2021 DLVATVTSPTGVTQRCDVVAL--DDVNYTIRFVPQEMGVHTVSVRNRGAHIPGSPFQFTVGAITDGGAHKVHAAGPGLQ--QGLTYSPNDFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKD-----------GSCGVSYRVTEPGEYQCSIRFNDEHIPGSPFRVVINEAIERTFLSPEMRQLSVAT---VQDRGLMIGRPTAFTVNYTGMTGA-LRAYVVSPSGAHTDALVHRVDVDQHAVRFTPSENGPHLVHVLMDERPIPGSPFRVVVGQDDQGLVTASGEGLTHGRVGERNRFFVDTMHAGSGALSVTVDGPSKVQLNCNERPNGY-EFSYLPFLPGEYLINIKYGDMQHIIGSPFKAYVTGDAIQETYAVDSTHVVVETRASGMQQSLGESRPSRVICTGSGLQQAY-LNQTNTFTVNATQAGH----DVLYVGVSGPVVACEEVNIKHLGQGQYAVNYVVRDRGRHLIMVKWGEQHVPGSPFVVDVL 2490          
BLAST of Filamin vs. TrEMBL
Match: A0A4E0RU07 (Filamin-A OS=Fasciola hepatica OX=6192 GN=D915_004146 PE=4 SV=1)

HSP 1 Score: 2848.54 bits (7383), Expect = 0.000e+0
Identity = 1438/2535 (56.73%), Postives = 1806/2535 (71.24%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSN----------------------------------SDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILT----PFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPK-STPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYA-----FQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX-----XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQK-GPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            +AERELAEDA+WK+IQKNTFTRWAN+HL+P NLI+DDLQYD ADGLKLI LV+ LSG  F+H +++P+FRTQKLENVTMVLRFLEE+EGLRLVNIDS+DI DCR KLILGLIWTLILHYSIT+PLWEGE      GQG+GP+PKQRLL W+N+K+  +PVKNFT+DWNDGTAIGALVDACAPGLCP+W QW+PKQ L+NA+EA+N AE+ L+V  LI+P EMINP+VDEKAMMTYLSQFP+A+L   APL PK+    VRAYGPGLE  GNT+GNPA FT+DTF+AG+G +++IVLNPKGQ+EPC+I  + +++  YSC+Y+PT EGEYR+IIKFA  EI NSPFKV V+ A GD SK +ASGPGIEP GN+ GRRTFFN+FTA AGPG+VDCVILD  G +DS+KP ITKQ E+ +L+EYT K+EGLHSVNVFFAG QI  SPFGVMV  K S                                    D KQAYATGRGIQP+GVRVRD+A+F+VHTEDAG   L V V  P      C ++K    L++C+Y PQR GP+ V ++YG + I LSPFNVDV PYK+S+I+AFGPGLTGG+V+KPA F VETNGETGALGFSI+GPSEA+IDC DNGDGSA V YWPTVPGEYAVHILC+DENIPKSPYM  I+ D    DP +V  +GPG+  +G    +P +F V+ ++AG P+ +  EC D  G+ + +++RDN DGTY+C YTPK+P KHT++VSYG VN+P SPF+V+V E      ++V+GPG+E       T+F VDCKLAG G++GIS+ DE  RDVP+ T D  DGTF + YT  T GPTYT+ +FF+  E+P+SPF+VP++ + D  K  + NL+ + P+G+  EF+++T    P   SK +P ++VK PNG R+P  + E+ +GF   FTPTV+GPH+V V+  G P+  SP+      R N    P  +  +    D            +P Q A +TP+                                E A L    V AYG+GL +  A  PA F IDS + PPAPL VTIEGP EAKI+Y+DNGDGTC V YLP EPG Y+VNVLY D HIK SPF V + P  +      DV++V AYGPGL PTGV K+SF+KFTV+AKP+D  G+G+VKAI+ +P  QR+ C V NN DGT+SCSYSP  DG H +++TYDG PV  SP+ V V  G DPSR+RAYGPGLE G+T + Q+FTVDL+GAGQG LGL++EGPADAQIQC DNKDGTC+V YLP K G+YDV +KFN+ +IPGSPF VPI D VD S+V+CYGPGLE  G+R   P+ FTVDAS+AG+AP+ V  +D   +S  PA ++P+   P ++DVTY+P   G C+IEV      V  SPF Q+VL + EP++V VTGEGV P R   +    P+ F ++TR+AG  DLEL V+ P  + + L+V +HGDGT++C Y+  V G +TV+V +G + +P SP++VPV    + + C IE    + +PVG+   I VNT  AG G ++ + + P G      I     G   + Y P   G Y V++ F  + +PNG   Q A       P+     ER  H  T       + T Y  VDFK PVGP F +V  +V+ PS R   P L++NGDGT+T Q+QP+E GLHELE+ YNGQPI GSPF+FYV++ + SG VTAYGPGLSYGR    A FT+VTK+AGAGGLSL+VEGPSKAEIQC DNKNGTC VSYLPL PG+Y I IKFM+ HI GSPFTA I GEP++ +Q+CVGTTS++PLRI+ETDI NL A V SP+G+E+  TLKRL NG+LGISFTP+E+GEH VNV R+GRHI NSPFKI+VGENEIGNASRV++YG+GL +G  N+ CQF VDTRNAGYG LSLSIEGPSK +IECHDNHDGTCLVTY+PTEPGTYIINV+YAD  VPGSPF V IGG PS  + ERI R ++ A+V+ +G+ CELNL IPG N R+  A+V SP+G  + C+++AL D  ++IRF+P+E+GVHTVSV++   H+ GSPFQFTVG + DGG HKVH  G G+++GL    N F+IYTREAGAG LSIAIEGPSKAEIDF+D KDGSCGV+YRV EPG+Y CSI+FNDEH+PGSP+ + I+E    ++  P         + R +S+A +QD+G  IG    F +NY G+T G++ AYV+SPS     A + ++D +Q++V F P ENG H VHVL++  PIPGSPFRVV      G VT SGEG+ HG  G  N FFVDT +AG+GAL+VT+DGPSKVQLNC E  +GY F+Y+P  PG+Y I+IKYG   HIIGSPF   ++G+  Q   ++  T  + +T    SG  Q  G S+P  V C G GL+ A + + N F V+A  AG DVLYVGVSGPV  CEEVNIKHLG  ++ VNY V+++GRHL+MV+WG   VPGSPF + V
Sbjct:   26 MAERELAEDAEWKLIQKNTFTRWANEHLRPKNLIVDDLQYDFADGLKLIGLVEALSGQQFKHVNRKPSFRTQKLENVTMVLRFLEENEGLRLVNIDSTDIVDCRSKLILGLIWTLILHYSITIPLWEGE---VDHGQGQGPTPKQRLLSWLNNKLVDRPVKNFTSDWNDGTAIGALVDACAPGLCPDWRQWEPKQNLRNAREAMNAAEQWLDVPQLIRPEEMINPRVDEKAMMTYLSQFPSAKLKEGAPLRPKSTPEMVRAYGPGLERHGNTVGNPARFTIDTFSAGRGGVEVIVLNPKGQREPCDILSNNDRQQTYSCAYVPTQEGEYRVIIKFATKEILNSPFKVMVEGAQGDASKASASGPGIEPQGNQAGRRTFFNIFTAAAGPGNVDCVILDPHGGRDSIKPVITKQGEDNYLVEYTPKDEGLHSVNVFFAGQQIPKSPFGVMVGPKPSAPLLMQPPTPLMTGSEEPIQAMQAPRKMSAPRRPACDPKQAYATGRGIQPQGVRVRDLADFKVHTEDAGEGPLEVAVIAPDGREIPCNVRKTGAYLFDCNYTPQRAGPHQVHVRYGGDHIMLSPFNVDVGPYKDSRIRAFGPGLTGGVVNKPAVFVVETNGETGALGFSIEGPSEARIDCTDNGDGSATVAYWPTVPGEYAVHILCNDENIPKSPYMVPIEPDMGKCDPERVKVHGPGVQPTGNVAGQPTEFTVDIRDAGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCNYTPKVPRKHTILVSYGAVNVPRSPFRVDVAEPSQPGKVRVFGPGVESVIRGQPTHFTVDCKLAGQGNVGISITDEMGRDVPMDTQDMRDGTFRVAYTAHTPGPTYTVHVFFNNQEVPRSPFRVPVKPNIDMSKIHVENLSPSIPVGKPTEFDVITAGAGPPSNSKPQPNVVVKGPNGMRIPSTMTESVDGFTPSFTPTVVGPHSVAVDVGGVPVKGSPF------RTNATPAPPVQDAICPVVD------------VPRQHAAITPLS-----------------------------ALEAAGL----VRAYGDGLHRATAGRPAQFTIDSRDAPPAPLSVTIEGPAEAKINYMDNGDGTCGVEYLPVEPGPYVVNVLYKDTHIKGSPFPVRVVPPGREHV---DVSRVHAYGPGLQPTGVLKESFAKFTVDAKPVDPQGRGLVKAIVVSPTKQRTACIVKNNGDGTWSCSYSPIDDGLHHVEVTYDGAPVNGSPFPVNVAPGCDPSRVRAYGPGLEGGMTHELQRFTVDLDGAGQGALGLALEGPADAQIQCHDNKDGTCTVDYLPTKAGTYDVFVKFNDMNIPGSPFAVPIKDKVDPSRVRCYGPGLEPRGARAQQPATFTVDASQAGDAPIHVATVDRLGRST-PAHVVPRPGQPNIYDVTYVPATEGPCQIEVRQGQSHVARSPFTQHVLPAYEPQRVRVTGEGVHPSRPLGLPATQPTSFHVDTREAGMGDLELSVSDPEAQPLQLEVVDHGDGTYSCHYRPIVVGRHTVRVKFGGQEIPESPYLVPVAPSGRADLCRIESGNESRIPVGQECVITVNTAQAGIGQVTCRIITPSGAQADVEIHEAGNGRVNIYYTPPIRGDYLVEVRFGGDLVPNGRFNQRAVTADELTPEVVIQEERVQHMSTQSIHSSTLVTGYHPVDFKLPVGPTFSHVDGLVHTPSGRTMRPTLLDNGDGTVTAQFQPNEPGLHELEITYNGQPIPGSPFRFYVEA-VGSGNVTAYGPGLSYGRSGEPADFTLVTKEAGAGGLSLSVEGPSKAEIQCHDNKNGTCSVSYLPLVPGEYTISIKFMENHIPGSPFTAHIAGEPRRFNQVCVGTTSEMPLRITETDIYNLVATVRSPSGQEQPSTLKRLPNGHLGISFTPREIGEHYVNVFRNGRHIANSPFKIYVGENEIGNASRVRIYGNGLREGTANQNCQFTVDTRNAGYGSLSLSIEGPSKADIECHDNHDGTCLVTYRPTEPGTYIINVRYADQTVPGSPFVVQIGGEPSLRMMERITRQRELADVTHVGSQCELNLKIPGINIRDLVATVTSPTGVTQRCDVVALDDVNYTIRFVPQEMGVHTVSVRNRGAHIPGSPFQFTVGAITDGGAHKVHAAGPGLQQGLTYSPNDFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVSYRVTEPGEYQCSIRFNDEHIPGSPYRVVINEAIERTFLSP---------EMRQLSVATVQDRGLMIGRPTAFTVNYTGMT-GALRAYVVSPSGAHTDALVHRVDVDQHAVRFTPSENGPHLVHVLMDERPIPGSPFRVVVGQDDQGLVTASGEGLTHGRVGERNRFFVDTMHAGSGALSVTVDGPSKVQLNCNERPNGYEFSYLPFLPGEYLINIKYGDMQHIIGSPFKAYVTGDAIQETYAVDSTHVVVET--RASGMQQSLGESRPSRVICTGSGLQQAYLNQTNTFTVNATQAGHDVLYVGVSGPVVACEEVNIKHLGQGQYAVNYVVRDRGRHLIMVKWGEQHVPGSPFVVDV 2489          

HSP 2 Score: 156.377 bits (394), Expect = 7.991e-34
Identity = 122/416 (29.33%), Postives = 197/416 (47.36%), Query Frame = 2
Query: 3215 VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNE-KHIPGSPFTVPI--------------HDIVDV--------------SKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVID--TATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVL 4369
            V A G GL +G+  +P  F I + E     L + IEGP +A+ID+ D  DG+C V+Y   EPG Y  ++ +NDEHI  SP+ V I    + +    ++ +++     +   G+     + FTVN   +     G ++A + +P    +   V       ++  ++P+ +G H + +  D  P+  SP+ V V Q  D   + A G GL  G   +  +F VD   AG G L ++++GP+  Q+ C +  +G     YLP  PG Y ++IK+ + +HI GSPF   +              H +V+               S+V C G GL++  + +   + FTV+A++AG   L V V     A + V    +      G + V Y+  + G   I V +    VPGSPFV +VL
Sbjct: 2089 VHAAGPGLQQGLTYSPNDFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVSYRVTEPGEYQCSIRFNDEHIPGSPYRVVINEAIERTFLSPEMRQLSVAT--VQDRGLMIGRPTAFTVNYTGM----TGALRAYVVSPSGAHTDALVHRVDVDQHAVRFTPSENGPHLVHVLMDERPIPGSPFRVVVGQ-DDQGLVTASGEGLTHGRVGERNRFFVDTMHAGSGALSVTVDGPSKVQLNCNERPNGY-EFSYLPFLPGEYLINIKYGDMQHIIGSPFKAYVTGDAIQETYAVDSTHVVVETRASGMQQSLGESRPSRVICTGSGLQQ--AYLNQTNTFTVNATQAGHDVLYVGVSGPVVACEEVNIKHL----GQGQYAVNYVVRDRGRHLIMVKWGEQHVPGSPFVVDVL 2490          

HSP 3 Score: 115.161 bits (287), Expect = 2.113e-21
Identity = 124/495 (25.05%), Postives = 210/495 (42.42%), Query Frame = 2
Query: 1037 NLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA-GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNS----DAKQ-AYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDD-ENIPKSPYMAQIQLD----TKLFD---------------------PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIP---VQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVI 2392
            +L   V +P G  + C++      ++ Y+  ++P   G + + ++   + IP SPF+  V     G   KV A+GPG++           F+++T EAG G +   I       +D + RKD               + Y   E G +  ++ F    I  SP+ V+++     +    + +Q + AT   +Q  G+ +     F V+      A L   V  P  +     + +V    +   + P   GP++V +     PI  SPF V V    +  + A G GLT G V +   F V+T +  +GAL  ++ GPS+ +++C +  +G    +Y P +PGEY ++I   D ++I  SP+ A +  D    T   D                     P +V   G GL      N+   F VN   AG           V+G  +    V I+    G Y+  Y  +  G+H ++V +G  ++P SPF V+V+
Sbjct: 2021 DLVATVTSPTGVTQRCDVVAL--DDVNYTIRFVPQEMGVHTVSVRNRGAHIPGSPFQFTVGAITDGGAHKVHAAGPGLQ--QGLTYSPNDFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKD-----------GSCGVSYRVTEPGEYQCSIRFNDEHIPGSPYRVVINEAIERTFLSPEMRQLSVAT---VQDRGLMIGRPTAFTVNYTGMTGA-LRAYVVSPSGAHTDALVHRVDVDQHAVRFTPSENGPHLVHVLMDERPIPGSPFRVVVGQDDQGLVTASGEGLTHGRVGERNRFFVDTMHAGSGALSVTVDGPSKVQLNCNERPNGY-EFSYLPFLPGEYLINIKYGDMQHIIGSPFKAYVTGDAIQETYAVDSTHVVVETRASGMQQSLGESRPSRVICTGSGLQQAY-LNQTNTFTVNATQAGH----DVLYVGVSGPVVACEEVNIKHLGQGQYAVNYVVRDRGRHLIMVKWGEQHVPGSPFVVDVL 2490          
BLAST of Filamin vs. TrEMBL
Match: A0A4S2L3S3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010478 PE=4 SV=1)

HSP 1 Score: 2816.95 bits (7301), Expect = 0.000e+0
Identity = 1423/2501 (56.90%), Postives = 1800/2501 (71.97%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILT----PFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPK-STPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYS--IERTTHHYTTE--QSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFR-----XXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPS--KPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            +AERELAEDA+WK+IQKNTFTRWAN+HLKP N+ ++DLQYDLADGL+LI LV+ LSG  F+H +++P+FRTQKLENVTMVLRFLEE+EGLRLVNIDS+DI DCR KLILGLIWTLILHYSIT+PLWEGE  +   GQG+GP+PKQRLL W+N+K+  +PVKNFTTDWNDGTAIGALVDACAPGLCP+W QW+PKQ L+NA+EA+N AE+ L+V  LI+P EMINP+VDEKAMMTYLSQFP+A+L   APL PK+    VRAYGPGL+  GNT+GNPA FT+DTF+AG+G +++IVLNPKGQ+EPCEI  + +++  YSC+Y+PT EGEYR+IIKFA  EI NSPFKV V+ AAGD SK TASGPGIEP GN+ GRRTFFN+FTA AGPG+VDCVILD  G +DS+KP ITKQ E+ +L+EYT ++EGLHSVNVFFAG QI +SPFGVMV       DAKQAYATGRGIQP+GVRV+D+A+F+VHTEDAG   L V V  P      C  +K    L++CSY PQR G + V ++YG + I LSPFNVDV PYK+S+I+AFGPGL+GG+V+KPA F VETNGETGALGFSI+GPSEA+IDC DNGDGSA V YWPT PGEYAVHILC+DENIPKSP+M  I+ D    DP +V  +GPG++ +G    +P +F+V+ ++AG P+ +  EC D  G+ + +++RDN DGTY+C YTPK+P KHTV+VSYG VN+P SPF+V V E      ++V+GPG+E       T+F VDCK AG G++GISV DE  RDV + T D  DGTF + YT  T GPTYT+ +FF+  E+P+SPF+VP++ + D  K  + NL+   P+G+  EF+++T    P   +K RP ++VKSP+G RVP  + ET +GF   FTPTV GPHT+ V+  G P+  SP++  AT  V  +E      P+     Y + N       +     +++P+E + +                                    V AYG+GL    +  PA F IDS + PPAPL VTIEGP EAKI+Y DNGDGTC V YLP EPG Y VNVLY D HIK SPF V + P  +      DV++V AYGPGL PTGV K+SF+KFTV+AKP+D  G G+VKAI+ NP  QR+ C V NN DGT+ CSYSP  DG H I++TYDG PV  SP+ V V  G DPSR+R YGPGLE G+T + Q+FTVDL+GAGQG LGL+IEGPADAQIQC DNKDGTC+V YLP K G YDV +KFN+ ++PGSPF VPI D VD S+V+CYGPGLE  G+R   P+ FTVDAS+AG+AP+ V  +D   +S  PA  +P+ S PG++DVTY+P   G C+IEV   +  V  SPF Q+VL + EP++V VTGEGV P R   +   +P+ F ++TRDAG  DLEL V+ P  + + L+V +HGDGT+TC Y+  + G +TV+V +G + +P SPF+VPV    + + C IE      VPVG+   I VNT  AG G ++ + V P G      I+    G   V Y P   G Y V++ F  + +PNG   Q A    E  S  +E    H TT   QS  I+ T Y  VDFK PVGP+F +V  +V  PS R   P LI+NGDGT+T Q+QP+E GLHELE+ YN QPI GSPF+FYV++ + SG V+AYGPGLSYGR    A FT++T++AGAGGLSL+VEGPSKAEIQC DNKNGTC VSYLPL PG+Y I IKFM++HI GSPFTA + GE ++ +Q+CVGTTS++PLRI+ETDI NL A V SP+G+E+  +LKRL NG+LGISFTP+E+GEH VNV R+GRHI NSPFKI+VGE EIGNAS+V++YG+GL++G  N+ CQF VDTRNAGYG LSLSIEGPSK +IECHDNHDGTCLVTY+PTEPGTYIINVKYAD  V GSPF V+IGG PS  + ERI R ++ A+V+ +G+ CELNL IPG + R+ TA+V SPSG  + C+++ + D  ++IRF+P+E+GVHTVSV+    H+ GSPFQFTVG + DGG HKVH  G G++ GL    N+F+IYTREAGAG LSIAIEGPSKAEIDF+D KDGSCG++YRV EPG+Y CS++FNDE++PGSPF + I+E    ++  P         + R +S+AA+QD+G  IG    F +NY G T G++ AY +SPS  +  A + ++D +Q+ V F P ENG H VHVL++  PIPGSPFR       +G VT SGEG+ HG  G  N FFV+T+ AG+GAL+VT+DGPSKV+LNC E   GY FTY+P APGDY I+I++G   HIIGSPF   ++G+  Q   +   T  + +T    +   Q+  S  +P  V C G GL  A + + N F V+A  AG DVLYVGVSGPV  CEEVNIKHLG  ++ VNY V+++G+HL+M++WG+  VPGSPF + V
Sbjct:   25 MAERELAEDAEWKLIQKNTFTRWANEHLKPKNVTVEDLQYDLADGLRLIGLVEALSGQQFKHVNRKPSFRTQKLENVTMVLRFLEENEGLRLVNIDSTDIVDCRSKLILGLIWTLILHYSITIPLWEGEIDH---GQGQGPTPKQRLLSWLNNKLVDRPVKNFTTDWNDGTAIGALVDACAPGLCPDWRQWEPKQNLRNAREAMNAAEQWLDVPQLIRPEEMINPRVDEKAMMTYLSQFPSAKLKEGAPLRPKSTPELVRAYGPGLQPHGNTVGNPARFTIDTFSAGRGQVEVIVLNPKGQREPCEILTNNDRQQTYSCAYVPTQEGEYRVIIKFATKEILNSPFKVMVEGAAGDASKATASGPGIEPQGNQAGRRTFFNIFTAAAGPGNVDCVILDPHGGRDSIKPVITKQGEDNYLVEYTPRDEGLHSVNVFFAGQQIPNSPFGVMVGPM---CDAKQAYATGRGIQPQGVRVKDLADFKVHTEDAGEGPLEVAVIAPDGREIPCTTRKTGAYLFDCSYNPQRAGLHQVHVRYGGDHIMLSPFNVDVGPYKDSRIRAFGPGLSGGVVNKPAVFVVETNGETGALGFSIEGPSEARIDCTDNGDGSATVAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDMGKCDPDRVKVHGPGVLPTGNVAGQPTEFVVDIRDAGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCSYTPKVPRKHTVLVSYGTVNVPRSPFRVEVAEPSQPGKVRVFGPGVESVVRGEPTHFTVDCKQAGQGNVGISVTDETGRDVAMDTQDMRDGTFRVAYTANTPGPTYTVHVFFNNQEVPRSPFRVPVKPNIDMSKIHVENLSPNIPVGKPTEFDVITAGAGPPSNNKPRPNVVVKSPSGMRVPCTMAETVDGFTPSFTPTVAGPHTIAVDIAGMPVKGSPFRTQATPEVAIQE------PI-----YPVANAVQKHAPV----TQMSPIEAAGL------------------------------------VRAYGDGLHHATSGRPAHFTIDSRDAPPAPLSVTIEGPAEAKINYADNGDGTCGVEYLPMEPGPYTVNVLYKDIHIKGSPFPVRVAPPGREHI---DVSRVHAYGPGLQPTGVLKESFAKFTVDAKPVDPQGHGLVKAIVVNPHKQRTACLVQNNGDGTWKCSYSPVDDGLHHIEVTYDGAPVQGSPFPVNVAPGCDPSRVRVYGPGLEGGLTHELQRFTVDLDGAGQGALGLAIEGPADAQIQCHDNKDGTCTVDYLPTKAGPYDVFVKFNDMNVPGSPFQVPIRDRVDPSRVRCYGPGLEPRGARAQQPATFTVDASQAGDAPIYVATVDRLGRST-PAHTVPRPSQPGVYDVTYVPATEGPCQIEVRQGSAHVARSPFTQHVLPAFEPQRVRVTGEGVHPTRPLGLPATLPTSFHVDTRDAGMGDLELSVSDPEAQPLQLEVVDHGDGTYTCHYRPIIVGRHTVRVKFGGQEIPESPFLVPVAPSGRADLCRIESGNDGRVPVGQECVITVNTLQAGLGQVTCRIVTPSGATADVEIQEAPNGRVNVYYTPPIRGDYLVEVRFGGDLVPNGRFNQRAVTTDELISDTVEERVQHVTTHSVQSSTIV-TGYHPVDFKLPVGPMFSHVEGLVRTPSGRTVQPNLIDNGDGTVTAQFQPTEPGLHELEITYNRQPIPGSPFRFYVEA-VGSGNVSAYGPGLSYGRAGEPAEFTLITREAGAGGLSLSVEGPSKAEIQCHDNKNGTCSVSYLPLVPGEYTISIKFMERHIPGSPFTAHVGGETRRFNQVCVGTTSEMPLRITETDIYNLVATVRSPSGQEQPSSLKRLPNGHLGISFTPREIGEHYVNVFRNGRHIANSPFKIYVGEGEIGNASKVRIYGNGLHEGTANQNCQFTVDTRNAGYGSLSLSIEGPSKADIECHDNHDGTCLVTYRPTEPGTYIINVKYADQLVNGSPFVVHIGGEPSLRMMERITRQRELADVTHVGSQCELNLKIPGISLRDLTATVTSPSGVTQRCDVMPIDDVNYTIRFVPQEMGVHTVSVRHRGSHIPGSPFQFTVGAITDGGAHKVHAAGPGLQHGLTYTPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGISYRVTEPGEYQCSVRFNDENIPGSPFRVIINEAMERTFYSP---------EIRQLSVAAVQDRGLQIGRPTAFTVNYTG-TSGTLRAYAVSPSGVQIPAYVHQVDIDQHGVRFTPQENGPHLVHVLMDERPIPGSPFRIIVGQEDLGLVTASGEGLTHGRVGEKNRFFVNTTQAGSGALSVTVDGPSKVKLNCTERPDGYEFTYLPLAPGDYMINIRHGDQRHIIGSPFKAYVTGDAVQDIYNADTTHVVVETGSRFATGPQRSVSEARPDKVICTGSGLHQAFLNQTNTFNVNATQAGHDVLYVGVSGPVVACEEVNIKHLGLGQYAVNYLVRDRGQHLIMIKWGDEHVPGSPFVVNV 2452          

HSP 2 Score: 125.946 bits (315), Expect = 1.383e-24
Identity = 131/502 (26.10%), Postives = 207/502 (41.24%), Query Frame = 2
Query: 1037 NLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA-GDPSKVTASGPGIEP----VGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNS----DAKQAYATGRGIQPEGVRVRDVAEFQV-HTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIV-SKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDE-NIPKSPYMAQI----------------------------QLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIP---VQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVI 2392
            +L   V +P G  + C++   P  ++ Y+  ++P   G + + ++   S IP SPF+  V     G   KV A+GPG++       NE      F+++T EAG G +   I       +D + RKD               I Y   E G +  +V F    I  SPF V+++     +    + +Q       +Q  G+++     F V +T  +G   L      P        + +V    +   + PQ  GP++V +     PI  SPF + V       + A G GLT G V  K  FF   T   +GAL  ++ GPS+ K++C +  DG    TY P  PG+Y ++I   D+ +I  SP+ A +                            Q       P KV   G GL      N+   F VN   AG           V+G  +    V I+    G Y+  Y  +  G+H +++ +G+ ++P SPF VNV+
Sbjct: 1981 DLTATVTSPSGVTQRCDVM--PIDDVNYTIRFVPQEMGVHTVSVRHRGSHIPGSPFQFTVGAITDGGAHKVHAAGPGLQHGLTYTPNE------FSIYTREAGAGGLSIAIEGPSKAEIDFEDRKD-----------GSCGISYRVTEPGEYQCSVRFNDENIPGSPFRVIINEAMERTFYSPEIRQLSVAA--VQDRGLQIGRPTAFTVNYTGTSG--TLRAYAVSPSGVQIPAYVHQVDIDQHGVRFTPQENGPHLVHVLMDERPIPGSPFRIIVGQEDLGLVTASGEGLTHGRVGEKNRFFVNTTQAGSGALSVTVDGPSKVKLNCTERPDGY-EFTYLPLAPGDYMINIRHGDQRHIIGSPFKAYVTGDAVQDIYNADTTHVVVETGSRFATGPQRSVSEARPDKVICTGSGLHQAF-LNQTNTFNVNATQAGH----DVLYVGVSGPVVACEEVNIKHLGLGQYAVNYLVRDRGQHLIMIKWGDEHVPGSPFVVNVV 2453          
BLAST of Filamin vs. TrEMBL
Match: G7Y5W0 (Filamin OS=Clonorchis sinensis OX=79923 GN=CLF_101494 PE=4 SV=1)

HSP 1 Score: 2811.56 bits (7287), Expect = 0.000e+0
Identity = 1423/2542 (55.98%), Postives = 1804/2542 (70.97%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNS------------------------------------------DAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILT----PFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPK-STPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYS--IERTTHHYTTEQSKP-IIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXX-----XXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQK--GPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            +AERELAEDA+WK+IQKNTFTRWAN+HLKP N+ +DDLQYDLADGL+LI LV+ LSG  F+H +++P+FRTQKLENVTMVLRFLEE+EGLRLVNIDS+DI DCR KLILGLIWTLILHYSIT+PLWEGE  +   GQG+GP+PKQRLL W+N+K+  +PVKNFTTDWNDGTAIGALVDACAPGLCP+W QW+PKQ L+NA+EA+N AE+ L+V  LI+P EMINP+VDEKAMMTYLSQFP+A+L   APL PK+    VRAYGPGL+  GNT+GNPA FT+DTF+AG+G +++IVLNPKGQ+EPCEI  + +++  YSC+Y+PT EGEYR+IIKFA  EI NSPFKV V+ AAGD SK TASGPGIEP GN+ GRRTFFN+FTA AGPG+VDCVILD  G +DS+KP ITKQ E+ +L+EYT ++EGLHSVNVFFAG QI +SPFGVMV  K +                                            DAKQAYATGRGIQP+GVRV+D+A+F+VHTEDAG   L V V  P      C  +K    L++CSY PQR G + V ++YG + I LSPFNVDV PYK+S+I+AFGPGL+GG+V+KPA F VETNGETGALGFSI+GPSEA+IDC DNGDGSA V YWPT PGEYAVHILC+DENIPKSP+M  I+ D    DP +V  +GPG++ +G    +P +F+V+ ++AG P+ +  EC D  G+ + +++RDN DGTY+C YTPK+P KHTV+VSYG VN+P SPF+V V E      ++V+GPG+E       T+F VDCK AG G++GISV DE  RDV + T D  DGTF + YT  T GPTYT+ +FF+  E+P+SPF+VP++ + D  K  + NL+   P+G+  EF+++T    P   +K RP ++VKSP+G RVP  + ET +GF   FTPTV GPHTV V+  G P+  SP+++ AT  V  +E      P+     Y + N       +     +++P+E S +                                    V AYG+GL    +  PA F IDS + PPAPL VTIEGP EAKI+Y DNGDGTC V YLP EPG Y VNVLY D HIK SPF V + P  +      DV++V AYGPGL PTGV K+SF+KFTV+AKP+D  G G+VKAI+ NP  QR+ C V NN DGT+ CSYSP  DG H I++TYDG PV  SP+ V V  G DPSR+R YGPGLE G+T + Q+FTVDL+GAGQG LGL+IEGPADAQIQC DNKDGTC+V YLP K G YDV +KFN+ ++PGSPF VPI D VD S+V+CYGPGLE  G+R   P+ FTVDAS+AG+AP+ V  +D   +S  PA  +P+ S PG++DVTY+P   G C+IEV   +  V  SPF Q+VL + EP++V VTGEGV P R   +    P+ F ++TRDAG  DLEL V+ P  + + L+V +HGDGT+TC Y+  + G +TV+V +G + +P SPF+VPV    + + C IE      VPVG+   I VNT  AG G ++ + V P G      I+    G   + Y P   G Y V++ F  + +PNG   Q A    E  S  +E    H TT   +   I T Y  VDFK PVGP+F +V  +V  PS R   P LI+NGDGT+T Q+QP+E GLHELE+ YNGQPI GSPF+FYV++ + SG V+AYGPGLSYGR    A FT+VT++AGAGGLSL+VEGPSKAEIQC DNKNGTC VSYLPL PG+Y I IKFM++HI GSPFTA + GE ++ +Q+CVGTTS++PLRI+ETDI NL A V SP+G+E+  +LKRL NG+LGISFTP+E+GEH VNV R+GRHI NSPFKI+VGE EIGNAS+V++YG+GL++G  N+ CQF VDTRNAGYG LSLSIEGPSK +IECHDNHDGTCLVTY+PTEPGTYIINVKYAD  V GSPF V+IGG PS  + ERI R ++ A+V+ +G+ CELNL IPG + R+ TA+V SPSG  + C+++ + D  ++IRF+P+E+GVHTVSV+    H+ GSPFQFTVG + DGG HKVH  G G++ GL    N+F+IYTREAGAG LSIAIEGPSKAEIDF+D KDGSCG++YRV EPG+Y CS++FNDE++PGSPF + I+E    ++  P         + R +S+AA+QD+G  IG    F +NY G++ G++ AY +SPS  +  A + ++D +Q+ V F P ENG H VHVL++  PIPGSPFR++VG+      T SGEG+ HG  G  N FFV+T+ AG+GAL+VT+DGPSKV+LNC E   GY FTY+P APGDY I+I++G   HIIGSPF   ++G+  Q   +   T  + +T   ++   Q+     +P  V C G GL  A + + N F V+A  AG DVLYVGVSGPV  CEEVN+KHLG  ++ VNY V+++G+HL+M++WG+  VPGSPF + V
Sbjct:   25 MAERELAEDAEWKLIQKNTFTRWANEHLKPKNVTVDDLQYDLADGLRLIGLVEALSGQQFKHVNRKPSFRTQKLENVTMVLRFLEENEGLRLVNIDSTDIVDCRSKLILGLIWTLILHYSITIPLWEGEIDH---GQGQGPTPKQRLLSWLNNKLVDRPVKNFTTDWNDGTAIGALVDACAPGLCPDWRQWEPKQNLRNAREAMNAAEQWLDVPQLIRPEEMINPRVDEKAMMTYLSQFPSAKLKEGAPLRPKSTPELVRAYGPGLQPHGNTVGNPARFTIDTFSAGRGQVEVIVLNPKGQREPCEILTNNDRQQTYSCAYVPTQEGEYRVIIKFATKEILNSPFKVMVEGAAGDASKATASGPGIEPQGNQAGRRTFFNIFTAAAGPGNVDCVILDPHGGRDSIKPVITKQGEDNYLVEYTPRDEGLHSVNVFFAGQQIPNSPFGVMVGPKPAVQPPIQPSLQPLIQSPAPIMPSREEPIQAMTAPRKMSVPKRPVCDAKQAYATGRGIQPQGVRVKDLADFKVHTEDAGEGPLEVAVIAPDGREIPCTTRKTGAYLFDCSYNPQRAGLHQVHVRYGGDHIMLSPFNVDVGPYKDSRIRAFGPGLSGGVVNKPAVFVVETNGETGALGFSIEGPSEARIDCTDNGDGSATVAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDMGKCDPDRVKVHGPGVMPTGNVAGQPTEFVVDIRDAGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCSYTPKVPRKHTVLVSYGTVNVPRSPFRVEVAEPSQPGKVRVFGPGVESVVRGEPTHFTVDCKQAGQGNVGISVTDETGRDVAMDTQDMRDGTFRVAYTANTPGPTYTVHVFFNNQEVPRSPFRVPVKPNIDMSKIHVENLSPNIPVGKSTEFDVITAGAGPPSNNKPRPNVVVKSPSGMRVPCTMAETVDGFTPSFTPTVAGPHTVAVDIAGMPVKGSPFRIQATPEVAIQE------PI-----YPVANAVQKHAPV----TQMSPIEASGL------------------------------------VRAYGDGLHHATSGRPAHFTIDSRDAPPAPLSVTIEGPAEAKINYADNGDGTCGVEYLPMEPGPYTVNVLYKDIHIKGSPFPVRVAPPGREHI---DVSRVHAYGPGLQPTGVLKESFAKFTVDAKPVDPQGHGLVKAIVVNPHKQRTACLVQNNGDGTWKCSYSPVDDGLHHIEVTYDGAPVQGSPFPVNVAPGCDPSRVRVYGPGLEGGLTHELQRFTVDLDGAGQGALGLAIEGPADAQIQCHDNKDGTCTVDYLPTKAGPYDVFVKFNDMNVPGSPFQVPIRDRVDPSRVRCYGPGLEPRGARAQQPATFTVDASQAGDAPIYVATVDRLGRST-PAHTVPRPSQPGVYDVTYVPATEGPCQIEVRQGSAHVARSPFTQHVLPAFEPQRVRVTGEGVHPTRPLGLPATQPTSFHVDTRDAGMGDLELSVSDPEAQPLQLEVVDHGDGTYTCHYRPIIVGRHTVRVKFGGQEIPESPFLVPVAPSGRADLCRIESGNDGRVPVGQECVITVNTLQAGLGQVTCRIVTPSGATADVEIQEAPNGRVNIYYTPPIRGDYLVEVRFGGDLVPNGRFNQRAVTTDELISDTVEERVQHVTTHSVQSSTIMTGYHPVDFKLPVGPMFSHVEGLVRTPSGRTVQPNLIDNGDGTVTAQFQPTEPGLHELEITYNGQPIPGSPFRFYVEA-VGSGNVSAYGPGLSYGRAGEPAEFTLVTREAGAGGLSLSVEGPSKAEIQCHDNKNGTCSVSYLPLVPGEYTISIKFMERHIPGSPFTAHVGGETRRFNQVCVGTTSEMPLRITETDIYNLVATVRSPSGQEQPSSLKRLPNGHLGISFTPREIGEHYVNVFRNGRHIANSPFKIYVGEGEIGNASKVRIYGNGLHEGTANQNCQFTVDTRNAGYGSLSLSIEGPSKADIECHDNHDGTCLVTYRPTEPGTYIINVKYADQLVNGSPFVVHIGGEPSLRMMERITRQRELADVTHVGSQCELNLKIPGISLRDLTATVTSPSGVTQRCDVMPIDDVNYTIRFVPQEMGVHTVSVRHRGSHIPGSPFQFTVGAITDGGAHKVHAAGPGLQHGLTYSPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGISYRVTEPGEYQCSVRFNDENIPGSPFRVIINEAMERTFYSP---------ELRQLSVAAVQDRGLQIGRPTAFTVNYTGMS-GTLRAYAVSPSGVQIPAYVHQVDVDQHGVRFTPQENGPHLVHVLMDERPIPGSPFRIIVGQEDFGLVTASGEGLTHGRVGEKNRFFVNTTQAGSGALSVTVDGPSKVKLNCTERPDGYEFTYLPLAPGDYMINIRHGDQRHIIGSPFKAYVTGDAVQDIYTADTTHVVVETGSRLAAGPQRLVTEPRPDKVICTGSGLHQAFLNQTNTFNVNATQAGHDVLYVGVSGPVVACEEVNVKHLGLGQYAVNYLVRDRGQHLIMIKWGDQHVPGSPFAVNV 2497          

HSP 2 Score: 124.02 bits (310), Expect = 5.201e-24
Identity = 129/498 (25.90%), Postives = 207/498 (41.57%), Query Frame = 2
Query: 1037 NLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA-GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNS----DAKQAYATGRGIQPEGVRVRDVAEFQV-HTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIV-SKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDE-NIPKSPYMAQIQLDT-------------------------KLFD---PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIP---VQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVI 2392
            +L   V +P G  + C++   P  ++ Y+  ++P   G + + ++   S IP SPF+  V     G   KV A+GPG++           F+++T EAG G +   I       +D + RKD               I Y   E G +  +V F    I  SPF V+++     +    + +Q       +Q  G+++     F V +T  +G   L      P        + +V    +   + PQ  GP++V +     PI  SPF + V       + A G GLT G V  K  FF   T   +GAL  ++ GPS+ K++C +  DG    TY P  PG+Y ++I   D+ +I  SP+ A +  D                          +L     P KV   G GL      N+   F VN   AG           V+G  +    V ++    G Y+  Y  +  G+H +++ +G+ ++P SPF VNV+
Sbjct: 2026 DLTATVTSPSGVTQRCDVM--PIDDVNYTIRFVPQEMGVHTVSVRHRGSHIPGSPFQFTVGAITDGGAHKVHAAGPGLQ--HGLTYSPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKD-----------GSCGISYRVTEPGEYQCSVRFNDENIPGSPFRVIINEAMERTFYSPELRQLSVAA--VQDRGLQIGRPTAFTVNYTGMSG--TLRAYAVSPSGVQIPAYVHQVDVDQHGVRFTPQENGPHLVHVLMDERPIPGSPFRIIVGQEDFGLVTASGEGLTHGRVGEKNRFFVNTTQAGSGALSVTVDGPSKVKLNCTERPDGY-EFTYLPLAPGDYMINIRHGDQRHIIGSPFKAYVTGDAVQDIYTADTTHVVVETGSRLAAGPQRLVTEPRPDKVICTGSGLHQAF-LNQTNTFNVNATQAGH----DVLYVGVSGPVVACEEVNVKHLGLGQYAVNYLVRDRGQHLIMIKWGDQHVPGSPFAVNVV 2498          
BLAST of Filamin vs. TrEMBL
Match: A0A5J4NU72 (Filamin OS=Paragonimus westermani OX=34504 GN=DEA37_0004303 PE=4 SV=1)

HSP 1 Score: 2806.16 bits (7273), Expect = 0.000e+0
Identity = 1418/2540 (55.83%), Postives = 1805/2540 (71.06%), Query Frame = 2
Query:  170 LAERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSNFRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSK----------------------------------TSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILT----PFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKST-PGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAF---------QPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXX-----XXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKG--PSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            +AERELAEDA+WK+IQKNTFTRWAN+HLKP N+ ++DLQYD ADGLKLI LV+ LSG  F+H +++P+FRTQKLENVTMVLRFLEE+EGLRLVNIDS+DI D R KLILGLIWTLILHYSIT+PLWEGE      GQG+GP+PKQRLL W+N+K+  +PVKNFTTDWNDG AIGALVDACAPGLCP+W +W+PKQ L+NA+EA++ AE+ L+V  LI+P E+INP+VDEKAMMTYLSQFP+A+L   APL PK+    VRAYGPGL+  GNT+GNPA FT+DTF+AG+G +++IVLNPKGQ+EPCEI  + +++  YSC+Y+PT EGEYR+IIKFA  EI NSPFKV V+ A GD SK +ASGPGIEP GN+ GRRTFFN+FTA AGPG+VDCVILD  GR+D++KP ITKQ E+ +L+EYT K+EGLHSVNVFFAG QI +SPFGVMV+ K                                      DAKQAYATGRGIQP+G+RV+D+A+F+VHTEDAG   L V V  P      C  +K    L++CSY PQR G + V ++YG + I LSPFNVDV PYKES+I+AFGPGL+GG+V+KPA F VETNGETGALGFSI+GPSEA+IDC DNGDGSA V YWPTVPGEYAVHILC+DENIPKSP+M  I  D    DP +V  +GPG++ +G    +P +F V+ ++AG P+ +  EC D  G+ + +++RDN DGTY+C YTPK+P KHT++VSYG VN+P SPF+V+V E      ++V+GPG+E       T+F+VDCK AG G++GISV DE  RDV + T D  DGTF + YT  T GP YTI +FF+  E+P+SPF+VP++ + D  K  + NL+   P+G+  EF+++T    P   SK RP ++V SP+G RVP  + E+ +GF   FTPTV GPHTV ++  G P+  SP++  A+           ETP+             ++P  P+ +A                 +  +   P   +        E A L    V A+G+GL    +  PA F IDS + PPAPL VTIEGP EAKI+Y DNGDGTC V YLP EPG Y+VNVLY D HIK SPF V + P  +      DV++V AYGPGL PTGV K+SF+KFTV+AKP+D  G+G+VKAI+ NP  QR+ C V NN DGT+ CSYSP  +G H I++TYDG PV  SP+ V V  G DPSR+ AYGPGLE G+T + Q+FTVDL+GAGQG LGL++EGPADAQIQC DNKDGTC+V+YLP + GSYDV +KFN+ +IPGSPF VPI D VD S+V+CYGPGLE  G+R   P+ FTVDAS+AG+AP+ V  +D   +S  PA ++P++  PG++DVTY+P   G C+IEV      V  SPF Q+VL + EP++V VTGEGV P R   +    P+ F ++TRDAG  DLEL V+ P  + + L+V +HGDGT+TC Y+  V G +TV+V +G + +  SPF+VPV    + + C+IE    + VPVG+   I +NT  AG G ++ + V P G      I+    G   V Y P   G Y V++ F  E +PNG   Q A          QP      ER  H  T       + T Y  VDFK PVGP F  V  +V  PS R   P LI+NGDGT+T Q+QP+E GLHELE+ YNGQPI GSPF+FYV++ + SG VTAYGPGLSYGR    A FT+VTK+AGAGGLSL+VEGPSKAEIQC DNKNGTC VSYLPLAPGDY I IKFM++HI GSPFTA I GE ++ +Q+CVGTTS++PLRI+ETDI NL A V SP+G+E+  TLKRL NG+LGISFTP+E+G+H VNV R+GRHI NSPFKI+VGE+EIGNAS+V++YG+GL +G  N+ CQF VDTRNAGYG LSLSIEGPSK +IECHDNHDGTCLVTY+PTEPGTYIINVKYAD  V GSP+ V++GG PS  + ERI R ++ A+V+ +G+ CELNL IPG + R+ TA+V SPSG  + C++IA+ D  ++I+F+P+E+GVHTVSV+    H+ GSPFQFTVG + DGG HKV   G G++ GL    N F+IYTREAGAG LS+AIEGPSKAEIDF+D KDGSCG++YRV EPG+Y CS++FNDEH+PGSPF + I+E    ++  P         + R +S+A++QD+G  IG    F +NY G+T G + AYV++PS  +  A I ++D +Q++V F P ENG H VHVL++  PIPGSPFRV+VG+     VT +GEG+ HG  G  N FFV+T+ AG+GAL+VT+DGPSKVQLNC E   GY+F+Y+P APG+Y I+I++G   HI+GSPF   ++G+      +   T  + +T   ++   Q+    S+P  V C G GL+ A + + N F V+A  AG DVLYVGVSGPV  CEEVNIKHLG+ ++ VNY V+++G+HL+MV+WG+  VPGSPF I V
Sbjct:   83 MAERELAEDAEWKLIQKNTFTRWANEHLKPKNMFVEDLQYDFADGLKLIGLVEALSGQQFKHVNRKPSFRTQKLENVTMVLRFLEENEGLRLVNIDSTDIVDSRSKLILGLIWTLILHYSITIPLWEGE---VDHGQGQGPTPKQRLLSWLNNKLVERPVKNFTTDWNDGIAIGALVDACAPGLCPDWRKWEPKQNLRNAREAMDAAEQWLDVPQLIRPEEIINPRVDEKAMMTYLSQFPSAKLKEGAPLRPKSTPELVRAYGPGLQPHGNTVGNPARFTIDTFSAGRGQVEVIVLNPKGQREPCEILSNNDRQQTYSCAYVPTQEGEYRVIIKFATKEILNSPFKVMVEGAIGDASKASASGPGIEPQGNQAGRRTFFNIFTAAAGPGNVDCVILDPHGRRDAIKPVITKQGEDNYLVEYTPKDEGLHSVNVFFAGQQIPNSPFGVMVAPKPVAQPPIQPPAPIIPSQEEPIQAAISQRKMSAPRRPACDAKQAYATGRGIQPQGIRVKDLADFKVHTEDAGEGPLEVTVISPDGREIPCTTRKTGAYLFDCSYNPQRAGLHQVHVRYGGDHIMLSPFNVDVGPYKESRIRAFGPGLSGGVVNKPAVFVVETNGETGALGFSIEGPSEARIDCTDNGDGSATVAYWPTVPGEYAVHILCNDENIPKSPFMVPIDPDMGKCDPERVKVHGPGVMPTGNVAGQPTEFTVDIRDAGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCSYTPKVPRKHTILVSYGTVNVPRSPFRVDVAEPSQPGRVRVFGPGVESVVRGEPTHFIVDCKQAGQGNVGISVTDEMGRDVAMDTQDMRDGTFRVAYTANTPGPNYTIHVFFNNQEVPRSPFRVPVKPNVDMSKILVENLSPNIPVGKPTEFDVITAGAGPPSNSKPRPNVVVTSPSGMRVPCTMAESVDGFTPSFTPTVTGPHTVAIDVGGIPVKGSPFRTHAS----------PETPI-------------HEPVYPMSNAG---------------QQHAAAMAPMSAL--------EAAGL----VRAFGDGLYHATSGRPAHFTIDSRDAPPAPLSVTIEGPAEAKINYNDNGDGTCGVEYLPTEPGPYVVNVLYKDVHIKGSPFPVRVAPPGREHV---DVSRVHAYGPGLQPTGVLKESFAKFTVDAKPVDPQGRGLVKAIVVNPHKQRTACLVQNNGDGTWKCSYSPIDEGLHHIEVTYDGAPVQGSPFPVNVAPGCDPSRVCAYGPGLEGGLTHELQRFTVDLDGAGQGALGLALEGPADAQIQCHDNKDGTCTVEYLPTRAGSYDVFVKFNDMNIPGSPFQVPIRDRVDPSRVRCYGPGLEPRGARAQQPATFTVDASQAGDAPVHVATVDRLGRST-PAHVVPRAAQPGVYDVTYVPNTEGPCQIEVRQGPSHVARSPFTQHVLPAFEPQRVRVTGEGVHPSRPLGLPATQPTSFHVDTRDAGIGDLELSVSDPEAQPLQLEVVDHGDGTYTCHYRPMVVGRHTVRVKFGGQEITESPFLVPVAPSGRADLCHIESGNDSRVPVGQECVITLNTSQAGIGQVTCRIVTPSGATADVEIQEAPNGRVHVYYTPPIRGDYLVEVRFGGELVPNGRFNQRAVTADELMADTQPPTYIQEERVQHMTTQSLHSSTMVTGYHPVDFKLPVGPTFSQVEGLVRTPSGRTMQPTLIDNGDGTVTAQFQPNEPGLHELEITYNGQPIPGSPFRFYVEA-VGSGVVTAYGPGLSYGRAGELADFTLVTKEAGAGGLSLSVEGPSKAEIQCNDNKNGTCSVSYLPLAPGDYTISIKFMERHIPGSPFTAHIGGETRRLNQVCVGTTSEMPLRITETDIYNLVATVRSPSGQEQPSTLKRLPNGHLGISFTPREIGDHYVNVFRNGRHIANSPFKIYVGESEIGNASKVRVYGNGLREGTANQNCQFTVDTRNAGYGSLSLSIEGPSKADIECHDNHDGTCLVTYRPTEPGTYIINVKYADQLVQGSPYVVHVGGEPSLRMMERITRQRELADVTHVGSQCELNLKIPGVSLRDLTANVTSPSGVTQRCDVIAVDDVNYTIKFVPQEMGVHTVSVRHRGSHIAGSPFQFTVGAITDGGAHKVRAAGQGLQHGLTYAPNDFSIYTREAGAGGLSVAIEGPSKAEIDFEDRKDGSCGISYRVTEPGEYQCSVRFNDEHIPGSPFQVTINETMERTFYSP---------ELRQLSVASIQDRGLQIGRSTAFTVNYSGMT-GRMRAYVVAPSGVQTEAYIHQVDVDQHAVRFTPQENGPHLVHVLMDERPIPGSPFRVIVGQDDFGLVTATGEGLSHGRVGERNRFFVNTTQAGSGALSVTVDGPSKVQLNCTERPDGYDFSYLPMAPGEYLINIRHGDQQHIVGSPFKAFVTGDAVHDVFTADSTHVVVETGGRLATGPQRSVTESRPNRVICTGSGLQQAYLNQTNTFTVNATQAGHDVLYVGVSGPVVACEEVNIKHLGSGQYAVNYVVRDRGQHLIMVKWGDQHVPGSPFVINV 2554          

HSP 2 Score: 118.242 bits (295), Expect = 2.809e-22
Identity = 125/497 (25.15%), Postives = 203/497 (40.85%), Query Frame = 2
Query: 1037 NLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAA-GDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNS----DAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIV-SKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHIL-CDDENIPKSPYMAQIQLDT--KLFD--------------------------PLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIP---VQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVI 2392
            +L   V +P G  + C++      ++ Y+  ++P   G + + ++   S I  SPF+  V     G   KV A+G G++           F+++T EAG G +   I       +D + RKD               I Y   E G +  +V F    I  SPF V ++     +    + +Q       IQ  G+++     F V+        +   V  P     +  I +V    +   + PQ  GP++V +     PI  SPF V V       + A G GL+ G V  +  FF   T   +GAL  ++ GPS+ +++C +  DG  + +Y P  PGEY ++I   D ++I  SP+ A +  D    +F                           P +V   G GL      N+   F VN   AG           V+G  +    V I+    G Y+  Y  +  G+H ++V +G+ ++P SPF +NVI
Sbjct: 2083 DLTANVTSPSGVTQRCDVIAV--DDVNYTIKFVPQEMGVHTVSVRHRGSHIAGSPFQFTVGAITDGGAHKVRAAGQGLQ--HGLTYAPNDFSIYTREAGAGGLSVAIEGPSKAEIDFEDRKD-----------GSCGISYRVTEPGEYQCSVRFNDEHIPGSPFQVTINETMERTFYSPELRQLSVAS--IQDRGLQIGRSTAFTVNYSGM-TGRMRAYVVAPSGVQTEAYIHQVDVDQHAVRFTPQENGPHLVHVLMDERPIPGSPFRVIVGQDDFGLVTATGEGLSHGRVGERNRFFVNTTQAGSGALSVTVDGPSKVQLNCTERPDGY-DFSYLPMAPGEYLINIRHGDQQHIVGSPFKAFVTGDAVHDVFTADSTHVVVETGGRLATGPQRSVTESRPNRVICTGSGLQQAY-LNQTNTFTVNATQAGH----DVLYVGVSGPVVACEEVNIKHLGSGQYAVNYVVRDRGQHLIMVKWGDQHVPGSPFVINVI 2555          
BLAST of Filamin vs. Ensembl Cavefish
Match: flna (filamin A, alpha (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-030131-2145])

HSP 1 Score: 1858.19 bits (4812), Expect = 0.000e+0
Identity = 1070/2554 (41.90%), Postives = 1522/2554 (59.59%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK-ESKIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQ-LDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE----TYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNE---FEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETET--PLLISADYAIDNKAYNKPSIPVQSAKLT-PVER---SNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEK-------------AELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILN-EVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTT----HHYTTEQSKPI---------------IRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXX---------XXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLT--QTVHMISGSTQKGP----SKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  N  I +LQ DL+DGL+LI L++ LS    FR  ++RP FR  +LENV++ L FL+  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+W+ E+ +  D + K  +PKQRLLGWI +K+P  P+ NF+ DW  G A+GALVD+CAPGLCP+W  WD  + + NA+EA+  A+E L V  +I P E+++P VDE ++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +   A FTV+T +AG+G + + V +P G +E  ++  + +K   YS  YIP + G +++ + FA   I  SPF+V+V  A GD SKVTA GPG+E VGN   + T+F+V+TA AG G V+ VI+D  G+KD+V+ +I  +  + +   Y   +EG H + + FAG QI  SP+ V V    + S      A GRG+QP+G+R+++ AEF+V+T+ AG  +L V + GP    E C+ K +   +Y   Y P  PG Y++ I +G   I  SPF V V       +++A+GPGL  G+V K A F VE  G+  G LGFS++GPS AKI+C D GDGS +V YWPT PGEYAVH+LC +E+I  SP+MA+I+    + F P KV AYGPGL  SG+S  KPA+F V+ K  G  + +K +  D  G  + VQ++DN +GTYSC YTP+ P KHTV+VS+G VN PESPF++N+    +   +KV GPG+  AKT ++    TYF VDC  AG GDI I +              +G  T                 + F++  IP +P ++ ++  +D  K K      +    +LN+   F + T   G K + +     P            NN    +   +TP   G   V V   G+PI  +P+ V     ++  +         + +  D  I  K+          AK+T P  +     V+   +P   +  F P ++  Y V+ T +              A      V   G GL +        F++D T   PA L + I  +   EA++   DNGDGT ++ Y+P  PG+Y + + Y  + + + P  + + P  ++S        V  +GPG+   GVF+++ ++FTV+A+ +   G   +K  + NP    +   + +  DGTY   Y+P  +G H +++ YD  PV  SP+ VPV +G DP+R+R +GPGL+ G+T +P KFTV+  GAG GGLGL++EGP++A++ C DNKDG+CSV+Y+P +PG+Y+++I +  + I GSPF+VP+ D VD +KVKC G G+  N  R   P  FTVDASKAG APL+V V       V+PA+++         V+Y+P   G   I VLY + ++P SP+   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T P  +    ++ ++ DGT+   Y  D+ G YT+ + YG   +P SP+ +         +C + G  +   + +G+   I V+ + AG G ++     P G  V   +     G   + Y   + G Y + + F  E+IPN   +  A +      + + T    + Y     +P                +R    V+ F    G V   VR     PS +   P + +N DGT+TV+Y P+E+GLHE+++ Y+G  I GSP +FYVD  + SG VTAYGPGL +G  +  A FT+ TKDAG GGLSLA+EGPSKA+I C+DN++GTC VSYLP+ PGDY+I +K+ DKHI GSP+ AKI G+   R S + VG+ +D+PL I E D++ L A + +P+GREE C LK L+NG++G+SF PKE+GEHLVN+ ++GRHIP+SP  + + ++EI +ASRV++ G GL++    E  +F++DTR+AGYGGLSLSIEGPSKV+I   D  DGTC VTY PTEPG YIIN+K+AD +VPGS F V + G     + E I R + AA V+ +G+ C+L+L IP  +  + TA V SPSG     EI+   +N + IRF+P E+GVHTVSVK   +HV GSPFQFTVGPL +GG HKV   G G+ER  A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGS GV+Y V EPGDY  SIKFNDE++P SPF++     P +S S          +D+R +++A+LQ+ G  +   A+F ++ +G   G I A V SPS   +   +++ID ++Y+V F+P ENG++ + V  N S IPGSPF++ VGE          +  G G+  G+TG   EF V+TS+AG GAL VTIDGPSKV+++CQE   GY  TY P APG+Y ISIKYGG  HI+GSPF   I+G+   S+ S+ ET S+        ++ S Q  P    S    V  +G GL    IG++N F VD   AG ++L VGV GP  PCEE+ +KHLGN  + V+Y ++EKG ++L+V+WG+  +PGSPF I V
Sbjct:   33 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIANLQTDLSDGLRLIGLLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLDR-ENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWD-EEEDTDDAKQK--TPKQRLLGWIQNKLPELPITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKPVDNAREAMQQADEWLGVPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYIPKVTGMHKVTVLFAGLHISKSPFEVDVGMAQGDSSKVTAQGPGLEAVGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECQIEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVSVGEACNPS---LCVAKGRGLQPKGLRIKETAEFKVYTKGAGTGELKVTIKGPKGLEEPCKKKDLGDGVYSFEYYPTTPGNYIITITWGGQHIPRSPFEVKVGTEAGAQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQHSPFMAEIKPAPDRDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGK-APLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPLKHTVMVSWGGVNTPESPFRMNIGAGCHPNKVKVSGPGV--AKTGLKAFEPTYFTVDCAEAGQGDISIGI-------------KSGSYTI---------------MVLFADQAIPMTPIRIKVDPSHDASKVKAEGPGLSRTGVELNKPTHFTVNTKGAG-KAKLDAQFTGPTKGEAVRDFDIVNNHDNTYTVKYTPVQQGNMGVNVTYGGDPIPKTPFAVAVAPSLDLSKVKVAGLGDKMTVGKDQDITVKSKGAGGQGKVGAKVTGPAGKPVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGVPIPGSPFPVEAVAPTDPSKVRCSGPGLERAKVGETGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYIPLYPGAYTLTIRYGGQDVPNFPARLHVEPAVETSG-------VKVFGPGVEGKGVFREATTEFTVDARALTKTGGKHIKTCVNNPSGNCTEALIRDQGDGTYKVEYTPYEEGPHSVEVAYDDSPVPNSPFRVPVTEGCDPARVRVHGPGLKAGLTNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCSVEYIPYEPGTYNLNITYGGQPITGSPFSVPVQDTVDPTKVKCQGQGIGTN-VRANIPQVFTVDASKAGMAPLQVRV-QGPKGVVEPAEVVDNGDQ-THTVSYVPTREGPYSINVLYADEEIPRSPYKVKVLPTHDASKVRASGPGLNTTG---VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGAEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVMALEGASPEQLMQQTQVPQYAYAPNMGQPWATDRPMGMNGLDVAGLRPFDLVIPFTIQKGEVTGEVR----MPSGKVARPEIADNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVD-YVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCVDNQDGTCTVSYLPVLPGDYNILVKYNDKHIPGSPYVAKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTASLTTPSGREEPCLLKMLRNGHVGVSFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIADASRVRVSGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTG--EGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDENIPDSPFVV-----PVASPS----------DDARRLTVASLQESGLKVNQPASFAVSLNG-AKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGEAGQAGDPGMVSAYGAGLEGGNTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKARITGSRLVSSHSMHETSSVLVDPVTRSVTSSQQAAPGWASSDASRVVAKGLGLTKGFIGQKNSFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDDHIPGSPFHITV 2511          
BLAST of Filamin vs. Ensembl Cavefish
Match: flncb (filamin C, gamma b (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-041008-175])

HSP 1 Score: 1397.88 bits (3617), Expect = 0.000e+0
Identity = 891/2276 (39.15%), Postives = 1271/2276 (55.84%), Query Frame = 2
Query:  992 NPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE----SKIKAFGPGL--TGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDC--VDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPS-TVKAECF-DVTGQT---IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIE----TYFVVDCKLAGSGDIGI----SVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQE--TNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV---IATDRVNTKEYPETETPLLIS--ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILN-EVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPG-YNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXX---------XXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMIS------GSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
             P  F + T  AG G++ +I+++ +G+++  EI      +  + C+Y P +EG + I + FA  +IP SPF V++  A+ +P+   A G G++P G  V     F V+T  AG G +  +I   KG  + VK  +    +  +  +Y     G ++V + + G  I  SPF V+VS    ++  ++  A G G+  E   V   A+F V         LG ++ GP ++  +C  K    C  +  Y P  PG Y V +   +  I  SPF   + P        K+K +GPGL  TG IV+KPA F ++  G   G L    +      ID    DNGD +    Y PT P ++ + I   + N+P SP+   I   +    P  V  YGPG+  SG+  N+P  F V+   AG    ++  +C   V G     I   I  N++ T++ +YTP   G++T++V + +  IP SPF++ V  + +A  +K  GPG+   KT +E    T+F V  K AG     +    ++  E + D  ++  DN D ++T++YT    G T        +A IP+SPF + +    D  K K+  LN    +G+  EF I T   G + + ++ + SP+   +P K++    N      + P   GP+ V +   GNP+  SP+ V   +  D    + Y       ++   A +AID K      + +      P E + ++   N +   S ++ P E   Y +              +   ++      VTA G GL +G  N  ASF +D ++   A L + I  +   +A++   +N DGT S+ Y+P   G Y + + Y    +   P  V + P         D + V  +GPG+ P GV ++  + F V+ +  +  G   +K  I NP    +   + +  DGTY   Y+   DG H I++ YD V V KSP+ V V +G DPSR+RAYGPGLEEG+  +P +FTV+  GAG GGLGL+IEGP++A++ C DNKDG+CSV+Y+P  PG YDV+I F    IPGSPF VP+ ++VD SKV+C GPGL  NG R   P  FTVD SKAG APL+V ++   T + +P  I      G   V Y P   G   + V Y + +VP SPF    L + +  KV  +G G+       +   +P  FTI+ RDAGE  L + +  P  +    ++ ++ DGT+T  Y  D+ G YT+ + YG   +P SP+ +         +C + G  L   + +G+   I V+ + AG G ++ K   P G  +   +     G   + Y   + G Y + + F  E+IPN             + + RT   +  +  K  I  E                    V  PS +   P + +N DGT+TV+Y P+E GLHE+++ Y+G  I GSP +FYVD+ I SG VTAYGPGLS+G  +  + FTIVTKDAG GGLSLAVEGPSKAEI C DNK+GTC VSYLP APGDY+I +KF DKHI GSPFTAKI G+   R SQ+ VGT +DV L+I+ETD+++L A + +P+G EE C LKRL N ++GISFTPKEVGEH+V+V ++G+H+ NSPFKI VG++EIG+AS+VK++G GL +G   E  +F+VDTR+AGYGGL LSIEGPSKV+I C D  DGTC VTY PTEPGTYIIN+K+AD +VPGSPF V + G       E I R + A  ++ +G+ C+LNL IPG  + R  TA V SP G  +  EII   D+ +S+RF+P+E+G HTV+VK   +HV GSPFQFTVGPL +GG HKV   G+G++RG+A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGSCGV Y V EPGDY  SIKFNDEH+P SPF++ I                 + +D+R +++ +LQ+ G  +  +A+F +  +G   G I A V +PS   +   I+++DN+++++ F+P ENG+H++ V  N S IPGSPF++ V         G V+  G G+  G TG  ++F V+T NAG+GAL+VTIDGPSKV+++CQE   GY  TY P APG Y ISIKYGG  HI+GSPF   +SG       S+ ET S L +TV   S       S  K  S    V   G GL  A IG++N F VD   AG ++L VGV GP  PCEEV +KH+GN  + V Y V+EKG ++L+V+WG+  VPGSPF + VP
Sbjct:  359 QPTYFDIYTAGAGAGDVGVIIVDSQGRRDTVEIILENKGDSVFRCTYGPVLEGPHVIYVTFAGQQIPRSPFTVHISEAS-NPNACRAIGRGLQPKGVRVKEVADFKVYTRGAGSGDLRVLIKGPKGGDEPVK--VHDLGDGVYECDYYPIFTGKYTVIITWGGHAIPRSPFEVVVSE---DAGPQKVRAWGPGL--ETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSC--DVLYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKCYGPGLEPTGCIVNKPAEFTIDARGAGRGQLKIYAQDSEGYPIDIQITDNGDSTFFCVYIPTKPIKHTIIITWGEVNVPNSPFRVTIGEGSH---PENVKVYGPGVEKSGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFADQEIPISPFRIKVDPSHDANKVKAEGPGL--CKTGVEVGKPTHFTVYTKGAGKATPEVHFTGALKGEAVSDFEII--DNHDYSYTVRYTAIQQGNTSISVCHGGDA-IPKSPFVINVAPPLDLSKIKVQGLNTKVDVGKDEEFIINTRGAGGQGKVDVKITSPSRRPIPCKVESGTANEVHTVKYIPPEEGPYKVDINYDGNPVPGSPFTVEGVMPPDPSKVRAYGPGLKGGIVGKPAPFAIDTKGAGTGGLGLTVEG--PCE-AKIECQDNGDGSCSVSYLPTEPGEYAINILFADAHIPGSPFKAMVQSVFDPSKVTASGPGLERGKVNEAASFTVDCSKAGEAELTIEIISDSGAQAEVHVQNNSDGTYSITYIPPFHGMYTITINYGGHAVPKFPARVQVDPAV-------DTSGVKVFGPGVEPRGVLREVTTHFIVDTRAHNKTGGNHIKTRIVNPSGSNTDAYITDKGDGTYRVEYTAYEDGVHLIEVLYDEVSVPKSPFRVSVTEGCDPSRVRAYGPGLEEGLVNKPNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGLPIPGSPFRVPVRELVDPSKVRCSGPGL-GNGVRAHVPQTFTVDCSKAGLAPLEV-LLYGPTGTTEPVSITDNGD-GTHTVIYTPAKDGPYTVCVKYADQEVPRSPFKIKALPAHDASKVRASGPGLN---ASGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNRDGTYTVSYVPDMTGRYTITIKYGGDEIPYSPYRIHALPSGDASKCLVTGSGLGPTIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENSDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPF----------HVVVRTFLSFDLQYRKLCIMGE--------------------VRMPSGKTARPHITDNKDGTVTVKYAPTEKGLHEMDIKYDGNHIPGSPLQFYVDA-INSGHVTAYGPGLSHGMVNKPSIFTIVTKDAGEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDDKHIPGSPFTAKITGDDSMRTSQLNVGTATDVSLKITETDLSSLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGQSEIGDASKVKVFGKGLVEGHTFEVAEFIVDTRSAGYGGLGLSIEGPSKVDINCEDVEDGTCKVTYCPTEPGTYIINIKFADQHVPGSPFTVKVLG--EGRKKESITRRRQAPSIASVGSTCDLNLKIPGETSTREMTAQVTSPGGKTDDAEIIEGEDSTYSVRFVPQEMGPHTVNVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLDRGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSIKFNDEHIPDSPFIVPI---------------ATLSDDARRLTVTSLQEMGLKVNHEASFAVQLNG-ARGVIDAKVHTPSGAVEECYITELDNDKHAIRFIPRENGVHSIDVRFNGSHIPGSPFKIRVGEPGQVGDPGMVSAFGPGLEGGTTGVPSDFIVNTCNAGSGALSVTIDGPSKVKMDCQECPEGYKVTYTPMAPGSYLISIKYGGPQHIVGSPFKAKVSGARLSGGHSLHETSSVLVETVTKTSSVAGSFASLPKFSSDASKVVSRGTGLSKAFIGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRMYNVTYTVKEKGDYILIVKWGDEMVPGSPFHVTVP 2551          

HSP 2 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 839/2578 (32.54%), Postives = 1234/2578 (47.87%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKT-NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNV----DVAPYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVL--------DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINN---LNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNN---GFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV----------IATDRVNTKEYPETETPLLISADYA-----IDNK--AYNKPSIPVQSAKLTPVERSNVKTF---SNPNKQRSNFEPNEEIIYPVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQ-PQKFTVDLEGAGQGG---LGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF--------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGS---LSIAIEGPSKAEIDFQ--DNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPF------------RXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENE---SGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  N  I DLQ DL+DGLKLI L++ LS    +R  H RPNFR  KLENV++ L FLE  E ++LV+IDS  I D  LKLILGLIWTLILHYSI+MP+WE ED    D   K  +PKQRLLGWI +K+P  P+ NF  DW DG A+GALVD CAPGLCP+W  WDP Q ++NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   APL  KT +  R +AYGPG+E  GN +  PA F V+T  AG G + + + +P+G  E   +  + +K  +YS  Y+P +EG +++ + FA  +I +SPF VNV  A GDP+KV               + T+F+++TA AG G V  +I+D++GR+D+V+  +  + ++ F   Y    EG H + V FAG QI  SPF V + S+ SN +A    A GRG+QP+GVRV++VA+F+V+T  AG  DL V + GP    E  ++  +   +YEC Y P   G Y V I +G + I  SPF V    D  P    K++A+GPGL  G+V K A F VE  G E G LGFSI+GPS+AKI+C D GDGS +V YWPT PG+YAVH++CDDE+I  SP+MA I        P KV  YGPGL  +G   NKPA+F ++ + AG    +K    D  G  I +QI DN D T+ C Y P  P KHT+I+++G VN+P SPF+V + E  +  N+KVYGPG+E++  K N  TYF VDC  AG GD+ I +          E   D  ++ +DN   T             YTI + F++ EIP SPF++ ++  +D  K K            +G+   F + T   G K  PE+              +  +N    +   +T    G  +++V   G+ I  SP+ +          I    +NTK     +   +I+   A     +D K  + ++  IP +    T  E   VK       P K   N++ N     PV  +    E   P     V AYG GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDG+CSV+YLP EPG Y +N+L+ D HI  SPF   +        ++ D +KVTA GPGL    V  +  + FTV+       G+  +   I +    ++   V NN DGTYS +Y P   G + I I Y G  V K P  V V    D S ++ +GPG+E  G+ ++    F VD     + G   +   I  P+ +    +  D  DGT  V+Y   + G + + + ++E  +P SPF V + +  D S+V+ YGPGLE     V  P++FTV+   AG   L + +   +   +        +  G   V YIP   G+ ++ + +  + +PGSPF   V    +P KV  +G G+    G+ +   VP  FT++   AG + LE+++ GP   +  + + ++GDGT T  Y     G YTV V Y ++ VP SPF +         +    GP LN   VP    V   ++ ++AG+G+L+ + + P G     +I + R G  TVSYVP   G Y + + +  + IP    R +A       S + +    T     P I+     V            V   V+ P   +    ++ N DGT  + Y   E G + + + + G+ I  SPF   V +             LS+   D+      +  +         V  PS   A     DNK+GT  V Y P   G + + IK+   HI GSP         +  +       S   V   S   +   +     L+  V  P+  E SC  K  ++G   +S+ P   G++ + V    +HIP SPF   +  ++    S+       LN G   +    + +T       L+ SI  PS  E  C      + H G   +++ P E G ++++VK    +V  SPF + +G       ++  +  +   E      V E  +            S+  PS     CE +   D    + + P E G + +++K  ++HV GSPF   V   +  G  K  I        +A+  +   +  +  G  S   ++  +  P     D +  + +D +  V +   E G +  ++K+  +HVPGSPF   +   P                  +  +     D+G   G  A F I       G +S  V  PS  E   S     +    V +V  E G + V +  N+  IP SPF            R+ V  +   G  ++H  +      F    N   G +   +  PS     C   E     +   ++P   G ++I +++ G +HI GSPF + + G   Q  D                         P  V   G GL+    G  ++FIV+   AG   L V + GP +    C+E          ++V Y     G +L+ +++G    + GSPF+  V
Sbjct:    5 EKDLAEDAPWKKIQQNTFTRWCNEHLKCMNKKIGDLQRDLSDGLKLIGLLEVLSQKKMYRKYHARPNFRQMKLENVSVALEFLER-EHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDED----DEDAKKLTPKQRLLGWIQNKVPQLPINNFHRDWRDGKALGALVDNCAPGLCPDWEMWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRSKTLHPKRAKAYGPGIEPRGNMVMRPAEFVVETVEAGLGEVLVYIEDPEGHTEEARVIPNNDKNRSYSVVYLPKVEGLHKVKVLFAGQDINHSPFLVNVSKALGDPNKV---------------QPTYFDIYTAGAGAGDVGVIIVDSQGRRDTVEIILENKGDSVFRCTYGPVLEGPHVIYVTFAGQQIPRSPFTVHI-SEASNPNA--CRAIGRGLQPKGVRVKEVADFKVYTRGAGSGDLRVLIKGPKGGDEPVKVHDLGDGVYECDYYPIFTGKYTVIITWGGHAIPRSPFEVVVSEDAGP---QKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVLYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKCYGPGLEPTGCIVNKPAEFTIDARGAGR-GQLKIYAQDSEGYPIDIQITDNGDSTFFCVYIPTKPIKHTIIITWGEVNVPNSPFRVTIGEGSHPENVKVYGPGVEKSGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTV---KYTPPGAGRYTIMVLFADQEIPISPFRIKVDPSHDANKVKAEGPGLCKTGVEVGKPTHFTVYTKGAG-KATPEVHFTGALKGEAVSDFEIIDNHDYSYTVRYTAIQQGNTSISVCHGGDAIPKSPFVINVAPPLDLSKIKVQGLNTKVDVGKDEEFIINTRGAGGQGKVDVKITSPSRRPIPCKVESGTANEVHTVKYIPPEEGPYKVDINYDGN-----PVPGSPFTVEGVMPPDPSKVRAYGPGLKGGIVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYAINILFADAHIPGSPFKAMV-------QSVFDPSKVTASGPGLERGKV--NEAASFTVDCSKA---GEAELTIEIISDSGAQAEVHVQNNSDGTYSITYIPPFHGMYTITINYGGHAVPKFPARVQVDPAVDTSGVKVFGPGVEPRGVLREVTTHFIVDTRAHNKTGGNHIKTRIVNPSGSNTDAYITDKGDGTYRVEYTAYEDGVHLIEVLYDEVSVPKSPFRVSVTEGCDPSRVRAYGPGLEEG--LVNKPNRFTVETRGAGTGGLGLAIEGPSEAKMS----CKDNKDGSCSVEYIPFTPGDYDVNITFGGLPIPGSPFRVPVRELVDPSKVRCSGPGL----GNGVRAHVPQTFTVDCSKAGLAPLEVLLYGPTGTTEPVSITDNGDGTHTVIYTPAKDGPYTVCVKYADQEVPRSPFKIKALPAHDASKVRASGPGLNASGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNRDGTYTVSYVPDMTGRYTITIKYGGDEIPYSPYRIHALP-----SGDASKCLVTGSGLGPTIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENSDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVRTF------------LSF---DLQYRKLCIMGE---------VRMPSGKTARPHITDNKDGTVTVKYAPTEKGLHEMDIKYDGNHIPGSPLQFYVDAINSGHVTAYGPGLSHGMVNKPSIFTIVTKDAGEGGLSLAVEGPSKAEISC--KDNKDGTCTVSYLPTAPGDYNIIVKFDDKHIPGSPFTAKITGDDSMRTSQ-------LNVGTATDVSLKITETD---LSSLTASIRAPSGNEEPCLLKRLPNRHIG---ISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGQSEIGDASKVKVFGKGLVE-GHTFEVAEFIVDTRSAGYGGLGLSIEGPSKVDINCEDV--EDGTCKVTYCPTEPGTYIINIKFADQHVPGSPFTVKV---LGEGRKKESITRRRQAPSIASVGSTCDLNLKIPGETSTREMTAQVTSPGGKTDDAEIIEGEDSTYSVRFVPQEMGPHTVNVKYRGQHVPGSPFQFTV--GPLGEGGA-----------HKVRAGGTGLDRGV-AGVPAEFSIWTREAGAGGLSIAVEGPSKAE--ISFEDRKDGSCGVAYVVQEPGDYEVSIKFNDEHIPDSPFIVPIATLSDDARRLTVTSLQEMGLKVNHEAS------FAVQLNGARGVIDAKVHTPSGAVEECYITELDNDKHAIRFIPRENGVHSIDVRFNG-SHIPGSPFKIRV-GEPGQVGD-------------------------PGMVSAFGPGLEGGTTGVPSDFIVNTCNAGSGALSVTIDGPSKVKMDCQEC------PEGYKVTYTPMAPGSYLISIKYGGPQHIVGSPFKAKV 2419          

HSP 3 Score: 93.9745 bits (232), Expect = 2.158e-18
Identity = 87/315 (27.62%), Postives = 135/315 (42.86%), Query Frame = 2
Query:  965 LELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKN--AAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVI-------LDTKGRKDSVKPKITKQSENKFLIEYT------------------TKEEGLHSVN----VFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV 1816
            L+  G  + + A F V   N  +G +D  V  P G  E C I +  N +  ++  +IP   G + I ++F  S IP SPFK+ V      GDP  V+A GPG+E  G   G  + F V T  AG G++   I       +D +   +  K   T  +   +LI                      +  G HS++    V    V   SS  G   S    +SDA +  + G G+    +  ++   F V    AG   L V V+GP    E+  +K +   +Y  +Y  +  G Y++ +K+G+  +  SPF+V V
Sbjct: 2243 LQEMGLKVNHEASFAVQ-LNGARGVIDAKVHTPSGAVEECYITELDNDK--HAIRFIPRENGVHSIDVRFNGSHIPGSPFKIRVGEPGQVGDPGMVSAFGPGLE--GGTTGVPSDFIVNTCNAGSGALSVTIDGPSKVKMDCQECPEGYKVTYTPMAPGSYLISIKYGGPQHIVGSPFKAKVSGARLSGGHSLHETSSVLVETVTKTSSVAGSFASLPKFSSDASKVVSRGTGLSKAFIGQKNT--FTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRMYNVTYTVKEKGDYILIVKWGDEMVPGSPFHVTV 2550          

HSP 4 Score: 66.2402 bits (160), Expect = 5.777e-10
Identity = 64/228 (28.07%), Postives = 94/228 (41.23%), Query Frame = 2
Query:  944 VRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSE-IPNSPFKVNVKNA-----------------------------------AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFL-IEYTTKEEGLHSVNVFFAGVQIQSSPFGVMV 1516
            V A+GPGLE  G T G P+ F V+T NAG G L + +  P   K  C+  + P     Y  +Y P   G Y I IK+   + I  SPFK  V  A                                   + D SKV + G G+      +G++  F V  ++AG    + +++   G K   +    K   N+   + YT KE+G + + V +    +  SPF V V
Sbjct: 2335 VSAFGPGLE--GGTTGVPSDFIVNTCNAGSGALSVTIDGPSKVKMDCQ--ECPE---GYKVTYTPMAPGSYLISIKYGGPQHIVGSPFKAKVSGARLSGGHSLHETSSVLVETVTKTSSVAGSFASLPKFSSDASKVVSRGTGLSKA--FIGQKNTFTVDCSKAG---TNMLMVGVHGPKTPCEEVYVKHMGNRMYNVTYTVKEKGDYILIVKWGDEMVPGSPFHVTV 2550          
BLAST of Filamin vs. Ensembl Cavefish
Match: flnca (filamin-C [Source:NCBI gene;Acc:103033794])

HSP 1 Score: 1358.2 bits (3514), Expect = 0.000e+0
Identity = 871/2293 (37.99%), Postives = 1260/2293 (54.95%), Query Frame = 2
Query:  941 RVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE----SKIKAFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDC--VDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPS-TVKAECF-DVTGQT---IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIET--YFVVDCKLAGSG--DIGISVLDEK--MRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAG--FTPTVIGPHTVTVECKGNPIGNSPYKVIA---TDRVNTKEYPETETPLLIS--ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXX---------XIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGSTQKGP----------SKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            +V+A GPGLE  GN    P  F + T  AG G++ +++++P+G+K+  E+      +  + C+Y P +EG + I + FA   IP SPFKV++  A+ + S   A+G G++P G  V     F VFT  AG G +   +    G +  VK  +    +  +  +Y     G ++V + + G  I  SPF V V  +   +  ++  A G G++     V   A+F V         LG ++ GP ++  +C+ K    C  +  Y P  PG Y V +   +  I  SPF   + P        K++AFGPGL  TG IV+ PA F ++      G L    +      ID    D GDG+    Y P  P ++ + I     N+P SPY     L  +   P KV  YGPG+  +G+ +++P  F V+   AG    ++  +C   V G     I   I  N++ T++ +YTP  PG++TV+V +    IP SP+KV V  + +A  ++  GPG+ +    ++T  +F +  K AG    ++  S   +   ++D  ++  DN D ++T+KYT    G      +      +P+SPF + +    D  K K+  LN    +G+  EF + T   G +    + + SP+G  +P KL+      V    + P   G + V V   GNP+  SP+ V A    D    + Y       ++   A ++ID K        +      P E + ++   N +   S ++ P E   Y +              +   K  L    VT  G GL +  A   A+F +D +    A L V I  +    A++   +N DGT SV Y P+  G Y +++ Y  + +   P  + + P         D + V  YGPG+ P GV +D  + F V+A+  +  G   ++  I NP    +   + +  DGTY   Y+   DG H I++ YD V V KSP+ V V +G DPSR+RAYGPGLE GI  +P  FTV+  GAG GGLGL+IEG ++A++ C DNKDG+CSV+Y+P  PG+YD++I +  + IPGSPF V + D+VD SKVKC GPGL  +G R   P  FTVD SKAG A L V +      + +P  +L  +  G   V Y P   G   + V Y +  VP SPF  +   + +  KV  +G G+       +   +P  FTI+ RDAGE  L + +  P  +     + ++ DGT+T  Y  DV G YT+ + YG   +P SP+ +         +C + G +   + + +   I V+ + AG G ++ K + P G  +   +     G   + Y   + G Y + + F  ++IPN     +  Q  ++  + R       ++ +P  R    ++ F    G +   VR     PS +   P + +N DGT+TV+Y P+E GLHE+++ Y+G  I GSP +F+VD+   SG VTAYGPGL +G  +  A FT+VTK+A  GGLSLAVEGPSKAEI C DNK+GTC VSYLP APGDY+I +KF  KHI GSPFTAKI G+   R SQ+ VG+ +DV L+I+ETD+++L A + +P+G E+ C LK L N ++G+SFTPKEVGEH V+V +SG+H+ NSPFKI VG +EIG ASRV+ +G GL +    E  +F VDTRNAGYGGL LSIEGPSKV+I+C D  DGTC VTY PTEPG YIIN+K+A+ ++PGSPF V + G     + E I+R + A  ++ +G +C+LNL IP  + +  TA V SP G     E++   D+ +S+RF+P E+G HTVSVK   +HV GSPFQFTVGPL +GGPHKV   G+G++RG+A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGSCGV+Y V EPGDY  SIKFN+EH+P SPF++ I                 + +D+R +++ +LQ++   +  +A+F +  +G   G I A V SPS   +   I+ +D ++ ++ F+P ENG+H++ V  N S IPGSPF V VGE   +G+         G+  G TG   EF V+T NAG+GAL+VTIDGPSK +++C E   GY   Y P APG+Y ISIKYGG  HI+GSPF   I+G       S+ ET S L +T  M   S   G           S    V C+G GL  A IG++N F VD   AG ++L VGV GP  PCE+V +KHLGN  + V Y V+EKG ++++V+WG+  VPGSPF + VP
Sbjct:  357 KVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEAS-NASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVK--VRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQ---AGLQKVRAWGPGLKTG--MVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSC--DVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGKGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRV---LVGEGCHPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGECMDTPTHFTIFTKGAGKAKPEVHFSTGQKGNPVKDFEII--DNHDYSYTVKYTALQQGNMSI-SVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGKDQEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGKPAPFSIDTKGAGAGG--LGLTVEGPCE-AKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPALDASRVTVSGPGLERAKAGEVATFTVDCSRAGEAELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAV-------DTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVVEGCDPSRVRAYGPGLEGGIVNKPNCFTVETRGAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRDVVDASKVKCSGPGL-GSGVRAHVPQTFTVDCSKAGLASLDVKLYGPG-GATEPVAVL-NNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKAG---VPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITIKYGGDQIPFSPYSIQARPTGDASKCLLSGSLGPNIQMCEETVISVDAKAAGTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSP---FHVQATKEPVVPR-------DEKQPQFRPINLLIPFTVQQGALTGEVRM----PSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPLQFFVDAA-ESGMVTAYGPGLCHGTVNKPATFTVVTKNAAEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKITGDDSLRTSQLNVGSAADVSLKITETDLSSLTASIRAPSGAEQPCLLKTLPNRHIGLSFTPKEVGEHEVSVKKSGKHVNNSPFKIMVGPSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDIKCEDVEDGTCRVTYCPTEPGNYIINIKFAEKHIPGSPFTVKVTG--EGRMKESIMRKRQAPSIASVGTICDLNLKIP--DVQGMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTVGPLGEGGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPI---------------ATLSDDARRLTVTSLQEKDLRVYQEASFAVQRNG-ARGVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDVKFNGSHIPGSPFNVRVGETGHAGDPGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVECAEGYKINYTPMAPGNYLISIKYGGPQHIVGSPFKAKITGVRLSGGHSLHETSSVLVET--MTKSSKVAGAYSSASSSSLSSDGSRVVCQGAGLTRAFIGQKNIFTVDCSKAGTNMLMVGVHGPRTPCEDVYVKHLGNRLYNVTYTVKEKGNYVVIVKWGDETVPGSPFHVTVP 2580          

HSP 2 Score: 1112.06 bits (2875), Expect = 0.000e+0
Identity = 847/2592 (32.68%), Postives = 1255/2592 (48.42%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKT-NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE-SKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISV--------LDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNTTP-IGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVK----LQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV----------IATDRVNTKEYPETETPLLISADYA-----IDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIY---------PVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQ-PQKFTVDLEGAGQGG---LGLSIEGP--ADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIV---PVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIR---------TEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYV--DSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCI--DNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQI-------CVGTTSDVPLRISETDIN----NLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSS-SLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQ--DNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPF------------RXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYN---FTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRP---CEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFE 7612
            E+ELAEDA WK IQ+NTFTRW N+HLK  N  + DLQ DL DGLKLI L++ LS    +R  H RPNFR  KLENV++ L FL+  E ++LV+IDS  I D  LKLILG+IWTLILHYSI+MP+W+ +D  ++       +PKQRLLGWI +K+P  P+ NF  DW DG A+GALVD CAPGLCP+W  WDP Q ++NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   AP+ P+  +  + +AYGPG+E EGN +  PA FTV+T +AG G + + V +P+G +E  ++  + +K+  YS SY+P + G +++ + FA  +I  SPF VNV    GDP+KV A GPG+EP GN   R T+F+++TA AG G V  VI+D +G+KD+V+  +  + ++ F   Y    EG H+++V FAG  I  SPF V +S     S+A    ATGRG+QP+GVRV++VA+F+V T+ AG  +L V+V GPG +    +++ V   +YEC Y P  PG Y V I +G   I  SPF V+V       K++A+GPGL  G+V K A F VE  G E G+LGFSI+GPS+AKI+C D GDGS +V YWPT PG+YAVH++CDDE+I  SP+MA I        P KV A+GPGL  +G+  N PA+F ++ + AG    +K    D  G  I ++I D  DGT+ C Y PK P KHT+I+S+G VN+P SP++V V E  +   +KVYGPG+E+   K++  TYF VDC  AG GDI I +          E   D  ++ +DN   T             YT+ + F+E EIP SP+KV +E  +D  K +     LN T   +     F I T   G K +PE+   +      PVK    +   +  +   +T    G  +++V   G+P+  SP+ +          +    +N K     +    ++   A     +  K  +    P+   KL P     V            + P EE  Y         PV  +    E   P     V AYG GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP E G Y +N+LY ++HI  SPF   + P         D ++VT  GPGL          + FTV+       G+  +   I +     +   + NN+DGT+S +Y+P  DG + I I Y G  V K P  + V    D S ++ YGPG+E +G+ +     F VD     + G   + + I  P  ++      D  DGT  V+Y   + G + + + ++E  +P SPF V + +  D S+V+ YGPGLE  G  V  P+ FTV+ ++   A      I+ A+++    +    +  G   V Y+P   GN +I + Y    +PGSPF   V +  +  KV  +G G+    G  +   VP  FT++   AG + L++ + GP   +  + V N+GDGT T  Y     G YTV V Y +K+VP SPF V   P H  +K       GP L++  VP    V   ++ ++AG+G+L+ + + P G     SI++ + G  TVSYVP   G Y + + +  + IP        F P   YSI+      T + SK ++           E +V+               V+       DV  ++ N DGT  + Y   E G + + + + GQ I  SPF      +  +P  +           +P       ++      G L+  V  PS    + +  DNK+GT  V Y P   G + + IK+   HI GSP   + F +  +   +       C GT +  P   +    N     L+  V  P+  E SC  K  ++G   +S+ P   G++ + V   G+HIP SPF   +  ++    S+       LN G   +    + +T       L+ SI  PS  E  C      + H G   +++ P E G + ++VK +  +V  SPF + +G  PS      R+         +    V E  +            S+  PS     CE +   D    + + P E G + +++K   +H+ GSPF   V      G  K  IM       +A+      +  +      ++  +  P    ++ +  ++ D +  V +   E G +  S+K++ +HVPGSPF   +   P                    +       Q    G    F I       G +S  V  PS  E   S     +    V ++  E G + V +  NN  IP SPF            R+ V  +      ++   +      F    N   G +   +  PS V   C   +   +     ++P   G ++I +K+ G +HI GSPF V +    +  +                          P  V   G GL+    G   EF+V+   AG   L V + GP +    C E          +++NY     G +L+ +++G    + GSPF+
Sbjct:    5 EKELAEDAPWKKIQQNTFTRWCNEHLKCINKNVTDLQRDLGDGLKLIALLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLDR-ERIKLVSIDSKAIVDGNLKLILGMIWTLILHYSISMPMWDDDDDEEKKKL----TPKQRLLGWIQNKVPQLPINNFNRDWRDGKALGALVDNCAPGLCPDWETWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPRQLHPKKAKAYGPGIEPEGNMVMKPAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKVLFAGQDIDKSPFSVNVAKTVGDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEA---SNASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGK-GELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTV---KYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGECMDTPTHFTIFTKGAG-KAKPEVHFSTGQKGN-PVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGKDQEFTVNTQGAGGQGNVGVKMVSPSGRPI-PCKLEPDRAKGVTNV--------KYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGKPAPFSIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPAL-------DASRVTVSGPGLERAKA--GEVATFTVDC---SRAGEAELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAVDTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVVEGCDPSRVRAYGPGLE--GGIVNKPNCFTVE-TRGAGAGGLGLTIEGASEAKMSCK---DNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRDVVDASKVKCSGPGL----GSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASK---VRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITIKYGGDQIP--------FSP---YSIQARP---TGDASKCLLSGSLGPNIQMCEETVISVDAKAAGTGKVTCKVLTPDGAELDV-DVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQATKEPVVPRDE----------KQPQFRPINLLIPFTVQQGALTGEVRMPSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPL--QFFVDAAESGMVTAYGPGLCHGTVNK-PATFTVVTKNAAEGGLSLAVEGPSKAEISC--KDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKITGDDSLRTSQ-------LNVGSAADVSLKITETD---LSSLTASIRAPSGAEQPCLLKTLPNRHIG---LSFTPKEVGEHEVSVKKSGKHVNNSPFKIMVG--PSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDIKCEDV--EDGTCRVTYCPTEPGNYIINIKFAEKHIPGSPFTVKV---TGEGRMKESIMRKRQAPSIASVGTICDLNLKIPDVQGMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTV--GPLGE------------GGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAE--ISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPIATLSDDARRLTVTSLQEKDLRVYQEAS------FAVQRNGARGVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDVKFNG-SHIPGSPFNVRVGETGHAGD--------------------------PGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVEC------AEGYKINYTPMAPGNYLISIKYGGPQHIVGSPFK 2443          

HSP 3 Score: 124.02 bits (310), Expect = 2.108e-27
Identity = 117/487 (24.02%), Postives = 196/487 (40.25%), Query Frame = 2
Query: 6212 VISPSGSFEMCEIIALSDNQ--FSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVE--RGLANDANQFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPF------RXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEI--GKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            V  P G  E  +++  +D +  +S+ ++PK  G H V V    + +  SPF   V   + G P+KV   G G+E    +      F IYT  AGAG +S+ I  P       E+  ++  D     TY+    G +   + F  + +P SPF + I E   +S  +                   LQ +G  +   A+F +   G   G +   V  P   E    +  + +  Y   + P   G + V +      IP SPF      +  + +V   G G+  G  G+  +F V+      G+L  +I+GPS+ ++ C++   G  +  Y P  PGDY + +    +  I  SPF                         H++  +    P K   V+  G GL+   +      EF +DA  AG   L +          ++ I   G+  F   Y  ++  +H +++ WG  +VP SP+ ++V
Sbjct:  294 VEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKVLFAGQDIDKSPFSVNVAKTV-GDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEASNASSCRATGR--------------GLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHV-ICDDEDIKDSPFMA-----------------------HILPAANDVFPEK---VRAFGPGLQPTGVIVNMPAEFTIDARQAGKGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLV 738          
BLAST of Filamin vs. Ensembl Cavefish
Match: FLNB (filamin B [Source:NCBI gene;Acc:103028460])

HSP 1 Score: 1347.41 bits (3486), Expect = 0.000e+0
Identity = 850/2292 (37.09%), Postives = 1261/2292 (55.02%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES----KIKAFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKG----PSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPS-TVKAEC----FDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGIS----VLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVP--VKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIAT---DRVNTKEYPETETPLLIS--ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQRTNE---------KAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGP-ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX---------XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLT-----QTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            ++ +V A GPGLE  GN    P  F + T  AG G +  ++ +P+G K   E       +  + C+Y P   G + + I F    IP SP+ V V   A  P    A+G G++P G  V +   F V T  AG G +   +   KG ++ VK  +T+  +  +  EY    +G ++V + + G  I  SPF V+V  +   + A++  A G G+  EG  V   A+F   +  +    LG  + GP ++  +C+ +    C  +  Y P  PG Y V +   +  I  SPF   + P  +S    ++KA+GPGL  +G I++KPA F VE  N   G L    +     P E K+   + GD   + TY PT   ++ V +     ++P SP+   +    K   P KV  +GPG+  +G+  ++P  F V+   AG    +V  +C         + +   I  N + T + +Y P   G+ T+ V + +  IP SPF+V V  + +A+ +K  GPG+ RA  ++   T+F V  K AG   + +     +  E ++D  ++  DN D ++T+KYTP   G      + F    I +SPF V + +  D  K ++N L +   +GQ  EF + T   G + + E  + SP+G  VP  V+ Q      +  + P   G +TV +  +GNP+  SP+ V A    D    K +       L+   A++ ID K      + +     T    + ++   N +   S ++ P E   Y V    E          A+++ P     V A G GL +G     +   +D  +  P  L +    +   +AK + +DN DGT +V Y+P   G Y + + Y  + + + P  V + P         D +KV  +GPG+   G+F+++ + FTV+A+ +   G   +KA + NP    + C + +  DGTY   Y+P  +G H +++ YD  PV KSP+ V V +G DP+R+ A GPGLEEG+T +  KF++   GAG GGLG+++EGP+++++ C DNKDG+C+V+Y P  PG YDV+I +  +HI GSPF VP+ D+VD SKVK  GPG+  +G R   P  FTVD SKAG APL V V  T  K V     +  +  G   V Y P   G   + V Y + +VP SPF   VL + +  KV  +G G+       +   +P  FTI+ +DAGE  L + +T  + +    ++ ++ DGT+   Y  D  G YT+ + YG   +P SP+ V   +     +C + GP I   + +G+ V   VNT+ AG G +S   V P G  V   +     G   + Y   K G Y + + F  ENIP           +  + +  T   Y    S  +  T +   D   P       +   V+ PS +   P +I+N DGT+ V+Y P+E+GLHE+ + YNG  I  SP +FYV++   S  VTAYGPGL YG  +  A FTI T+DA  GGL LA+EGPSKAEI CIDNK+GTC V+YLP  PGDY+I +++ +KHI GSPFTA+I  + K+RSQ+ +G+ +D  L I+ETD++ L A + +P+GR+E C LKR  N  +GISF P+EVGEHLV++ ++GRH+ NSP  I V ++EIG+A RV+++G GL +G   E   FVVDTR+AGYGGL+LSIEGPSKV+I+  D  DGTC V+Y PTEPGTYI+++++A+ +VPGSPF+V + G     + E I R Q AA V+ +G+VC+LNL IP  +  + +A V SPSGS E  EI+ + ++ + +RF+P E+GVHTV+VK   +HV GSPFQFTVGPL +GG +KV   G G+ER       +F+I+TREAGAG LSIA+EGPS+AEI F+D KDGSCGV+Y  NEPGDY  S+KFN+EH+P SP+++            PV   +   +D+R +++ +LQ+ G  +    +F +  +G   G+I A V SPS   +   +S+++ ++Y++ F+P ENGIH + V  N + IPGSPF V           G VT  G G+  G TG   +F ++T+ AG G+L VTI+GPSKV++ CQE   G+   Y P APG+Y ISIKYGG NHI GSPF   + G    +  +  E+ +LT     +     S S+ +  S    V   G GL  A +G+R  F VD   AG ++L VGV GP  PCEE+ +KH+G+ ++ V+Y ++E+G +LL V+WG   +PGSPF + VP
Sbjct:  352 DASKVTAKGPGLEPLGNIANKPTYFDIYTAGAGVGEVTAVIKDPQGNKNTVEALMEDKGDSVFRCTYRPVQAGPHSVNITFGGIAIPKSPYTVTV-GPASSPGACRATGRGLQPRGVRVRQVADFRVDTRSAGSGELKVTVKGPKGLEEPVK--LTEAMDGTYAYEYYPNTQGKYTVTITWGGQHIPKSPFEVVVGPE---AGAQKIRAWGPGL--EGGIVGRSADFVAESIGSDVGVLGFAIEGPSQARIECEDQNDGSC--DVKYWPTEPGEYAVHVMCDDEDIEDSPFMAYIVPDDKSSDPSQVKAYGPGLEKSGCIINKPAEFTVEAKNAGKGPLKIIAQNADGEPIEVKMR--NKGDNVYSCTYTPTSALKHTVAVTWGGVSVPNSPFRVNVG---KGSHPHKVKVFGPGVERTGLKAHEPTHFTVDCTEAGEGDVSVGIKCDANIISDKEEDVDFDIIPNANDTITVKYIPPGAGRLTIKVLFTDQEIPVSPFRVKVEPSHDASKVKADGPGLARAGVESGKPTHFTVHTKGAGKAPLDVQFSGPIKGEPVQDFEII--DNYDYSYTVKYTPVQQGEMVI-NVTFGGDPISKSPFAVGVAAPLDLSKIQVNGLESRVEVGQDQEFAVSTKGAGGQGKLEARITSPSGKSVPCAVEPQPGKGASLVKYIPKEEGVYTVEILYEGNPVPGSPFPVDAMLPPDPSKVKAFGPGLKGGLVGNPAEFTIDTKGAGTGGLGLTVEGPT---EAKIECSDNGDGTCSVSYLPTEPGEYLVNILFEDVHVPGSPFHADIQYPFDPTKVVASGSGLKRGKVGEISVVNVDCAKAGPGQLTLEAMSDAGSKAKTEVLDNKDGTYTVTYVPLTAGMYTLLLKYGGQAVPNFPAKVVVDPAV-------DTSKVKVFGPGVAGEGLFREATTDFTVDARALTKVGGKHIKAQVKNPSGAATDCVIADQGDGTYKVEYTPFENGVHAVEVLYDDTPVPKSPFQVGVGEGCDPARVVAKGPGLEEGLTDKANKFSIITRGAGIGGLGITVEGPSESKMSCKDNKDGSCNVEYTPYAPGLYDVNITYGGQHIQGSPFKVPVKDVVDASKVKLSGPGV-GSGVRAKIPQSFTVDCSKAGVAPLAVAV--TGPKGVAEPVDVIDNGDGTHTVAYTPSVEGPYSVVVKYADEEVPRSPFKLRVLPTHDASKVRASGPGLTTG----LPASLPVEFTIDAKDAGEGQLSVQITDQDGKLKTANISDNQDGTYKVSYVPDKVGRYTIVIKYGGDEIPTSPYRVRATTSGDASKCTVTGPGIGPTIGIGEEVGFVVNTKGAGKGKVSCVVVTPDGTEVEADVVENEDGTFDIFYTAPKPGTYVIYVRFGGENIP-----------KSPFKVMVTDGAYIPVNS--MNGTGFRPFDMVIPFAFRKGEITGEVHMPSGKTTQPEIIDNKDGTVMVKYAPTEAGLHEMHIKYNGSHIPESPLQFYVNNA-NSPNVTAYGPGLVYGVANKPATFTIYTEDAAEGGLDLAIEGPSKAEITCIDNKDGTCTVTYLPTLPGDYNILVRYNEKHIAGSPFTARITEDNKRRSQVKLGSAADFALDITETDLSLLTASIKAPSGRDEPCLLKRQPNNRIGISFIPREVGEHLVSIKKNGRHVANSPITIMVVQSEIGDAGRVQVFGQGLVEGRTFEMSDFVVDTRDAGYGGLALSIEGPSKVDIQTEDMDDGTCGVSYCPTEPGTYIVSIRFAEDHVPGSPFSVKVTG--EGRIRESISRRQKAASVASVGSVCDLNLKIPEIDALDMSAQVTSPSGSVEPAEIVEVGNHTYCVRFVPHEMGVHTVNVKYRGQHVPGSPFQFTVGPLGEGGANKVKAGGPGLERAEIGVPAEFSIWTREAGAGGLSIAVEGPSRAEISFEDRKDGSCGVSYVANEPGDYEVSVKFNEEHIPESPYLV------------PVMAPS---DDARRLTVTSLQESGLKVNQPTSFAVRLNG-AQGAIDAKVHSPSGALEECVVSELEQDKYAIRFIPRENGIHTIDVKFNGTHIPGSPFEVRVGEPGQGGDAGLVTAYGSGLERGTTGNQADFIINTTKAGPGSLAVTIEGPSKVKMECQECSEGFKVQYTPMAPGNYLISIKYGGPNHINGSPFRAKVMGPRLVNVTNASESSTLTVDPVIRPSSANSYSSLRAASDASKVSSRGSGLSKAYVGQRASFSVDCSKAGKNMLLVGVHGPQTPCEEIMVKHMGSLQYNVSYVLKERGSYLLAVKWGEDHIPGSPFHVTVP 2576          

HSP 2 Score: 1089.33 bits (2816), Expect = 0.000e+0
Identity = 845/2580 (32.75%), Postives = 1245/2580 (48.26%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNK-ELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKES-KIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGS-PSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGI------SVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINN---LNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVK----LQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYP----ETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS----NFEPNEEIIYPVQRTNEK----------AELRKPN---VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTI-YPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQP-QKFTVD---LEGAGQGGLGLSIEGPADAQIQCF--DNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPF---IVPVHSEAKPEQCYIEGPILNE-VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVD--STIPSGQVTAYGPGLSYGRP-DMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQ--CIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFT----------------AKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIEC--HDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEM-CEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVG--PLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSK----AEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXI---HHGHTG-RINE--FFVDTSNAGNGALTVTIDGPSKVQLNC---QENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWG--NHDVPGSPFEIVV 7621
            E++LAEDA WK IQ+NTFTRW N+HLK  N  I DLQ DL+DGL+LI L++ LS    +R  H+RP FR  KLENV++ L FL+  E +RLV+IDS  I D  LKLILG++WTLILHYSI+MP+WEGE    +D + K  +PKQRLLGWI  K+P  P+ NF+ DW DG A+GALVD+CAPGLCP+W  WD ++ ++NA EA+  A++ L +  +I P E+I+P VDE+++MTYLSQFP A+L   APL PK N  + RAYGPG+E  GN +  PA FTVDTF+AG+G + + + +P+G++E  E+   PN+ +  +S +YIP + G +++ + FA  +IP SPF+VNV  A GD SKVTA GPG+EP+GN   + T+F+++TA AG G V  VI D +G K++V+  +  + ++ F   Y   + G HSVN+ F G+ I  SP+ V V   +S    +   ATGRG+QP GVRVR VA+F+V T  AG  +L V V GP    E  ++ +     Y   Y P   G Y V I +G   I  SPF V V P   + KI+A+GPGL GGIV + A F  E+ G + G LGF+I+GPS+A+I+C D  DGS +V YWPT PGEYAVH++CDDE+I  SP+MA I  D K  DP +V AYGPGL  SG   NKPA+F V  KNAG  P  + A+  D  G+ I V++R+  D  YSC YTP    KHTV V++G V++P SPF+VNV +  +   +KV+GPG+ER   K +  T+F VDC  AG GD+ +      +++ +K  DV      N + T              TI++ F++ EIP SPF+V +E  +D  K K +           G+   F + T   G K   ++    P     PV+    +   +  +   +TP   G   + V   G+PI  SP+ V     ++  +      E+   +    ++A+  K           A++T     +V     P   +      + P EE +Y V+   E             +  P+   V A+G GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP EPG Y+VN+L+ D H+  SPF+  I YP         D  KV A G GL      +    + +V        G G +     +    ++   V +N DGTY+ +Y P   G + + + Y G  V   P  V V    D S+++ +GPG+  EG+ ++    FTVD   L   G   +   ++ P+ A   C   D  DGT  V+Y P + G + V + +++  +P SPF V + +  D ++V   GPGLE   +     ++F++    AG   L + V   +   +        +  G  +V Y P   G  ++ + Y    + GSPF   V +  +  KV ++G GV    G  +  K+P  FT++   AG + L + VTGP   +  +DV ++GDGT T  Y   V G Y+V V Y ++ VP SPF   ++P H  +K       GP L   +P    V   ++ ++AG+G LS +     G +   +I + + G   VSYVP K+G Y + + +  + IP    R  A       S + +    T     P I     V       G     V  VV  P   +    ++ N DGT  + Y   + G + + V + G+ I  SPFK  V   + IP   +   G      RP DM   F         G ++  V  PS    Q   IDNK+GT  V Y P   G + + IK+   HI  SP                    ++G   K +   + T         +     L+  +  P+  E +C   +  +G   +++ P   G++ + V  + +HI  SPF   + E+     S+VKL               F +D        L+ SI+ PS  +  C      +    +++ P E G +++++K    +V  SP  + +      S      R Q   +    G   E++  +            +S  G  ++  +   + D    + + P E G + VS++    HV GSPF   V     I     +     S    G   D N   +   E  A  +S  +  PS     AEI    N   +  V +  +E G +  ++K+  +HVPGSPF   +   P                 +  +       +   IG  A F I       G +S  V  PS  E   S     +    V +V  E G + V V  N   IP SP+ V V   +     +       +G ++N+   F    N   GA+   +  PS     C   +  +  Y   ++P   G +TI +K+ G  HI GSPF V + G   Q  D+                           V   G GL+    G + +FI++   AG   L V + GP +    C+E       +  F+V Y     G +L+ +++G  NH + GSPF   V
Sbjct:    5 EKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIADLQLDLSDGLRLIALLEILSQKKMYRKFHQRPTFRQMKLENVSVALEFLDR-ENIRLVSIDSKAIVDGNLKLILGMVWTLILHYSISMPVWEGE----EDDEAKKATPKQRLLGWIQHKVPDLPITNFSQDWKDGKALGALVDSCAPGLCPDWETWDTEKPVENATEAMQLADDWLGIPQVIAPEEIIDPSVDEQSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGPGIEPVGNRVMRPAVFTVDTFSAGQGQVTVYIEDPEGRRE--EVKAVPNEGKKTFSVAYIPQVMGPHKVTVLFAGQQIPKSPFEVNVDKAQGDASKVTAKGPGLEPLGNIANKPTYFDIYTAGAGVGEVTAVIKDPQGNKNTVEALMEDKGDSVFRCTYRPVQAGPHSVNITFGGIAIPKSPYTVTVGPASSPGACR---ATGRGLQPRGVRVRQVADFRVDTRSAGSGELKVTVKGPKGLEEPVKLTEAMDGTYAYEYYPNTQGKYTVTITWGGQHIPKSPFEVVVGPEAGAQKIRAWGPGLEGGIVGRSADFVAESIGSDVGVLGFAIEGPSQARIECEDQNDGSCDVKYWPTEPGEYAVHVMCDDEDIEDSPFMAYIVPDDKSSDPSQVKAYGPGLEKSGCIINKPAEFTVEAKNAGKGPLKIIAQNAD--GEPIEVKMRNKGDNVYSCTYTPTSALKHTVAVTWGGVSVPNSPFRVNVGKGSHPHKVKVFGPGVERTGLKAHEPTHFTVDCTEAGEGDVSVGIKCDANIISDKEEDVDFDIIPNANDTI-TVKYIPPGAGRLTIKVLFTDQEIPVSPFRVKVEPSHDASKVKADGPGLARAGVESGKPTHFTVHTKGAG-KAPLDVQFSGPIKGE-PVQDFEIIDNYDYSYTVKYTPVQQGEMVINVTFGGDPISKSPFAVGVAAPLDLSKIQVNGLESRVEVGQDQEFAVSTKGAGGQG--KLEARITSPSGKSVPCAVEPQPGKGASLVKYIPKEEGVYTVEILYEGNPVPGSPFPVDAMLPPDPSKVKAFGPGLKGGLVGNPAEFTIDTKGAGTGGLGLTVEGPTEAKIECSDNGDGTCSVSYLPTEPGEYLVNILFEDVHVPGSPFHADIQYP--------FDPTKVVASGSGLK-----RGKVGEISVVNVDCAKAGPGQLTLEAMSDAGSKAKTEVLDNKDGTYTVTYVPLTAGMYTLLLKYGGQAVPNFPAKVVVDPAVDTSKVKVFGPGVAGEGLFREATTDFTVDARALTKVGGKHIKAQVKNPSGAATDCVIADQGDGTYKVEYTPFENGVHAVEVLYDDTPVPKSPFQVGVGEGCDPARVVAKGPGLEEGLTD--KANKFSIITRGAGIGGLGITVEGPSESKMS----CKDNKDGSCNVEYTPYAPGLYDVNITYGGQHIQGSPFKVPVKDVVDASKVKLSGPGV----GSGVRAKIPQSFTVDCSKAGVAPLAVAVTGPKGVAEPVDVIDNGDGTHTVAYTPSVEGPYSVVVKYADEEVPRSPFKLRVLPTHDASK---VRASGPGLTTGLPASLPVEFTIDAKDAGEGQLSVQITDQDGKLKTANISDNQDGTYKVSYVPDKVGRYTIVIKYGGDEIPTSPYRVRA-----TTSGDASKCTVTGPGIGPTIGIGEEVGFVVNTKGAGKGKVSCVVVTPDGTEVEADVVENEDGTFDIFYTAPKPGTYVIYVRFGGENIPKSPFKVMVTDGAYIPVNSMNGTG-----FRPFDMVIPFAFRK-----GEITGEVHMPSGKTTQPEIIDNKDGTVMVKYAPTEAGLHEMHIKYNGSHIPESPLQFYVNNANSPNVTAYGPGLVYGVANKPATFTIYT--------EDAAEGGLDLAIEGPSKAEITCIDNK--DGTCTVTYLPTLPGDYNILVRYNEKHIAGSPFTARITEDN-KRRSQVKL----------GSAADFALDITETDLSLLTASIKAPSGRDEPCLLKRQPNNRIGISFIPREVGEHLVSIKKNGRHVANSPITIMV----VQSEIGDAGRVQVFGQGLVEGRTFEMSDFVVDTRDAGYGGLALSIEGPSKVDIQTEDMDDGTCGVSYCPTEPGTYIVSIRFAEDHVPGSPFSVKVTGEGRIRESISRRQKAASVASVGSVCDLN---LKIPEIDALDMSAQVTSPSGSVEPAEIVEVGNH--TYCVRFVPHEMGVHTVNVKYRGQHVPGSPFQFTV--GPLGE------------GGANKVKAGGPGLERAEIGVPAEFSIWTREAGAGGLSIAVEGPSRAE--ISFEDRKDGSCGVSYVANEPGDYEVSVKFNEEHIPESPYLVPVMAPSDDARRLTVTSLQESGLKVNQPTSFAVRLNGAQGAIDAKVHSPSGALEECVVSELEQDKYAIRFIPRENGIHTIDVKFNG-THIPGSPFEVRV-GEPGQGGDAGL-------------------------VTAYGSGLERGTTGNQADFIINTTKAGPGSLAVTIEGPSKVKMECQEC------SEGFKVQYTPMAPGNYLISIKYGGPNH-INGSPFRAKV 2446          
BLAST of Filamin vs. Ensembl Cavefish
Match: flnca (filamin-C [Source:NCBI gene;Acc:103033794])

HSP 1 Score: 1063.91 bits (2750), Expect = 0.000e+0
Identity = 758/2165 (35.01%), Postives = 1105/2165 (51.04%), Query Frame = 2
Query:  176 ERELAEDAQWKVIQKNTFTRWANQHLKPSNLIIDDLQYDLADGLKLINLVQELSGSN-FRHTHKRPNFRTQKLENVTMVLRFLEESEGLRLVNIDSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKT-NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE-SKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLI-SGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISV--------LDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKIN--NLNNT-TPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVK----LQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKV----------IATDRVNTKEYPETETPLLISADYA-----IDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIY---------PVQRTNEKAELRKP----NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGITKQ-PQKFTVDLEGAGQGG---LGLSIEGP--ADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIV---PVHSEAKPEQCYIEGPILNE--VPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRT-----------------EYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYV--DSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCI--DNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQI-------CVGTTSDVPLRISETDIN----NLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-----DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSS-SLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTV 6370
            E+ELAEDA WK IQ+NTFTRW N+HLK  N  + DLQ DL DGLKLI L++ LS    +R  H RPNFR  KLENV++ L FL+  E ++LV+IDS  I D  LKLILG+IWTLILHYSI+MP+W+ +D  ++       +PKQRLLGWI +K+P  P+ NF  DW DG A+GALVD CAPGLCP+W  WDP Q ++NA+EA+  A++ L V  +I P E+++P VDE ++MTYLSQFP A+L   AP+ P+  +  + +AYGPG+E EGN +  PA FTV+T +AG G + + V +P+G +E  ++  + +K+  YS SY+P + G +++ + FA  +I  SPF VNV    GDP+KV A GPG+EP GN   R T+F+++TA AG G V  VI+D +G+KD+V+  +  + ++ F   Y    EG H+++V FAG  I  SPF V +S     S+A    ATGRG+QP+GVRV++VA+F+V T+ AG  +L V+V GPG +    +++ V   +YEC Y P  PG Y V I +G   I  SPF V+V       K++A+GPGL  G+V K A F VE  G E G+LGFSI+GPS+AKI+C D GDGS +V YWPT PG+YAVH++CDDE+I  SP+MA I        P KV A+GPGL  +G+  N PA+F ++ + AG    +K    D  G  I ++I D  DGT+ C Y PK P KHT+I+S+G VN+P SP++V V E  +   +KVYGPG+E+   K++  TYF VDC  AG GDI I +          E   D  ++ +DN   T             YT+ + F+E EIP SP+KV +E  +D  K +     LN T   +     F I T   G K +PE+   +      PVK    +   +  +   +T    G  +++V   G+P+  SP+ +          +    +N K     +    ++   A     +  K  +    P+   KL P     V            + P EE  Y         PV  +    E   P     V AYG GL  G+   PA F ID+       LG+T+EGP EAKI+  DNGDGTCSV+YLP E G Y +N+LY ++HI  SPF   + P         D ++VT  GPGL          + FTV+       G+  +   I +     +   + NN+DGT+S +Y+P  DG + I I Y G  V K P  + V    D S ++ YGPG+E +G+ +     F VD     + G   + + I  P  ++      D  DGT  V+Y   + G + + + ++E  +P SPF V + +  D S+V+ YGPGLE  G  V  P+ FTV+ ++   A      I+ A+++    +    +  G   V Y+P   GN +I + Y    +PGSPF   V +  +  KV  +G G+    G  +   VP  FT++   AG + L++ + GP   +  + V N+GDGT T  Y     G YTV V Y +K+VP SPF V   P H  +K       GP L++  VP    V   ++ ++AG+G+L+ + + P G     SI++ + G  TVSYVP   G Y + + +  + IP        F P   YSI+      T + SK ++                   E +V+               V+       DV  ++ N DGT  + Y   E G + + + + GQ I  SPF      +  +P  +           +P       ++      G L+  V  PS    + +  DNK+GT  V Y P   G + + IK+   HI GSP   + F +  +   +       C GT +  P   +    N     L+  V  P+  E SC  K  ++G   +S+ P   G++ + V   G+HIP SPF   +  ++    S+       LN G   +    + +T       L+ SI  PS  E  C      + H G   +++ P E G + ++VK +  +V  SPF + +G  PS      R+         +    V E  +            S+  PS     CE +   D    + + P E G + +++K   +H+ GSPF   V
Sbjct:   33 EKELAEDAPWKKIQQNTFTRWCNEHLKCINKNVTDLQRDLGDGLKLIALLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLDR-ERIKLVSIDSKAIVDGNLKLILGMIWTLILHYSISMPMWDDDDDEEKKKL----TPKQRLLGWIQNKVPQLPINNFNRDWRDGKALGALVDNCAPGLCPDWETWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPRQLHPKKAKAYGPGIEPEGNMVMKPAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKVLFAGQDIDKSPFSVNVAKTVGDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEA---SNASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGK-GELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTV---KYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGVQVDTPTHFTIFTKGAG-KAKPEVHFSTGQKGN-PVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGKDQEFTVNTQGAGGQGNVGVKMVSPSGRPI-PCKLEPDRAKGVTNV--------KYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGKPAPFSIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPAL-------DASRVTVSGPGLERAKA--GEVATFTVDC---SRAGEAELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAVDTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVVEGCDPSRVRAYGPGLE--GGIVNKPNCFTVE-TRGAGAGGLGLTIEGASEAKMSCK---DNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRDVVDASKVKCSGPGL----GSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASK---VRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITIKYGGDQIP--------FSP---YSIQARP---TGDASKCLLSVSIGGRGVGSLGPNIQMCEETVISVDAKAAGTGKVTCKVLTPDGAELDV-DVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQATKEPVVPRDE----------KQPQFRPINLLIPFTVQQGALTGEVRMPSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPL--QFFVDAAESGMVTAYGPGLCHGTVNK-PATFTVVTKNAAEGGLSLAVEGPSKAEISC--KDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKITGDDSLRTSQ-------LNVGSAADVSLKITETD---LSSLTASIRAPSGAEQPCLLKTLPNRHIG---LSFTPKEVGEHEVSVKKSGKHVNNSPFKIMVG--PSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDIKCEDV--EDGTCRVTYCPTEPGNYIINIKFAEKHIPGSPFTVKV 2102          

HSP 2 Score: 985.712 bits (2547), Expect = 0.000e+0
Identity = 741/2302 (32.19%), Postives = 1116/2302 (48.48%), Query Frame = 2
Query:  941 RVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE----SKIKAFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDC--VDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPS-TVKAECF-DVTGQT---IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIET--YFVVDCKLAGSG--DIGISVLDEK--MRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAG--FTPTVIGPHTVTVECKGNPIGNSPYKVIA---TDRVNTKEYPETETPLLIS--ADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIYPVQ-------------RTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTI--EGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIE--------GPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPG------YNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPF------------RXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYN---FTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRP---CEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGN-HDVPGSPFE 7612
            +V+A GPGLE  GN    P  F + T  AG G++ +++++P+G+K+  E+      +  + C+Y P +EG + I + FA   IP SPFKV++  A+ + S   A+G G++P G  V     F VFT  AG G +   +    G +  VK  +    +  +  +Y     G ++V + + G  I  SPF V V  +   +  ++  A G G++     V   A+F V         LG ++ GP ++  +C+ K    C  +  Y P  PG Y V +   +  I  SPF   + P        K++AFGPGL  TG IV+ PA F ++      G L    +      ID    D GDG+    Y P  P ++ + I     N+P SPY     L  +   P KV  YGPG+  +G+ +++P  F V+   AG    ++  +C   V G     I   I  N++ T++ +YTP  PG++TV+V +    IP SP+KV V  + +A  ++  GPG+ +    ++T  +F +  K AG    ++  S   +   ++D  ++  DN D ++T+KYT    G      +      +P+SPF + +    D  K K+  LN    +G+  EF + T   G +    + + SP+G  +P KL+      V    + P   G + V V   GNP+  SP+ V A    D    + Y       ++   A ++ID K        +      P E + ++   N +   S ++ P E   Y +              +   K  L    VT  G GL +  A   A+F +D +    A L V I  +    A++   +N DGT SV Y P+  G Y +++ Y  + +   P  + + P         D + V  YGPG+ P GV +D  + F V+A+  +  G   ++  I NP    +   + +  DGTY   Y+   DG H I++ YD V V KSP+ V V +G DPSR+RAYGPGLE GI  +P  FTV+  GAG GGLGL+IEG ++A++ C DNKDG+CSV+Y+P  PG+YD++I +  + IPGSPF V + D+VD SKVKC GPGL  +G R   P  FTVD SKAG A L V +      + +P  +L  +  G   V Y P   G   + V Y +  VP SPF  +   + +  KV  +G G+       +   +P  FTI+ RDAGE  L + +  P  +     + ++ DGT+T  Y  DV G YT+ + YG   +P SP+ +         +C +         G +   + + +   I V+ + AG G ++ K + P G  +   +     G   + Y   + G Y + + F  ++IPN     +  Q  ++  + R       ++ +P  R    ++ F    G +   VR     PS +   P + +N DGT+TV+Y P+E GLHE+++ Y+G  I GSP +F+VD+   SG VTAYGPGL +G  +  A FT+VTK+A  GGLSLAVEGPSKAEI C DNK+GTC VSYLP APGDY+I +KF  KHI GSPFTAKI G+   R SQ+ VG+ +DV L+I+ETD+++L A + +P+G E+ C LK L N ++G+SFTPKEVGEH V+V +SG+H+ NSPFKI VG +EIG ASRV+ +G GL +    E  +F VDTRNAGYGGL LSIEGPSKV+I+C D  DGTC VTY PTEPG YIIN+K+A+ ++PGSPF V + G     + E I+R + A  ++ +G +C+LNL IPG        Q   T +    S ++   E   +S      R    +  VH   V+   +     PF+   G ++  G   +   GS   +    D    T      G   ++           +  ++ D +  V +   E G +  S+K++ +HVPGSPF   +   P                    +       Q    G    F I       G +S  V  PS  E   S     +    V ++  E G + V +  NN  IP SPF            R+ V  +      ++   +      F    N   G +   +  PS V   C   +   +     ++P   G ++I +K+ G +HI GSPF V +    +  +                          P  V   G GL+    G   EF+V+   AG   L V + GP +    C E          +++NY     G +L+ +++G    + GSPF+
Sbjct:  385 KVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEAS-NASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVK--VRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQ---AGLQKVRAWGPGLKTG--MVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSC--DVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGKGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRV---LVGEGCHPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGVQVDTPTHFTIFTKGAGKAKPEVHFSTGQKGNPVKDFEII--DNHDYSYTVKYTALQQGNMSI-SVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGKDQEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGKPAPFSIDTKGAGAGG--LGLTVEGPCE-AKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPALDASRVTVSGPGLERAKAGEVATFTVDCSRAGEAELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAV-------DTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVVEGCDPSRVRAYGPGLEGGIVNKPNCFTVETRGAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRDVVDASKVKCSGPGL-GSGVRAHVPQTFTVDCSKAGLASLDVKLYGPG-GATEPVAVL-NNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKAG---VPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITIKYGGDQIPFSPYSIQARPTGDASKCLLSVSIGGRGVGSLGPNIQMCEETVISVDAKAAGTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSP---FHVQATKEPVVPR-------DEKQPQFRPINLLIPFTVQQGALTGEVRM----PSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPLQFFVDAA-ESGMVTAYGPGLCHGTVNKPATFTVVTKNAAEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKITGDDSLRTSQLNVGSAADVSLKITETDLSSLTASIRAPSGAEQPCLLKTLPNRHIGLSFTPKEVGEHEVSVKKSGKHVNNSPFKIMVGPSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDIKCEDVEDGTCRVTYCPTEPGNYIINIKFAEKHIPGSPFTVKVTG--EGRMKESIMRKRQAPSIASVGTICDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKT----RGGETKREVH---VEESTKVGGRDPFRDIFGSIL--GRESLGCFGSLTSK---EDVQGMTAQVTSPGGKVVN----------AELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTV--GPLGE------------GGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAE--ISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPIATLSDDARRLTVTSLQEKDLRVYQEAS------FAVQRNGARGVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDVKFNG-SHIPGSPFNVRVGETGHAGD--------------------------PGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVEC------AEGYKINYTPMAPGNYLISIKYGGPQHIVGSPFK 2560          

HSP 3 Score: 591.267 bits (1523), Expect = 2.788e-171
Identity = 573/2002 (28.62%), Postives = 887/2002 (44.31%), Query Frame = 2
Query:  941 RVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEI---FDS-PNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKP-KITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGF-ADLGVNVYGPGRSLEKCQIK-KVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVD-VAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGF-SIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKT--NIETYFVVDCKL---AGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVA-GFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLL-------ISADYAIDNKAYNKPSIPVQ----SAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQ-RTNEKAELRKP------------NVTAYGEGLVK-GV-ANTPASFIIDSTEEPPAPLGVTI---EG-PMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVA----KVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLE---GAGQGGLGLSIEGPA--DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTP-GLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVP-------------GNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIE--GPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIP----------NGSIRQYAFQPQEQYSIE-------------------------------RTTHHYTTEQSKPIIRT------------EYSVVDFKFPVGPVFDYV--RAVVNC---PSNRKDV----------------PRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSG--QVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDI---------NNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGEN-EIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYAD-SNVPGSPFAVNIGGY----------PSSSLTERILRHQDAAEVSQIGN-----------VC-----------ELNLIIPGYNQRNTTASVISPSGSFEMCE---IIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTV 6370
            +V+ YGPG+E  G     P  FTVD   AG+G++ I +    G     E    FD   N    ++  Y P   G Y +++ FA  EIP+SP+KV V+  + D  KV A GPG+   G +V   T F +FT  AG    + V   T  + + VK  +I    +  + ++YT  ++G  S++V   G  +  SPF + V+     S  K      +G+  E V V    EF V+T+ AG   ++GV +  P      C+++   +  +    YIP   G Y VD+ Y  NP+  SPF V+ + P   SK++A+GPGL GGIV KPA F ++T G        +++GP EAKI+C DNGDG+ +V+Y PT  G+Y ++IL  +++IP SP+ A ++      D  +VT  GPGL       + A F V+   AG  + +  E    +G T  V+I +NNDGT+S  YTP+  G +T+ + YG   +P+ P ++ V  A + + +KVYGPG+E      ++ T+F+VD +     G   I + +++    +      D GDGT+ ++YT    G     ++F+ E  +P+SPF+V +    D    ++         G +N+    T          + +     S   +  ++  +G  +  + P + G + + +   G PI  SP+ V+  D V+  +  +   P L       +   + +D       S+ V+         PV   N    +       N+ P+EE  Y V  +  +K   R P             V A G GL K GV A+ P  F ID+ +     L V I   EG P +A I   DN DGT +V+Y+P   G Y + + Y  + I  SP+++   P   +S  +  V+     V + GP +           + TV +      G G V   +  P        V  N DGT+   Y+    G++ I I + G  +  SP+ V   +  +P   R           KQPQ   ++L       QG L   +  P+   A+    DNKDGT +V+Y P + G +++ IK++  HIPGSP    + D  +   V  YGPGL      V  P+ FTV    A E  L +     A +    A+I  K    G   V+Y+P   G+  I V ++   +PGSPF   +           TG+               SL T        +D+ L +T  +  S+   +         C  K  +P             G + V V    K+V  SPF + V      E   +   G  L E    +     V+T+NAG G L     GP    + C  E+   G   V+Y P + G Y + + F +++IP           G +++   + ++  SI                                R++H YT  +   I +T            E + V  + P   +F  +  R  + C    ++++DV                  L+ +GD T +V++ P+E G H + V Y+GQ + GSPF+F V      G  +V A G GL  G   +   F+I T++AGAGGLS+AVEGPSKAEI   D K+G+C VSY+   PGDY + IKF ++HI  SPF   I        ++ V +  +  LR+ +              ++A V SP+G  E C +  +      I F P+E G H ++V  +G HIP SPF + VGE    G+   V  YG GL  G      +FVV+T NAG G LS++I+GPSK +++C +  +G   + Y P  PG Y+I++KY    ++ GSPF   I G            SS L E + +    A      +           VC           + N+     ++  T   ++   G    CE   +  L +  +++ +  KE G + V VK  +  V GSPF  TV
Sbjct:  774 KVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVE-PSHDAGKVRAEGPGLNKTGVQVDTPTHFTIFTKGAGKAKPE-VHFSTGQKGNPVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKV-----QGLN-EKVEVGKDQEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGKPAPFSIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAVK---PALDASRVTVSGPGLERA-KAGEVATFTVDCSRAGE-AELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAVDTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLI-EVFYDEVAVPKSPFRVSVVEGCD--PSRVRAYGPGLEGGIVNKPNCFTVETRGAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRDVVDASKV-KCSGPGLGSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVLN----NGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQ--DNKDGTYTVSYVPDVTGRYTITIKYGGDQIPFSPYSIQARPTGDASKCLLSVSIGGRGVGSLGPNIQ--------MCEETVISVDAKAAGTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQATK--EPVVPRD---------EKQPQFRPINLLIPFTVQQGALTGEVRMPSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPLQFFV-DAAESGMVTAYGPGLCHG--TVNKPATFTVVTKNAAEGGLSL-----AVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKI-----------TGDD--------------SLRTSQLNVGSAADVSLKITETDLSSLTASIRAPSGAEQPCLLK-TLPNRHIGLSFTPKEVGEHEVSVKKSGKHVNNSPFKIMVGPSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDIKC--EDVEDGTCRVTYCPTEPGNYIINIKFAEKHIPGSPFTVKVTGEGRMKESIMRKRQAPSIASVGTICDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVHVEESTKVGGRDPFRDIFGSILGRESLGCFGSLTSKEDVQGMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTVGPLGEGGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPIATLSDDARRLTVTSLQEKDLRVYQEASFAVQRNGARGVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDVKFNGSHIPGSPFNVRVGETGHAGDPGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVECAEGY-KINYTPMAPGNYLISIKYGGPQHIVGSPFKAKITGVRLSGGHSLHETSSVLVETMTKSSKVAGAYSSASSSSLSSDGSRVVCQGAGLTRAFIGQKNIFTVDCSKAGTNMLMVGVHGPRTPCEDVYVKHLGNRLYNVTYTVKEKGNYVVIVKWGDETVPGSPFHVTV 2696          

HSP 4 Score: 516.538 bits (1329), Expect = 1.882e-147
Identity = 505/1816 (27.81%), Postives = 790/1816 (43.50%), Query Frame = 2
Query: 2417 KVYGPGIERAKTNIE--TYFVVDCKLAGSGDIGISVLD-EKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPI-ESDNDFKKYKINNLNNTTPIGQLNE----FEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNG---FVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLIS-------ADYAIDNKAYN----KPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRT-NEKAELRKP------------NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITK--QPQKFTVDLEGAGQGGLGLSIE------GPADAQIQCFD---NKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKS--VKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAG-ESDLELMVTGPNNESVNLDVD-NHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYG--RPDMHAHFTIVTK---DAGAGGLSLAVEGPSKA--EIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIF--GEPKKRSQICVGTTSDVPLR----ISETDINNLNAIVISPTGREES-CTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQ-FVVDTRNAGYGGLSLSIEGPSKVE--IECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGP--HKVHIMGSGVERGLAN----DANQFTIYTREAGAGSLSIAIEGPSKAEIDFQ--DNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIH-----HGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            K YGPGIE     +     F V+   AG G++ + V D E  R+   V  +N                 + +++ F+  +I +SPF V + ++  D  K +        P G + +    F+I T   G+     +IV  P G +  V++   N G   F   + P + GPHT+ V   G PI  SP+KV  ++  N      T   L          AD+ +  K       K S+        PV+  +V           ++ P     Y V  T   +A  R P             V A+G GL  G+    A F++++       LG +IEGP +AKI+  D GDG+C V Y P EPG Y V+V+ +DE IKDSPF   I P    ++N     KV A+GPGL PTGV  +  ++FT++A+     GKG +K    +         + +  DGT+ C Y P    +H I I++ GV V  SPY V V +G  P +++ YGPG+E+   K  +P  FTVD   AGQG + + I+      G A+A I  FD   N + T +V+Y P  PG Y V + F EK IP SP+ V +    D  KV+  GPGL + G +V TP+ FT+    AG+A  +V+   T  K   VK  +I+       + V Y     GN  I V +    VP SPF  +V    +  KV V G   +   G          FT+NT+ AG + ++ + +  P+   +   ++ +   G    +Y     G Y V V Y    VPGSPF V     A P +    GP L    VGK     ++T+ AG G L     GP    + C  ++   G  +VSY+P + G Y + +++ +++IP GS  + A +P    S   T      E++K     E +            +    +V+      +V R+ NN DGT +V Y P   G + + + Y GQ +   P +  V+  + +  V  YGPG+       D+  HF +  +     G   + + +  PS +  +    D  +GT  V Y     G + I + + +  +  SPF   +    +P +      G    +  +      ET       + ++  G  E+  + K  ++G   + + P   G + +N+   G+ IP SPF + V   ++ +AS+VK  G GL  G+     Q F VD   AG   L + + GP      +   +N DGT  V Y P+E G Y + VKYAD +VP SPF V+      +S         D A V     V E  +      +   T  ++ P G  +   I    D  +++ ++P   G +T+++K     +  SP+     P  D       V I G GV     N    +    ++  + AG G ++  +  P  AE+D    +N DG+  + Y   EPG YV +I+F  +H+P SPF +Q  + P            ++  D +      +           N +I +  +  G+++  V  PS K     I    +   +V + P E G+H + +  + + IPGSP +  V          +     HG   +   F V T NA  G L++ ++GPSK +++C++N+ G    +Y+P APGDY I +K+ G  HI GSPF   I+G+     DS+R ++                             L V      +  I +  L+         SG  +PC    +K L N    +++  +E G H + V+     V  SPF+I+V
Sbjct:  287 KAYGPGIEPEGNMVMKPAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKVLFAGQDIDKSPFSVNVAKTVGDPNKVQARG-PGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIV-DPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEASNASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVKVRDV----GDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILP----AANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQA---GKGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADID-FDIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGVQVDTPTHFTIFTKGAGKAKPEVH-FSTGQKGNPVKDFEIIDNHDYS-YTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGK------DQEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGKPAPFSIDTKGAGAGGLGLTVEGPCEAKIEC--QDNGDGTCSVSYLPTEAGDYNINILYGEKHIP-GSPFKAAVKPALDAS-RVTVSGPGLERAK---AGEVATFTVDCSRAGEAELTVEIVSDSGATAEV-RIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAVDTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVVEGCDPSRVRAYGPGLEGGIVNKPNCFTVETRGAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLV--RDVVDASKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKAGVPASLPV-EFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITIKYGGDQIPFSPYSIQARPTGDASKCLLSVSIGGRGVGSLGPNIQMCEETVISVDAKAAGTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQATKEP------------VVPRDEKQPQFRPI-----------NLLIPFT-VQQGALTGEVRMPSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPLQFFVDAAESGMVTAYGPGLCHGTVNKPATFTVVTKNAAEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDGK-HIPGSPFTAKITGD-----DSLRTSQ-----------------------------LNVGSAADVSLKITETDLSSLTASIRAPSGAEQPCL---LKTLPNRHIGLSFTPKEVGEHEVSVKKSGKHVNNSPFKIMV 2007          

HSP 5 Score: 438.728 bits (1127), Expect = 2.624e-123
Identity = 414/1544 (26.81%), Postives = 671/1544 (43.46%), Query Frame = 2
Query: 3164 IYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPM----EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDS---FSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTV--DNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLE-EGI-TKQPQKFTVDLEGAGQGGLGLSIEGPADAQI--QCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVL---NSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKT--VTIPVNTQNAGDGILS------AKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYG--PGLSYGRPDMHAHFTIVTKDAGA-GGLSLAVEGPSKAEIQCI---DNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIF--GEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQ-----NGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSI--EGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQR-----NTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKAN----FVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGH--------TGRINEFFVDTSNAGNGALTVTIDGPSKV--QLNCQENESG-YNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMIS-GSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEI 7615
            + P Q   +KA+   P +   G  ++K     PA F +++ +     + V +E P     EAK+   ++   T SV+Y+PK  G + V VL+  + I  SPF+V +      +  + D  KV A GPGL PTG        F  +T  A      G G V  +I +P  ++ T  V  +N  D  + C+Y P ++G H I +++ G P+ KSP+ V + + S+ S  RA G GL+ +G+  K+   F V  +GAG G L +S++GP  A++  +  D  DG     Y P  PG Y V+I +  + IP SPF V +     + KV+ +GPGL+     V   + F V+A       L  ++   +   ++          G  DV Y P   G+  + V+ ++  +  SPF+ ++L   N   PEKV   G G++P    +I N +P+ FTI+ R AG+ +L++         +++ + + GDGTF C Y    P  +T+ + +G  NVP SP+ V V     P++  + GP + +  +  +      V+   AG G +S      A  VG     +   I        TV Y P   G Y V ++F ++ IP+   +       +   +            +    T +++  F    G     V        N      +I+N D + TV+Y   + G   + V + G P+  SPF   V   +   +V   G    +  G+      FT+ T+ AG  G + + +  PS   I C    D   G  +V Y+P   G Y + + +    + GSPF  +     +P K      G    +  + +   I+   A         E     +++     +G   +S+ P E G++ +N+L   +HIP SPFK  V      +ASRV + G GL      E   F VD   AG   L++ I  +  +  E+  ++N+DGT  VTY P   G Y I+++Y    VP  P  + +     +  T  +  +    E   +      + I+    Q      +    +I+PSGS     I    D  + + +   E G+H + V  D   V  SPF+ +V    D  P +V   G G+E G+ N  N FT+ TR AGAG L + IEG S+A++  +DNKDGSC V Y    PG+Y  +I +  + +PGSPF                   +++  D    S       G   G +A+    F ++       S+   +  P    +  ++    +  ++V++ P E G + V V   +  +P SPF+V       + +    G              EF +D  +AG G LTV I  P     + + Q+N+ G Y  +YVP+  G YTI+IKYGG+  I  SP+ +             R T   ++ +  +S G    G   P    CE                VDA  AG   +   V  P     +V++    +  F + Y   E G++++ +R+G   +P SPF +
Sbjct:  276 VKPRQLHPKKAKAYGPGIEPEGNMVMK-----PAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKVLFAGQDIDKSPFSVNV------AKTVGDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGA------GAGDVSVVIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEASNASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTG--MVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIE----CEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPT--GVIVN-MPAEFTIDARQAGKGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGVQVDTPTHFTI--FTKGAGKAKPEVHFSTGQKGNPVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGK---DQEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGKPAPFSIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAV--KPALDASRVTVSGPGLERAKAGEVATFTVDCSRAGEAELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQV---EPAVDTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVVEGCD--PSRVRAYGPGLEGGIVNKPNCFTVETRGAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPF-------------------HVLVRDVVDASKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITIKYGGD-QIPFSPYSI-----------QARPTGDASKCLLSVSIGGRGVGSLGPNIQMCE-----------ETVISVDAKAAGTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHV 1739          

HSP 6 Score: 420.239 bits (1079), Expect = 1.163e-117
Identity = 232/497 (46.68%), Postives = 311/497 (62.58%), Query Frame = 2
Query: 6194 RNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXX---------XIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKS-LTQTVHMISGSTQKGP----------SKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            +  TA V SP G     E++   D+ +S+RF+P E+G HTVSVK   +HV GSPFQFTVGPL +GGPHKV   G+G++RG+A    +F+I+TREAGAG LSIA+EGPSKAEI F+D KDGSCGV+Y V EPGDY  SIKFN+EH+P SPF++ I                 + +D+R +++ +LQ++   +  +A+F +  +G   G I A V SPS   +   I+ +D ++ ++ F+P ENG+H++ V  N S IPGSPF V VGE   +G+         G+  G TG   EF V+T NAG+GAL+VTIDGPSK +++C E   GY   Y P APG+Y ISIKYGG  HI+GSPF   I+G       S+ ET S L +T  M   S   G           S    V C+G GL  A IG++N F VD   AG ++L VGV GP  PCE+V +KHLGN  + V Y V+EKG ++++V+WG+  VPGSPF + VP
Sbjct: 2219 QGMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTVGPLGEGGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPI---------------ATLSDDARRLTVTSLQEKDLRVYQEASFAVQRNG-ARGVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDVKFNGSHIPGSPFNVRVGETGHAGDPGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVECAEGYKINYTPMAPGNYLISIKYGGPQHIVGSPFKAKITGVRLSGGHSLHETSSVLVET--MTKSSKVAGAYSSASSSSLSSDGSRVVCQGAGLTRAFIGQKNIFTVDCSKAGTNMLMVGVHGPRTPCEDVYVKHLGNRLYNVTYTVKEKGNYVVIVKWGDETVPGSPFHVTVP 2697          

HSP 7 Score: 369.392 bits (947), Expect = 4.769e-102
Identity = 339/1211 (27.99%), Postives = 532/1211 (43.93%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSK----VTASGPGIEPVGN--EVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKK--YKINNLNNTTPIGQLNEFEILTP---FDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVI-----------ATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNG-KGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQ---GSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKF-NEKHIPGSPFTVPI--------HDIVDVS------------------------------KVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPG--LFDVTYIPENIGNCEIEVLYNNMQVPGSPF 4354
            ++ +VRA GPGL+  G     P  FT+D  +AG+G L + +L+P+G+ +   I D  NK+  Y+ SY+P + G Y I IK+   +IP SP+ +  +   GD SK    V+  G G+  +G   ++   T  +V    AG G V C +L   G +  V   + +  +  F I YT  E G + + + F G  I +SPF V  +        K+        QP+   +  +  F V         L   V  P     +  I+          Y P   G + +DIKY  N I  SP    V   +   + A+GPGL  G V+KPA F V T N   G L  +++GPS+A+I C DN DG+  V+Y PT PG+Y + +  D ++IP SP+ A+I  D    D L+ +    G  + +S       I  T  +   ++++A     +G   P  ++   +      +TPK  G+H V V     ++  SPFK+ V   E G A+ ++ +G G+  A T     F VD + AG G +G+S+  E    V +  +D  DGT        T    Y I I F+E  IP SPF V +  +   K+   +     +   +G + +  +  P   F     +  +       S    + + T      G          V VE      G  P++ I               + +KE  +  T  + S    + N    +      S +  P E  +       + Q     P +  + P+       E     V A G GL +G+A  P  F I + E     L + +EGP +A+I + D  DG+C V+Y+ +EPG Y V++ +N+EHI DSPF V I      ++  DD  ++T        T + +     +   +  +  NG +G++ A + +P      C + +      +  + P  +G H ID+ ++G  +  SP+ V V +     DP  + AYGPGL+ G T  P +F V+   AG G L ++I+GP+ A++ C +  +G   + Y P  PG+Y +SIK+   +HI GSPF   I        H + + S                              +V C G GL R  + +   + FTVD SKAG   L V V    T    P + +     G  L++VTY  +  GN  + V + +  VPGSPF
Sbjct: 1546 DASKVRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQD--NKDGTYTVSYVPDVTGRYTITIKYGGDQIPFSPYSIQAR-PTGDASKCLLSVSIGGRGVGSLGPNIQMCEETVISVDAKAAGTGKVTCKVLTPDGAELDVD--VVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQAT--------KEPVVPRDEKQPQFRPINLLIPFTVQQ-----GALTGEVRMPSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPLQFFVDAAESGMVTAYGPGLCHGTVNKPATFTVVTKNAAEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKITGD----DSLRTSQLNVGSAADVSLK-----ITETDLSSLTASIRAP----SGAEQPCLLKTLPNRHIGLSFTPKEVGEHEVSVKKSGKHVNNSPFKIMVGPSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSI--EGPSKVDIKCEDVEDGTC-RVTYCPTEPGNYIINIKFAEKHIPGSPFTVKVTGEGRMKESIMRKRQAPSIASVGTICDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETK----REVHVEESTKVGGRDPFRDIFGSILGRESLGCFGSLTSKEDVQGMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTVGPL------GEGGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPI------ATLSDDARRLTV-------TSLQEKDLRVYQEASFAVQRNGARGVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDVKFNGSHIPGSPFNVRVGETGHAGDPGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVECAEGY-KINYTPMAPGNYLISIKYGGPQHIVGSPFKAKITGVRLSGGHSLHETSSVLVETMTKSSKVAGAYSSASSSSLSSDGSRVVCQGAGLTR--AFIGQKNIFTVDCSKAGTNMLMVGVHGPRT----PCEDVYVKHLGNRLYNVTYTVKEKGNYVVIVKWGDETVPGSPF 2692          

HSP 8 Score: 217.624 bits (553), Expect = 7.849e-56
Identity = 162/523 (30.98%), Postives = 241/523 (46.08%), Query Frame = 2
Query: 5531 IFGEPKKRSQI-CVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPS-------SSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVI-----SPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGG-PHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVN----EPGDYVCSIKFND-EHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAA-------------------LQDQGFN---IGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPF 6976
            IFG    R  + C G+ +      S+ D+  + A V SP G+  +  L    +    + F P E+G H V+V  SG+H+P SPF+  VG    G   +V+  G GL  G+     +F + TR AG GGLS+++EGPSK EI   D  DG+C V+Y   EPG Y +++K+ + ++P SPF V I            +SL E+ LR    A  +                QRN    VI     SPSG  E C I  +  ++ +IRF+P+E GVH++ VK +  H+ GSPF   VG     G P  V   G G++ G      +F + T  AG+G+LS+ I+GPSKA++D  +     C   Y++N     PG+Y+ SIK+   +H+ GSPF  +I     S      +  +++       S  A                    Q  G     IG K  F ++        +   V  P    +   +  + N  Y+V +   E G + V V   +  +PGSPF
Sbjct: 2196 IFGSILGRESLGCFGSLT------SKEDVQGMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTVGPLGEGGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPIATLSDDARRLTVTSLQEKDLRVYQEASFAV---------------QRNGARGVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDVKFNGSHIPGSPFNVRVGETGHAGDPGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVE-----CAEGYKINYTPMAPGNYLISIKYGGPQHIVGSPFKAKITGVRLSGGHSLHETSSVLVETMTKSSKVAGAYSSASSSSLSSDGSRVVCQGAGLTRAFIGQKNIFTVDCSKAGTNMLMVGVHGPRTPCEDVYVKHLGNRLYNVTYTVKEKGNYVVIVKWGDETVPGSPF 2692          
BLAST of Filamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004223.1 (pep scaffold:Pmarinus_7.0:GL476636:147693:235187:1 gene:ENSPMAG00000003806.1 transcript:ENSPMAT00000004223.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 516/1386 (37.23%), Postives = 749/1386 (54.04%), Query Frame = 2
Query: 3554 FKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHI-PGSPFTVPIHDIVDVSKVKCYGPGLERNGS-------RVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIE----GPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSI-ENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPI-TGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRI-SETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGG--------------PHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFR---------XXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLT----QTVHMISGSTQ-----KGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLM 7570
             +D+ S+F V+A+ I   G   V+  +  P    +  +V +NHDGTY+  Y P+  G H +++TY G  V +SP+ V V  G DPSR+R +GPGLE G+T +   F++D   AG GGLGL +EGP +A +   ++ +G  +V+Y    PG Y   I +    I  GSPF VP+ D V+ +KV+C GPGL  +         R   P  F+VD S+AG+A L V        + +P +++ ++  G+  +TY P  +G   + V Y    VP SPF  +VL + +  +V V+G GV       +   +P+ FTI+TR+AG++ L + +  P+       V + GDG F+  Y  DV G Y+V V YG   VPGSPF V   +     +C++     GP +    +G+   + VN + AG G ++ + + P    +   + EN   G  ++ +   + G Y + + F  + IPN      A            +   +TE  +P     + VV F    G    ++   V+ PS RK  PR+I+N DGT++V + P E GLHE+++ YNG  I + SP +FYVD  +    VTAYGPGLS+G    HA FTI TKDAG GGLSLAVEGPSKAEI C DNK+GTC VSYLP APGDY I +KF  +HI GSP+ A+I  +  + S +  G+T DV LRI  +TD   L A + +P+GR++ C LKRL +G +GISF+PKEVGEHLV+V   GRH+P+SPF++ VG +E+G+A RV+  G GL +    E  +F+VDTR AG+G + +S+EGPS+VE+ C D  DG C V Y P EPGTY + +K+A+  +PGSPF V + G       E +   Q AA V+ +G+ C L L IP  +  + T   ++    F +       DN  + R +P  +        + + H + S + + VG    GG               H+V+   +G    +       +I+ R           EGP         + +  C V      P DY  S++F DEH+PGSPF+L +D                +  +SR ++++ L + G+ +   A+F ++ +G   G I A V +PS   +   +S+ID  + +  FVP ENG+H V V  + + +PGSPFR              V+  G G+  G TG   EF VDTS AG G+L V IDGPSKV+++C E   GY+F Y+P APG Y +SI YGG +HI GSP+   ++G       ++ ET S      +    ++G        K  S    V+  G GL  A +GK+N F VD G AG +VL VGV GP  PCEEV++KH G  RF V Y V+E+G +LL+
Sbjct: 1138 LRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTA-QGPHGTREPVEVV-QAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVS---ASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLADGGPGPAIQ---IGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLAM-----------SEDISTESLRPF----HLVVPFSLRKG----HITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPSRSPLQFYVDE-MDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIREDSLRASLLSRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVSG--PGRQKEEVSLCQAAAPVAVVGSTCSLPLAIPVTDCTHRTLKRVASGKDFSLEGAHVRDDNCTAQRQLPPRV--------TRSGHYSVSRWLWRVGRGAAGGSDARLASPKIGETFSHRVNEGATGGVNRMNGRMGHGSIFLRGG---GGGGHTEGPFFNTGTCDAHFNSGCAVENVTPPPRDYEVSVRFEDEHIPGSPFLLTVDG---------------VCEESRRVAVSGLLESGWKVNHPASFAVHLNG-AKGRIEAKVHTPSGSVENCFVSEID--KVAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLI 2464          

HSP 2 Score: 441.425 bits (1134), Expect = 5.931e-125
Identity = 249/563 (44.23%), Postives = 346/563 (61.46%), Query Frame = 2
Query:  455 DSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFT----AEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV-APYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKV 2125
            DS  I D  LKLILGL+WTLILHYSI+MP+WE    +++D + K  +PKQRLLGWI  K+P  P+ NF+ DW DG A+GALVD+CAPGLCP+W  WD  Q + NA+EA+  AE+ L VA +I P E+++P VDE ++MTYLSQFP A+L   APL PK N     A+GPG+E  GN++   A F V+T NAG G + + V +P+G KE   +    +K+ ++   Y P + G +++ + FA   I  SPF V V    GD  KVTA GPG+EP GN  G+ T+F++ T    A AG G V   +LD +GR+D+V+  + ++ +      Y     G H V+V +AG  +  SPF V +    +    +   A+GRG+Q  GVRV D A F+V T+ AG +D G+         E  + ++V   ++E  Y P   GP+V+ I +G   I  SPF V V A     K++A+GPGL  G+  + A F VE  G + G LGFSI+GPS+A+I C D GDGS +V Y PT PG+YAVH+LCD+E++  SP+MA I   ++   P +V
Sbjct:    1 DSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEEDDEAKKQTPKQRLLGWIQHKLPDLPISNFSQDWKDGRALGALVDSCAPGLCPDWEIWDVHQPIDNAREAMQQAEDWLGVAQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACR---ASGRGLQSRGVRVGDAAGFRVLTKQAG-SDFGMC---KASGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV 552          

HSP 3 Score: 419.083 bits (1076), Expect = 4.613e-118
Identity = 497/1956 (25.41%), Postives = 796/1956 (40.70%), Query Frame = 2
Query: 1844 AFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPS----EAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAE---CFDVTGQ--TIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGISVL--DEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPY--KVIATDR----VNTKEYPETETPL--LISADYAIDNKAYNKPSIPVQSAKL---TPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQ---RTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIE---GPM-----EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVD----NNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPG--LEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKP---GSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGES---------DLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFP-VGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPIT-GSPFKFYVDSTIPSGQVTAYGPGLSY------------GRPDMHAHFTIVTKDAGAGGLSLAVEGP--SKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF-----------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGM-VNETCQFVVDTRNAGYGGLSLSIEGPSKVEIE---CHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIP-GYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHV-TGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGS-ISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX--------XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMIS--GSTQKGPSKPYNVKCEGDGLKVAEIGK 7405
            AFGPG+   G  V + A F VET N   G +   ++ P     EA++   ++   S    Y P V G + V +L   ++I +SP+   + +     D  KVTA GPG+  SG    K   F + T   G+ + V        D  G+   + + +    D    C Y P +PG H V V Y    +P SPF VN+ EA N    +  G G++     +     F V  K AGS D G+     +E MR   V     G+G    +Y P   GP     I +    IP+SPF+V + ++   +K +       T +   +   ++             ++ P+ +R+    +   +  V  + PT  G + V V C    +  SP+   ++   R       +  P  + PL  L  A   +  K   +P  P  +  +   +  +R+ ++                 +  PV     T+    L +      GE   K  +   ++  I     PP  + V I+   G M     +   D I N + T +V Y P   G + + V ++++ ++DSPF + + P         D +KV   GPG+N TGV     + FTV  +     GK  +     +P    +   +D    +NHD +Y+  Y+P   G   + +TY G  V  SP+ V V    D  +IR  G G  LE G  ++ +  T    G GQ  L   +  P   ++ C        +           G + + + ++   +PGSPF +      + SKV+ +G GL   G  V  P++F VD + AG   L + V       ++          G   V+Y+P   G   + +L+ +  VPGSPF   V  S E   V V G GV      L      S    ++    E          D+      P++  V + + +    TFTC +K+      T  +    +  P    +   H   KP       P L +      V     ++  GD +  A  + P G     S+ +   G   V YVP   G + V++ +    +P    R       +     R   H    +     R     +D +    G +  +V          ++ P      +G  TV+Y     G +   + Y G  IT GSPF   V   +   +V   GPGL              G P M   F++    AG   L +  +GP  ++  ++ +   +G   ++Y P   G Y + +++  + +  SPF             ++ G     S +     +D  +   E     L+  ++ P G      +    +G   +S+ P   G + V V      +P SPF +       G+AS+  L   G    + + E    +V+ + AG G ++  +  P ++E++     +  DGT  + +  T+PG Y+I V++    +P SPF V      S  ++   LR                +L++P    + + T  V  PSG      II   D   S+ F P E G+H + +K +  H+ + SP QF V  +   GP  V   G G+  G+      FTI T++AG G LS+A+EGPSKAEI  QDNKDG+C V+Y    PGDY  ++KF  +H+PGSP+M +I E+                         +L+    + GS  +  +     TD + ++A + +PS ++ +  + ++D+ Q  + F P E G H V V      +P SPFRV            V  SG G+    T    EF VDT  AG G++ V+++GPS+V+L+C++ E G     Y P  PG Y ++IK+     I GSPF V +SG   Q     +E  SL Q    ++  GST   P       C    LK    GK
Sbjct:  162 AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPF--PVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGS-DFGMCKASGEEPMRHREV-----GEGVHEFEYKPLALGPHVIT-ITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVR-YVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVRHRPSAKPPLPGLPRAPQPLKTKTKKQP-WPFAAVTMRGNSVSDRAVIRFMYLCTDLHIRPSVALRLFVPVPMSVSTSLLVSLTRRRSRHTGES--KCFSTKVSANAISPVVVPPGDVSVGIKCAAGAMVPVDSDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPS-------HDASKVRVEGPGINATGVEAAKPAHFTVYTR---GAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVRVVTRGAGGRGQ--LEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGL--RGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLE----CHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLEPTQREEVKHIDVPTPKEKPDSTIVTILLTSR--MTFTCLFKYIKAVRLTPVLPTKLRARPS--LLSSFHQSFKPTP--PSHPALRDAVSEFAVDARTISRCGGDHVRCAV-MAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAV---ADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDP------EGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQM---FSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHA--FATGDASKCFLADGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLAM---SEDISTESLR--------------PFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPSRSPLQFYVDEM--DGP-SVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIRED-------------------------SLRASLLSRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKF-AEEQIPGSPFTVLVSGPGRQ-----KEEVSLCQAAAPVAVVGSTCSLPLAIPVTDCTHRTLKRVASGK 2014          

HSP 4 Score: 351.673 bits (901), Expect = 2.327e-97
Identity = 433/1756 (24.66%), Postives = 703/1756 (40.03%), Query Frame = 2
Query: 1130 YIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTK--GRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAG-FADLGVNVYGPGRSLEKCQ-IKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVD-VAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIP----------VQIRDNNDGTYSC--------RYTPKIPGKH----TVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKL---AGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIG-QLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPI-GNSPYKVIATDRVNTKEYPETETPLLISAD----YAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEI------------IYPVQRTNEKAELRKPN-------VTAYGEGLVK----GV------ANTPASFIIDSTEEPPAPLGVTIEGP--MEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGL-----NPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFN-QRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQ---PQKFTVDLEGAGQGGLGLSIEGPA--DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPG-SPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSE--AKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQP---QEQYSIERTTHHYTTEQSKPIIRTEYSVVDF------KFPVGPVFDYVRAVV---NCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISE-----TDIN----NLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGE-NEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYAD-SNVPGSPFAVNIGG 6082
            Y P   G + I++ F+  E+ +SPF ++V  +  D SKV   GPGI   G E  +   F V+T  AG   +D    D +       +  +I    +  + ++YT  ++G   + V + G  +  SPF V V+      D  +    G G + E   +    E +V T  AG    L   +  P R    C             +      GP+ +D+ Y  +P+  SPF ++ V P   SK++ +G GL GG V  PA F V+T     G LG +++GP EA+++C D+GDG+ +V+Y P   GEYAV+IL  D ++P SP+ A ++   +      V  +GPG+  G +   P      + +         +  +V    +P          V I   +  T++C        R TP +P K     +++ S+     P  P                  P +  A +     F VD +     G   +  +V+            DN DGT+       ++   + +++ ++ A +P+SPF+V +    D  + +++       +  + N F I T   G      + V+ P  + V  + ++   GF   +     G +   +   G  I   SP+ V   D VN  +   +   L +SA      A+   A    S+    A    ++     T   P+  R   E  + +            + P     + A    P+       + AY  G V+    GV      A+ P  F ID+ E   APL +TI  P     +   +D GDG  SV+YLP   G Y V V Y  + +  SPF V  +    +S        +   GPG       PT V         VNAK     G+G V   +  P   +     V+N  DGT+S  ++    G + I + + G  +  SP+ V                 + E I+ +   P    V      +G +   +  P+   A  +  DN+DGT SV + P + G +++ IK+N  HIP  SP    + D +D   V  YGPGL      V   + FT+D   AGE  L + V +  +K+    Q    +  G   V+Y+P   G+  I V +    +PGSP++  +        ++  G        H ++ ++P        D   + L   +  P+       +    DG     +     G + V V  G ++VP SPF V V +       +    G  L E    +     V+T+ AG G +     GP  + V    E+   G   V Y P + G Y + + F +E IP          P   +E+ S+ +         S   +     V D       +   G  F    A V   NC + R+  PR+  +G  +++        G           P  G  F   V+     G     G            H +I  +  G        EGP      C  + N  C V  +   P DY + ++F D+HI GSPF   + G  ++  ++ V    +   +++        +N     + A V +P+G  E+C +  +    +   F P+E G H V+V   G  +P SPF++ VGE     +A+ V  +G GL  G      +FVVDT  AG G L+++I+GPSKV ++C +  +G     Y PT PG Y++++ Y    ++ GSP+   + G
Sbjct:  701 YTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSH-DASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPL---DLGKIRVEGLGTKLE---MGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSG---VQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLEPTQREEVKHIDVPTPKEKPDSTIVTILLTSRMTFTCLFKYIKAVRLTPVLPTKLRARPSLLSSFHQSFKPTPPSH----------------PALRDAVSE----FAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTY-AVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGL-GLHVEGPGEAHVAFE-EDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALD----VTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCF-----LADGGPGPAIQIGEPTLVL--------VNAKE---AGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLA---------------MSEDISTESLRPFHLVVPFS-LRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPSRSPLQFYV-DEMDGPSVTAYGPGLSHG--MVGKHAAFTIDTKDAGEGGLSLAV-EGPSKAEISCQ---DNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIREDSLRASLLSRGS------THDVSLRIPD-------DTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGP--SRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVSGPGRQKEEVSLCQAAAPVAVVGSTCSLPLAIPVTDCTHRTLKRVASGKDFSLEGAHVRDDNCTAQRQLPPRVTRSGHYSVSRWLWRVGRGAAGGSDARLASPKIGETFSHRVNEGATGGVNRMNG---------RMGHGSIFLRGGGG---GGHTEGPFFNTGTCDAHFNSGCAVENVTPPPRDYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSGLLESGWKVNHPASFAVHLNGAKGRIEAKVHTPSGSVENCFVSEIDK--VAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFC-YLPTAPGLYLVSICYGGPHHIAGSPYRARVTG 2350          

HSP 5 Score: 342.428 bits (877), Expect = 1.471e-94
Identity = 313/1149 (27.24%), Postives = 507/1149 (44.13%), Query Frame = 2
Query:  929 TNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVK----PKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRD-VAEFQVHTED---AGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE-SKIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPK-SPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAEC-------FDVTGQ-----TIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNE--FEILTPFDGSKVRPEIIVKSPNGSRVPVKLQE--TNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIA-TDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRS-NFEPNEEIIY---------------PVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVK 4231
             N  +VR +G GL   G  +G PA F VDT  AG G L + V  P   +  C      + +   S SY+P   GEY + I FA++ +P SPF   VK     PS  T+   G++  G  V + T F      +     D   L    +++ VK    P   ++ ++  +    T       +  +   V++       + +  +  S   Q++   +   P    +RD V+EF V        G   +   V  P     +  +       Y   Y+P   GP+ V++ Y    +  SPF V VA   + S+++  GPGL GG+  +   F ++T     G LG  ++GP EA +   ++ +G   V Y    PGEY  HI      I   SP+   ++ +    +P KV   GPGL  G+S       +V    AG+P     +C        DVT Q       PV++    DG ++  YTP + G +++ V Y   ++P SPF V+V+ A +A  ++V G G+  +    ++ T F +D + AG   + I+++D           D GDG F++ Y P   G      + +   E+P SPF V   +  D  K  + +     P  Q+ E    ++   +  + +    V +P    + V + E   +  F   FT T  GP+ + V   G  I NSP+ V+A ++ ++T    E+  P  +   +++  K +    + + S +     +++ +   N +   S +F P E+ ++               P+Q   +  E+  P+VTAYG GL  G+    A+F ID+ +     L + +EGP +A+I   DN DGTCSV+YLP  PG Y + V +  +HI  SP+   I  D+  +S +                       S   V+ +  D     ++ A I  P  ++  C +    DG    S+SP   G+H + +   G  V  SP+ V V   +  D  R+RA G GLEE  T +  +F VD   AG G + +S+EGP+  ++ C D +DG C V Y P +PG+Y ++IKF E+ IPGSPFTV +            GPG ++    +   +            PL + V D   +++K
Sbjct:  930 ANPSKVRVWGEGLR--GGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECH----DHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVK-----PSVETS---GVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLEPTQREEVKHIDVPTPKEKPDSTIVTILLTSRMTFTCLFKYIKAVRLTPVLPTKLRARPSLLSSFHQSF---KPTPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEV---NPAKVRCSGPGL--GLSAG---GGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVA-VGYGTDEVPGSPFPVHAFATGDASKCFLAD-GGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLAMSEDIST----ESLRPFHLVVPFSL-RKGHITGEVHMPSGR-----KASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPSRSPLQFYVD--EMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIREDSLRASLL--------------------SRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVS-----------GPGRQKEEVSLCQAAAPVAVVGSTCSLPLAIPVTDCTHRTLK 2008          

HSP 6 Score: 241.891 bits (616), Expect = 5.705e-64
Identity = 315/1352 (23.30%), Postives = 549/1352 (40.61%), Query Frame = 2
Query: 1394 ITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCL-----------YECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP---YKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVP---GEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPS---TVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVT-DDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKV---PIESDNDFKKYKINNLNNTTPIGQLNEFEI----LTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNG-FVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEY----PETETPLLISAD-YAIDNKAYNKPSIPVQ----SAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIY-------------PVQRTNEKAELR--KPNV-TAYGEGLVKGV-ANTPASFIIDSTEEPPAPLGVTIEGPMEAK--IDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAY----GPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQ---CFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDAS-KAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYV 5254
            I K   +   ++YT    G  ++ VFF+  +++ SPFG+ V     + DA +    G GI   GV     A F V+T  AG A+L V         E  ++    P L           Y   Y P + G   + + YG + +  SPF V VAP     + +++  G  L  G   +         G  G L   +  P+  K+ C       A            G + + +  D   +P SP++ +  L     +P KV  +G GL  G     PA+F V+T  AG      TV+  C         ++  D+ DGT S  Y P   G++ V + + + ++P SPF   V  +   + ++V+GPG+E+  T +       C L+ S  +      E+++ + V T  +  D T            T   +   +    P  P K+   P    +  + +K    ++      ++EF +    ++   G  VR    V +P+G      + + ++G +   + P+  GPH V V   G  +  SP++V   D  +        P  E  L   A+ ++ID +A     + +            E      F+      S  E    I Y             PV+     A++R   P +  + G G+V  V A  P  F +D +    A L VT +GP   +  ++ +   DG  ++ Y P   G Y ++V Y  + +  SPF V +           D  +V   G G++ +GV     + FT++ +     G   +   I +P        V +  DG +S SY P V G++ + + Y    V  SP+ V  +   D S+        GP ++ G   +P    V+ + AG+G +   +  P   ++      +  DGT S+ +   +PG Y ++++F  + IP SPF V +    D+S             +    P    V  S + G    +V++   + +   P  I   +  G   V++ P   G  E+++ YN   +P    +Q  ++  +   V   G G+     H +  K  + FTI+T+DAGE  L L V GP+   ++   DN  DGT +  Y    PG+Y++ V +  +++PGSP++  +  ++        G   +      ++ IP +T  A   +L+A    P G    C ++    G   +S+ P+++G + V +     ++P+   R      +   +          E+++     E+ +VD ++     F  +   +  PS R ++    +  DG   V Y P E G + L + +  + I GSPF   V
Sbjct:  689 IIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDV---VPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQ-------FEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMG-CEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPA---NPSKVRVWGEGLRGG-EVGIPAEFCVDTTAAGVGGLGLTVEGPC------EARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLEPTQREEVKHIDVPTPKEKPDSTIVTILLTSRMTFTCLFKYIKAVRLTPVLPTKLRARPSLLSSFHQSFKPTPPSHPALRDAVSEFAVDARTISRCGGDHVR--CAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVL-------AAYDAGRVRVSGAGVSASGVPASLPTDFTIDTRE---AGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLADGGPGPAIQIG---EPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHV-LAMSEDIS-------------TESLRPFHLVVPFSLRKGHITGEVHM--PSGRKASPRII--DNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPSRSPLQFYVDEMDGPSVTAYGPGL----SHGMVGK-HAAFTIDTKDAGEGGLSLAVEGPSKAEISCQ-DNK-DGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIREDSLRASLLSRGSTHD-----VSLRIPDDTDPA---LLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEF-IVDTRY---AGFGSMCVSMEGPS-RVEL-HCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLV 1965          

HSP 7 Score: 201.445 bits (511), Expect = 1.266e-51
Identity = 215/859 (25.03%), Postives = 362/859 (42.14%), Query Frame = 2
Query: 5357 GAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFG--EPKKRSQICVGTTSDVPLRISETDINNLNA------IVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHI-PNSPFKIFVGENEIGNASRVKLYGDGLN----DGMVNET-----CQFVVDTRNAGYGGLSLSIEGP--SKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNI-GGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASV--ISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPF---QFTVGP-----LIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDF---QDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPF-MLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPG-SPFR-----XXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQS---------NDSIR-----ETKSLTQTVHMISG-----------------------------STQKG----PSKPYNV-------------KCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            G   +  AV  PS    E    DN +GT  V Y+P + G + + + +    +  SPF   +    +P +      G    +  R +   I+   A      + +   G E     +    G   + +     GE+L ++   G  I   SPF + V  +E+ N ++V+  G GL      G+V          F VD   AG   L ++ +GP  ++  +E     DG   +TY P+  G Y ++V+YA  +VP SPF V++   Y +     R+         S +      +  I      +   S+  + P G      ++   D  FS+ ++P   G ++V+V      V GSPF    F  G      L DGGP      G  ++ G   +     +  +EAG G ++  +  P + E+D    ++  DG+  + +   +PG YV +++F  + +P SPF +L + E+  +   +P                              + V+ +  L  G I+  V  PS ++    I    +   SV F P+E G+H + +  N   IP  SP +     +    VT  G G+ HG  G+   F +DT +AG G L++ ++GPSK +++CQ+N+ G  + +Y+P APGDY+I++K+ G  HI GSP+   I  ++ ++         + S+R     +   LT  +   SG                             S ++G    PS P+ V             +  G GL+ A   +  EFIVD   AG   + V + GP R   E++ + L + R +V Y   E G + L +++    +PGSPF ++V
Sbjct: 1156 GGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPG-EAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPV-RDEV-NPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAG----RVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLADGGP------GPAIQIG---EPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLAMSEDISTESLRPF-----------------------------HLVVPF-SLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPSRSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQ-HIPGSPYMARIREDSLRASLLSRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSR--VELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLV 1965          

HSP 8 Score: 151.369 bits (381), Expect = 1.889e-36
Identity = 222/894 (24.83%), Postives = 340/894 (38.03%), Query Frame = 2
Query: 5084 VRAVVNCPSNRKDVPRLI--NNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTI-PSGQVTAYGPGL--SYGRPDMHAHFTIVTKDAGAGGLS-------LAVEGPSKA-EIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI-----------FGEPKKRSQICVGTTS--DVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALS-DNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEG----PSKAEIDFQDNKDGSCGVTYRVNEP--GDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISK--IDNNQYS--VHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG-----HTGRINEFFVDTSNAG-NGALTVTIDGPSKVQLNCQENESGYNFTYVPNAP----GDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCE-EVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            V   V  P   K+  R+   N+   +    Y+P  +G H++ V + GQ I  SPF   V      +G+VTA GPG+  S        +F I T   GAG          L   G   A E+     ++     +Y PL PG + + + +    +  SPF+  I            G   +   + VG  +   V  + + +D     A        EE    + +  G     + P  +G H++ +   G+HIP SPF++ V         +V+ +G GL  GM   +  FVV+      G L  SIEGPS+  I C D  DG+C V Y PTEPG Y ++V   + +V  SPF  +I         ER+ RH+ +A+    G        +P   Q   T +   P   F    +   S  ++  IRFM     +H +      R     P   +   L+     +    G          AN  +      G  S+ I        P  +++ F   K+ +  +T +   P  G +   + F+++ V  SPF   ID  P    SK V+ E    N +           G      A+F +   G     +      P     +  +    IDN+ YS  V + P + G   + V      +PGSPF V V      G+    G       G   E  V T  AG  G L   +  P++ ++ C              A     G + + + Y G+  + GSPF                    L + V          P+ P  V+  G+GL+  E+G   EF VD   AG   L + V G   PCE  +     G+    V+Y   + G + + + + +  VPGSPF  VV
Sbjct:  192 VLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGMCKA------SGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAE--AGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV-RHRPSAKPPLPG--------LPRAPQPLKTKTKKQPW-PFAAVTMRGNSVSDRAVIRFMYLCTDLH-IRPSVALRLFVPVPMSVSTSLLVSLTRRRSRHTGESKCFSTKVSANAISPVVVPPGDVSVGIKCAAGAMVPVDSDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPF--GIDVVPSHDASK-VRVEGPGINAT-----------GVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHP-VPGSPF--------------------LMEAVL---------PANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEG---PCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVV 1019          

HSP 9 Score: 135.961 bits (341), Expect = 1.002e-31
Identity = 123/418 (29.43%), Postives = 180/418 (43.06%), Query Frame = 2
Query: 1190 PNSPF--KVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGV----NVYGPG--RSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVA-PYKESKIKAFGPGLT--GGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIR----DNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA 2398
            P +P   K+N KNA        A GPG+E VGN V R   F V T  AG G V   + D +G K+  +       +  F+  Y  +  G H V V FAG  I  SPF V+V+    + DA +  A G G++P G        F + T   G           V  P   R   +  +++    +  C+Y P  PGP++V + Y    +  SPF+V++         +A G GL   G  V   A F V T       G   K   E  +   + G+G     Y P   G + + I    ++IP+SP+   +  +     P KV A+GPGL +G++  + ADF+V        + V    F + G   P Q R    D  DG+   RY P  PG + V V     ++  SPF  +++ A
Sbjct:  147 PGAPLRPKLNPKNA-------HAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPP--HGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGM-CKASGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEA---GPQKVRAWGPGLETGMA-GRSADFVVEAIG----TDVGTLGFSIEG---PSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPA 543          

HSP 10 Score: 116.701 bits (291), Expect = 5.524e-26
Identity = 107/374 (28.61%), Postives = 164/374 (43.85%), Query Frame = 2
Query: 1544 KQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQI-----KKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP--YKESKIKAFGPGL--TGGIVSKPAFFEVET-------------------NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLIS-GISTNKPADFIVNTKNAGSP-STVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGT 2575
            K A+A G G++  G  V   AEF V TE+AG  ++ V V  P    E+ ++     K+ S   +   Y P+  GP+ V + +    I  SPF V VAP      K+ A GPG+  +G +  K  +F++ T                    G   A+  +++   +A + C          TY P VPG + V +      +P SP+   I    +  +P    A G GL S G+     A F V TK AGS     KA     +G+  P++ R+  +G +   Y P   G H + +++G  +IP SPF+V V        ++ +GPG+E         FVV+      G +G S+  E      +  DD GDG+
Sbjct:  158 KNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRS---FVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRC----------TYRPLVPGPHIVSVGYAGAAVPHSPFSVNIG---EACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGMCKA-----SGEE-PMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSI--EGPSQARIACDDRGDGS 507          

HSP 11 Score: 116.316 bits (290), Expect = 8.696e-26
Identity = 111/416 (26.68%), Postives = 180/416 (43.27%), Query Frame = 2
Query: 3191 KAELRKPNVTAYGEGLVKGVANT---PASFIIDSTEEPPAPLGVTIEGPM----EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTV-NAKPIDFNGKGIVKAIITNPFNQRSTC--TVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITK--QPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVL---NSCEPEKV 4393
            + +L   N  A+G G V+ V N+    A F++++       + V +E P     EA++   ++   +    Y P+  G + V VL+  +HI  SPF V + P         D  KVTA GPG+ P+G      + F +  A      G G V   + +P  +R     T++   D    C+Y P V G H + + Y G  V  SP+ V + +  +P   RA G GL+    +      F V  + AG    G+  +   +  ++  +  +G    +Y P   G + ++I +  KHIP SPF V +       KV+ +GPGLE         + F V+A       L  ++   +   +           G  DV Y+P   G+  + VL +   V  SPF+ ++L     C PE+V
Sbjct:  152 RPKLNPKNAHAFGPG-VEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH------GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGS-DFGM-CKASGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETG--MAGRSADFVVEAIGTDVGTLGFSIEGPSQARIA----CDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV 552          

HSP 12 Score: 113.62 bits (283), Expect = 4.787e-25
Identity = 117/450 (26.00%), Postives = 191/450 (42.44%), Query Frame = 2
Query: 3710 PAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEE--GITKQPQKFTVDLEGAGQGGLGLSIEGPA----DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTV---PIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTV----DASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKP 5020
            P VD +H +       P AK     P+    +P    A+GPG+E      ++  +F V+ E AG G + + +E P     +A++   ++K  +    Y P+  G + V++ F  +HI  SPF V   P H   D  KV   GPG+E +G+     + F +    D + AG   + V V+D   +       L +    +   TY P   G   + V Y    VP SPF  N+  +C P     +G G++  RG  + +   + F + T+ AG SD  +          + +V   G+G    +YK    G + + + +G K++P SPF V V +EA P++    GP L     G++    V       G L     GP    + C    +  G   V YVP + G Y V ++ ++E++       +          ER  H  + +   P
Sbjct:  126 PNVD-EHSVMTYLSQFPKAKLKPGAPLRPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHG--DAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQ-SRGVRVGDA--AGFRVLTKQAG-SDFGMCKASGEEPMRHREV---GEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGD--GSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVRHRPSAKPPLP 563          

HSP 13 Score: 96.6709 bits (239), Expect = 7.704e-20
Identity = 187/840 (22.26%), Postives = 314/840 (37.38%), Query Frame = 2
Query: 5285 AYGPGLSY--GRPDMHAHFTIVTKDAGAGGLSLAVEGPS----KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF---TAKIFGEPKKRSQICVGT--TSDVPLRISETDI-----------NNLNAIVISPTGREESC--TLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAG--YGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGD-------YVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSIS------AYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG--------HTGRINEFFVDTSNAGNGALTVTIDGP---SKVQLNCQE----NESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEF-IVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPF--EIVVP 7624
            A+GPG+       +  A F + T++AG G + + VE P     +A +   ++K  +    Y P   G + + + F  +HI  SPF    A   G+  K +    G   + +V  + +  DI            ++   V+ P GR ++   TL++ ++  L  ++ P   G H+V+V  +G  +P+SPF + +GE     A R    G       V +   F V T+ AG  +G    S E P    +   +  +G     YKP   G ++I + +   ++P SPF V +    + +  +++       E    G   +  +   G +      S+  PS +   C+     D    +R++P E G + V V  D   V  SPF               HI+ +      + D     +  R +    L      P   +   +        VT R N   D       Y+C+    D H+  S  +      P S       + +++ + +R  S    + + F+    AN  I+   +  G +S      A  + P + +    I K DN+  +V + P   G   + V  +   +  SPF + V     + +    G           +   F V T  AG   L V  + P   + V +   E    ++  Y   Y P   G   + + YGG+ H+ GSPF V ++                              P     ++ EG G K+ E+G   E  +V  G  G   L   +  P R   PC    +             + E G H + V +  H VPGSPF  E V+P
Sbjct:  162 AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGMCKASGEEP----MRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVS---AEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACD--DRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFM-------------AHILPA------SRDCFPERVRHRPSAKPPLPGLPRAPQPLKTKTKKQPWPFAAVTMRGNSVSDRAVIRFMYLCT----DLHIRPSVALRLFVPVPMSV------STSLLVSLTRRRSRHTGESKCFSTKVSAN-AISPVVVPPGDVSVGIKCAAGAMVPVDSDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGD-HVPGSPFPVTVAP-----------------------------PLDLGKIRVEGLGTKL-EMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAE--AAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLP 929          

HSP 14 Score: 95.1301 bits (235), Expect = 2.315e-19
Identity = 95/327 (29.05%), Postives = 140/327 (42.81%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPK-GQKEP---CEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEA-GPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDV---AEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE-SKIKAFGPGLTGGIVSKP 1885
            ++ +VR  GPG+   G     PA FTV T  AGK  LD+   +P+ G   P    EI D  N + +Y+  Y P  +G   + + +    +P SPF V V     D  K+   G G +    E+G      V T  A G G ++  +L    +K                      E G H ++V + G  +  SPF +M +   +N    + +        EG+R  +V   AEF V T  AG   LG+ V GP  +  +C       C    SY+P + G Y V+I + +  +  SPF   V P  E S ++ FGPG+  G    P
Sbjct:  734 DASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIID--NHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPL-DLGKIRVEGLGTK---LEMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCS-SEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPF-LMEAVLPANPSKVRVWG-------EGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTC--SVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTTFLP 1043          

HSP 15 Score: 75.0998 bits (183), Expect = 2.786e-13
Identity = 71/247 (28.74%), Postives = 102/247 (41.30%), Query Frame = 2
Query: 1151 EYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIE-------YTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGLTGG 1870
            +Y + ++F +  IP SPF + V     +  +V  SG  +   G +V     F V    A            KGR ++     +   EN F+ E       +  +E G+H V+V   G  +  SPF V V      +DA    A G G+  E       AEF V T  AG   L V + GP +    C      P  Y   Y+P  PG Y+V I YG       P ++  +PY+    +  GP L+GG
Sbjct: 2138 DYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSG--LLESGWKVNHPASFAVHLNGA------------KGRIEAKVHTPSGSVENCFVSEIDKVAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGL--ERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCS---EGPEGYHFCYLPTAPGLYLVSICYGG------PHHIAGSPYRA---RVTGPRLSGG 2356          

HSP 16 Score: 66.6254 bits (161), Expect = 9.071e-11
Identity = 54/210 (25.71%), Postives = 97/210 (46.19%), Query Frame = 2
Query: 3125 NKQRSNFEPNEEIIYPVQRTNEKA---------ELRKPN-------VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYND-EHIKDSPFNVTIY-PDTKSSSNIDDVAK--VTAYGPGLNPTGVFKDSFS-KFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGT 3691
            +K  + F P E  ++PV  T + A          + +P        V+A+G GL +G   +PA F++D++   P  L V I+GP + ++D  +  +G     YLP  PG Y+V++ Y    HI  SP+   +  P      N+ + +   V A  P     G+  +    K T ++  ++ +G G+  A++     +++  TVD    G+
Sbjct: 2218 DKVAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGY-HFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALV----GKQNAFTVDCGRAGS 2422          

HSP 17 Score: 66.2402 bits (160), Expect = 1.269e-10
Identity = 89/346 (25.72%), Postives = 149/346 (43.06%), Query Frame = 2
Query: 2057 NIPKSPYMAQIQLDTKLFDPLKVTAYGPGLIS-GISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDG--TYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA-GNAANIKVYGPGIERAK--TNIETYFVV----DCKLAGSGDIGISVLDEK-MRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNL---NNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVA-GFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEY----PETETPLL-ISADYAID 3034
              PK+       L  KL +P    A+GPG+ + G S  + A+F+V T+NAG    V     D  G     ++   ND   ++   Y P++ G H V V +   +I  SPF V V    G+A  +   GPG+E +       TYF +    D   AG GD+ ++VLD +  RD   +T +                  + + + ++ A +P SPF V I    +    + +     +    +G    F +LT   GS    +  +   +G   P++ +E   G     + P  +GPH +T+   G  I  SP++V+ +     ++     P  ET +   SAD+ ++
Sbjct:  139 QFPKAKLKPGAPLRPKL-NPKNAHAFGPGVEAVGNSVERAAEFVVETENAGL-GEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGS----DFGMCKASGEE-PMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVE 477          

HSP 18 Score: 61.6178 bits (148), Expect = 3.033e-9
Identity = 105/444 (23.65%), Postives = 168/444 (37.84%), Query Frame = 2
Query: 4523 NESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEV--PVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSI--ENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPII--RTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLI--NNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGL-SYG-RPDMHAHFTIVTKDAGA--GGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGE--PKKRSQI-------CVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFV 5791
             E V+ +VD H   T+  Q+                K  PG+P       +  P+  +  GP +  V   V +     V T+NAG G +      P G+     +   N++       Y P+  G ++V ++F  ++I + S       P    + + T      E S  +    T + +       G     V   V  P  R+D   +      D  +   Y+P   G H + V Y G  +  SPF   +      G   A G GL S G R    A F ++TK AG+  G    + E P +      +   G  +  Y PLA G + I I +  KHI  SPF   +  E  P+K             G ++D  +    TD+  L   +  P+    +C  +   +G   + + P E G++ V+VL     +  SPF   +
Sbjct:  121 EEIVDPNVDEHSVMTYLSQFPK-------------AKLKPGAPL----RPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHI-DRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGMCKASGEEPMRHR----EVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDR--GDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHI 540          

HSP 19 Score: 57.7658 bits (138), Expect = 4.234e-8
Identity = 100/430 (23.26%), Postives = 156/430 (36.28%), Query Frame = 2
Query: 6392 PHKVHIMGSGVERGLAND---ANQFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQI-----DENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLA--SISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGH--------TGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVS--GPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPF 7609
            P   H  G GVE  + N    A +F + T  AG G + + +E P     +A +  +++K  S    YR    G +  ++ F  +H+  SPF + +     D    ++    V+    +   + Y  I    D                          V+ P  +      ++ +  +      + P+  G H V V    + +P SPF V +GE    G     G          G    F V T  AG+        G   ++   +  E  + F Y P A G + I+I +GG  HI  SPF V +S                           + GP K   V+  G GL+    G+  +F+V+A   G DV  +G S  GP +    +     G+    V Y   E G + + V     DV  SPF
Sbjct:  157 PKNAHAFGPGVE-AVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVT--------------VLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGMCKASGEEPMRHR-EVGEGVHEFEYKPLALGPHVITITWGGK-HIPRSPFEVLVS--------------------------AEAGPQK---VRAWGPGLETGMAGRSADFVVEA--IGTDVGTLGFSIEGPSQ--ARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPF 536          

HSP 20 Score: 56.6102 bits (135), Expect = 1.040e-7
Identity = 57/191 (29.84%), Postives = 86/191 (45.03%), Query Frame = 2
Query:  962 GLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA--AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILD--TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGV-QIQSSPFGVMVS 1519
            GL   G  + +PA F V   N  KG ++  V  P G  E C  F S   ++A    ++P   G + + +    + +P SPF+V V     A D + V+A GPG+E      G    F V T+ AGPGS+  V +D  +K R D        +    +   Y     GL+ V++ + G   I  SP+   V+
Sbjct: 2173 GLLESGWKVNHPASFAVH-LNGAKGRIEAKVHTPSGSVENC--FVSEIDKVA--ARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLE--RGTTGSPAEFVVDTSGAGPGSL-AVAIDGPSKVRVD------CSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVT 2349          

HSP 21 Score: 51.9878 bits (123), Expect = 2.747e-6
Identity = 55/212 (25.94%), Postives = 80/212 (37.74%), Query Frame = 2
Query:  929 TNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFAN-SEIPNSPFKVNVKN-----------------AAGDP--------------------SKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEG 1450
             ++  V A+GPGLE    T G+PA F VDT  AG G+L + +  P   +  C   + P     Y   Y+PT  G Y + I +     I  SP++  V                    AG+P                    SKV + GPG+      VG++  F V    AG   +   +L      + V   +      +F + Y  KE G
Sbjct: 2259 ADAALVSAFGPGLER--GTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCS--EGPE---GYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTA--LVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEV--HVKHAGGRRFAVTYAVKERG 2459          
BLAST of Filamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004195.1 (pep scaffold:Pmarinus_7.0:GL476636:147693:235244:1 gene:ENSPMAG00000003806.1 transcript:ENSPMAT00000004195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 372/966 (38.51%), Postives = 533/966 (55.18%), Query Frame = 2
Query: 3482 KSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHI-PGSPFTVPIHDIVDVSKVKCYGPGLERNGS-------RVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIE-----------------GPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSI-ENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIR------------------QYAFQP---------QEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPI-TGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIF-GEPKKR-SQICVGTTSDVPLRI-SETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTA 6208
            K  +    + K ++  P  +P    +D+ S+F V+A+ I   G   V+  +  P    +  +V +NHDGTY+  Y P+  G H +++TY G  V +SP+ V V  G DPSR+R +GPGLE G+T +   F++D   AG GGLGL +EGP +A +   ++ +G  +V+Y    PG Y   I +    I  GSPF VP+ D V+ +KV+C GPGL  +         R   P  F+VD S+AG+A L V        + +P +++ ++  G+  +TY P  +G   + V Y    VP SPF  +VL + +  +V V+G GV       +   +P+ FTI+TR+AG++ L + +  P+       V + GDG F+  Y  DV G Y+V V YG   VPGSPF V   +     +C++                  GP +    +G+   + VN + AG G ++ + + P    +   + EN   G  ++ +   + G Y + + F  + IPN                      Q    P         +E +     +   + + S   +R  + VV F    G    ++   V+ PS RK  PR+I+N DGT++V + P E GLHE+++ YNG  I TGSP +FYVD  +    VTAYGPGLS+G    HA FTI TKDAG GGLSLAVEGPSKAEI C DNK+GTC VSYLP APGDY I +KF  +HI GSP+ A+I  GE   R S +  G+T DV LRI  +TD   L A + +P+GR++ C LKRL +G +GISF+PKEVGEHLV+V   GRH+P+SPF++ VG +E+G+A RV+  G GL +    E  +F+VDTR AG+G + +S+EGPS+VE+ C D  DG C V Y P EPGTY + +K+A+  +PGSPF V + G       E +   Q AA V+ +G+ C L L IPG    N TA
Sbjct: 1118 KQKTTTTSITKASSQAPPSHPA--LRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTA-QGPHGTREPVEVV-QAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVS---ASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQ---IGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKG----HITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDE-MDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVSG--PGRQKEEVSLCQAAAPVAVVGSTCSLPLAIPGNELFNCTA 2066          

HSP 2 Score: 477.248 bits (1227), Expect = 5.004e-136
Identity = 410/1544 (26.55%), Postives = 679/1544 (43.98%), Query Frame = 2
Query: 3299 APLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPV-AKSPYFVPVYQGSDPSRIRAYGPGLEEGITK-----------QPQKFTVDLEGAGQGGLGLSIEGPADAQ--IQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGE-------GVRPHRGHLIANKV--PSLFTINTRDAGESDLELMVTGPNNESVNLDV-DNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIV-----PVHSEAKP---------------------------EQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIER----TTHHYTTEQSKPIIRT-EYSVVDFKFPV-GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNK--NGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI----FGEPKKRSQICVGT----TSDVPLRISETDINNLNAIVIS---PTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKEL-GVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPG-----DYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSV---HFVPVENGIHNVHVLVNNSPIPGSPFR---------XXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLT----QTVHMISGSTQ-----KGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            AP G+T EG +       DN DGT +V Y+P   G + V V Y    +  SPF V +       ++  D ++V  +GPGL   G      + F+++ +     G G+    +  P    +    + + +G ++  Y     G++   ITY G  + A SP+ VPV    +P+++R  GPGL  G++             PQ F+VD   AG   L ++ +GP   +  ++     DG  ++ Y P   G Y + +++  + +P SPF V +    D  +V+  G G+  +G     P+ FT+D  +AG+APL + ++D      + A++L     GLF V+Y+P+  G   + V Y   +VPGSPF  +   + +  K  +          GV    G   A ++  P+L  +N ++AG   +   V  P    +++DV +N  DGTF+  +    PG Y + V +G + +P SPF V     P+    +P                           E   +   I  E      + +P + +    G ++ +   P G      I + R G  +VS+ P + G +E+ + +N  +IP GS  Q+     +  S+       +H    + +   I T +         V GP     +A ++C  N+          DGT +V Y P+  G + + V + GQ I GSP+     + I +G+ +     LS G    H     +  D     L+  +  PS  +  C+  +  +G   +S+ P   G++ + ++   +H+  SPF   +     G+ ++     +G     T +    I +T      ++ +S   P+  E  C  + L++G   + + P E G + + +  +   IP SPF + V          V L        +V  TC   +          +   + P +V    H +         +    G+   + + A   + G  F +  GG                     +   C+     P      T    I  +      +++ L   Q S  F+ + +   H+V+ K+ ++ V     + T   + +GG  KV + G    R       +F  +T + GA + S+ ++  +       D       V  RV++       DY  S++F DEH+PGSPF+L +D                +  +SR ++++ L + G+ +   A+F ++ +G   G I A V +PS   +   +S+ID +++S+    FVP ENG+H V V  + + +PGSPFR              V+  G G+  G TG   EF VDTS AG G+L V IDGPSKV+++C E   GY+F Y+P APG Y +SI YGG +HI GSP+   ++G       ++ ET S      +    ++G        K  S    V+  G GL  A +GK+N F VD G AG +VL VGV GP  PCEEV++KH G  RF V Y V+E+G +LL+V+WG+  VPGSPF + VP
Sbjct: 1168 APSGITTEGSV------TDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAV-------ADGCDPSRVRVHGPGLE--GGLTHRANVFSIDTRAAGCGGLGL---HVEGP--GEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGL--GLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRR-ARVL-DGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRK---GHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPS----KAEISCQDNK----------DGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYM----ARIIAGEDSLRASLLSRG--STHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHC--EDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLV-SGPGRQKEEVSLCQAAAPVAVVGSTCSLPLAIPGNELFNCTAQRQLPPRVTRSGHYSVSRWLWRVGRGAAGGS---DARLASPKI-GETFKIYNGG-------------TRGGCCGAVTKYCQREPAEPSMAHEGT----IPQAACIHASDLLKLKAGQGSYPFVTELMCSKHSVTYKASSQRVAVCKDRRTSRLVGNGGHRKVRLWGVSPSRATQPVCTRFYFWTHKKGARASSVDVDCVALNSFAVHDRLH----VDKRVSQTKNGINRDYEVSVRFEDEHIPGSPFLLTVDG---------------VCEESRRVAVSGLLESGWKVNHPASFAVHLNG-AKGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTVP 2620          

HSP 3 Score: 448.358 bits (1152), Expect = 5.110e-127
Identity = 251/563 (44.58%), Postives = 348/563 (61.81%), Query Frame = 2
Query:  455 DSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFT----AEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV-APYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKV 2125
            DS  I D  LKLILGL+WTLILHYSI+MP+WE    +++D + K  +PKQRLLGWI  K+P  P+ NF+ DW DG A+GALVD+CAPGLCP+W  WD  Q + NA+EA+  AE+ L VA +I P E+++P VDE ++MTYLSQFP A+L   APL PK N     A+GPG+E  GN++   A F V+T NAG G + + V +P+G KE   +    +K+ ++   Y P + G +++ + FA   I  SPF V V    GD  KVTA GPG+EP GN  G+ T+F++ T    A AG G V   +LD +GR+D+V+  + ++ +      Y     G H V+V +AG  +  SPF V +    +    +   A+GRG+Q  GVRV D A F+V T+ AG  +L V +  P R  E  + ++V   ++E  Y P   GP+V+ I +G   I  SPF V V A     K++A+GPGL  G+  + A F VE  G + G LGFSI+GPS+A+I C D GDGS +V Y PT PG+YAVH+LCD+E++  SP+MA I   ++   P +V
Sbjct:    1 DSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEEDDEAKKQTPKQRLLGWIQHKLPDLPISNFSQDWKDGRALGALVDSCAPGLCPDWEIWDVHQPIDNAREAMQQAEDWLGVAQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACR---ASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNP-RGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV 555          

HSP 4 Score: 426.017 bits (1094), Expect = 4.283e-120
Identity = 504/1977 (25.49%), Postives = 809/1977 (40.92%), Query Frame = 2
Query: 1844 AFGPGL--TGGIVSKPAFFEVET-NGETGALGFSIKGPS----EAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGL-ISGISTNKPADFIVNTKNAGSPSTVKAE---CFDVTGQ--TIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPY--KVIATDR----VNTKEYPETETPL--LISADYAIDNKAYNKP----------SIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIE---GPM-----EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVD----NNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPG--LEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKP---GSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLD-------VDNHGDGTFTCQYKHDVPGNYTVKV---LYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFP-VGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPIT-GSPFKFYVDSTIPSGQVTAYGPGLSY------------GRPDMHAHFTIVTKDAGAGGLSLAVEGP--SKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF-----------TAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLY---------GDGLNDG-----MVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIE---CHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSS--------------------SLTERILRHQDAAEVSQIGNVCE-----LNLIIP-GYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHV-TGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGS-ISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXX--------XXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMIS--GSTQKGP 7345
            AFGPG+   G  V + A F VET N   G +   ++ P     EA++   ++   S    Y P V G + V +L   ++I +SP+   + +     D  KVTA GPG+  SG    K   F + T   G+ + V        D  G+   + + +    D    C Y P +PG H V V Y    +P SPF VN+ EA N    +  G G++     +     F V  K AGSG++ + +L     + P+   + G+G    +Y P   GP     I +    IP+SPF+V + ++   +K +       T +   +   ++             ++ P+ +R+    +   +  V  + PT  G + V V C    +  SP+   ++   R       +  P  + PL  L  A   +  K   +P          ++P+   K   V RS ++  S  ++  SN          +       ++ +  +T       K  +   ++  I     PP  + V I+   G M     +   D I N + T +V Y P   G + + V ++++ ++DSPF + + P         D +KV   GPG+N TGV     + FTV  +     GK  +     +P    +   +D    +NHD +Y+  Y+P   G   + +TY G  V  SP+ V V    D  +IR  G G  LE G  ++ +  T    G GQ  L   +  P   ++ C        +           G + + + ++   +PGSPF +      + SKV+ +G GL   G  V  P++F VD + AG   L + V       ++          G   V+Y+P   G   + +L+ +  VPGSPF   V  S E   V V G GV      L     P L +  +     S LEL  + PN +  +L               TFTC +K+      T  +   L+  K    S  I    S+A P       P L +      V     ++  GD +  A  + P G     S+ +   G   V YVP   G + V++ +    +P    R       +     R   H    +     R     +D +    G +  +V          ++ P      +G  TV+Y     G +   + Y G  IT GSPF   V   +   +V   GPGL              G P M   F++    AG   L +  +GP  ++  ++ +   +G   ++Y P   G Y + +++  + +  SPF             ++ G     S +     +D  +   E     L+  ++ P G      +    +G   +S+ P   G + V V      +P SPF +       G+AS+  L          G   + G      + E    +V+ + AG G ++  +  P ++E++     +  DGT  + +  T+PG Y+I V++    +P SPF V +   P +                     L ER L    +  ++   ++        +L++P    + + T  V  PSG      II   D   S+ F P E G+H + +K +  H+ TGSP QF V  +   GP  V   G G+  G+      FTI T++AG G LS+A+EGPSKAEI  QDNKDG+C V+Y    PGDY  ++KF  +H+PGSP+M +I                I   DS   S+        + GS  +  +     TD + ++A + +PS ++ +  + ++D+ Q  + F P E G H V V      +P SPFRV            V  SG G+    T    EF VDT  AG G++ V+++GPS+V+L+C++ E G     Y P  PG Y ++IK+     I GSPF V +SG   Q     +E  SL Q    ++  GST   P
Sbjct:  162 AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPF--PVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNV-LLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVIT-ITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVR-YVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVRHRPSAKPPLPGLPRAPQPLKTKTKKQPWPFAALYLTWALPL---KFEVVSRSTMRGNSVSDRAGSNVIIVSSSRIIIIIIIFLIDVTQSPLTVCTR-ESKCFSTKVSANAISPVVVPPGDVSVGIKCAAGAMVPVDSDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPS-------HDASKVRVEGPGINATGVEAAKPAHFTVYTR---GAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVRVVTRGAGGRGQ--LEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGL--RGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLE----CHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTTFL----PPPLHSSCSLSDSHSLLELYRSDPNQQPEHLKWKLLFVYYSPSFKMTFTCLFKYIKAVRLTPVLPTKLHKQKTTTTS--ITKASSQAPPSH-----PALRDAVSEFAVDARTISRCGGDHVRCAV-MAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAV---ADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDP------EGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQM---FSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHA--FATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEM--DGP-SVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARI----------------IAGEDSLRASL-------LSRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKF-AEEQIPGSPFTVLVSGPGRQ-----KEEVSLCQAAAPVAVVGSTCSLP 2053          

HSP 5 Score: 327.02 bits (837), Expect = 7.175e-90
Identity = 313/1136 (27.55%), Postives = 486/1136 (42.78%), Query Frame = 2
Query:  929 TNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKD-SVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPF--GVMVSSKTSNSDAKQAYATGRGIQPEGVRVRD-VAEFQVHTED---AGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE-SKIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPK-SPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAEC-------FDVTGQ-----TIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERA--KTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKY------------KINNLNNTTPIGQLNE--FEILTPFDGSKVRPEIIVKSPNGSRVPVKLQE--TNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIA-----TDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAK------LTPV----------------------ERSNVKTFSNPNKQRS-NFEPNEEIIY---------------PVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPV--YQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTV 4063
             N  +VR +G GL   G  +G PA F VDT  AG G L + V  P   +  C      + +   S SY+P   GEY + I FA++ +P SPF   VK     PS  T+   G++  G  V + T F      +     D   L    R D + +P+  K    K L  Y +    +    +F     ++ +P     +   KT+ +   +A +      P    +RD V+EF V        G   +   V  P     +  +       Y   Y+P   GP+ V++ Y    +  SPF V VA   + S+++  GPGL GG+  +   F ++T     G LG  ++GP EA +   ++ +G   V Y    PGEY  HI      I   SP+   ++ +    +P KV   GPGL  G+S       +V    AG+P     +C        DVT Q       PV++    DG ++  YTP + G +++ V Y   ++P SPF V+V+ A +A  ++V G G+  +    ++ T F +D + AG   + I+++D           D GDG F++ Y P   G      + +   E+P SPF V   +  D  K              +       P  Q+ E    ++   +  + +    V +P    + V + E   +  F   FT T  GP+ + V   G  I NSP+ V+        R      P+T T          + + +  PS  +  ++      L P                        +++ +   N +   S +F P E+ ++               P+Q   +  E+  P+VTAYG GL  G+    A+F ID+ +     L + +EGP +A+I   DN DGTCSV+YLP  PG Y + V +  +HI  SP+   I     S       A + + G             S   V+ +  D     ++ A I  P  ++  C +    DG    S+SP   G+H + +   G  V  SP+ V V   +  D  R+RA G GLEE  T +  +F VD   AG G + +S+EGP+  ++ C D +DG C V Y P +PG+Y ++IKF E+ IPGSPFTV
Sbjct:  936 ANPSKVRVWGEGLR--GGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECH----DHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVK-----PSVETS---GVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLELYRSDPNQQPEHLKW---KLLFVYYSPSFKMTFTCLFKYIKAVRLTPVLPTKLHKQKTTTTSITKASSQAPPSHPA---LRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEV---NPAKVRCSGPGL--GLSAG---GGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVA-VGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVD--EMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLR-----ASLLSRG-------------STHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTV 2022          

HSP 6 Score: 255.373 bits (651), Expect = 5.654e-68
Identity = 350/1472 (23.78%), Postives = 569/1472 (38.65%), Query Frame = 2
Query: 1130 YIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTK--GRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAG-FADLGVNVYGPGRSLEKCQ-IKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVD-VAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVN--IPESPFKVNVIEAGNAANIKV--YGPGIERAKTNIETYFVVDCKL---AGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIG-QLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPI-GNSPYKVIATDRVNTKEYPETETPLLISAD----YAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSNFEPNEEI------------IYPVQRTNEKAELRKPN-------VTAYGEGLVK------GVANTPAS----FIIDSTEEPPAPLGVTIEGP--MEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTG-----VFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFN-QRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIR------------AYGPGL-EEGITKQPQKFTVDLEGAG----------------QGGLGLSIEGPA--DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIP-GSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSE--AKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVG--------PVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFY 5251
            Y P   G + I++ F+  E+ +SPF ++V  +  D SKV   GPGI   G E  +   F V+T  AG   +D    D +       +  +I    +  + ++YT  ++G   + V + G  +  SPF V V+      D  +    G G + E   +    E +V T  AG    L   +  P R    C             +      GP+ +D+ Y  +P+  SPF ++ V P   SK++ +G GL GG V  PA F V+T     G LG +++GP EA+++C D+GDG+ +V+Y P   GEYAV+IL  D ++P SP+ A ++   +      V  +GPG+  G +   P      + +    S    E +       P  ++      Y   Y+P      T +  Y       P  P K++  +    +  K     P    A  +  + F VD +     G   +  +V+            DN DGT+       ++   + +++ ++ A +P+SPF+V +    D  + +++       +  + N F I T   G      + V+ P  + V  + ++   GF   +     G +   +   G  I   SP+ V   D VN  +   +   L +SA      A+   A    S+    A    ++     T   P+  R   E  + +            + P     + A    P+       + AY  G V+        +  PAS    F ID+ E   APL +TI  P     +   +D GDG  SV+YLP   G Y V V Y  + +  SPF V  +    +S     V    +  PG+   G     +     +   VNAK     G+G V   +  P   +     V+N  DGT+S  ++    G + I + + G  +  SP+ V V       R R            A G GL E  + + P +     E                   +G +   +  P+   A  +  DN+DGT SV + P + G +++ IK+N  HIP GSP    + D +D   V  YGPGL      V   + FT+D   AGE  L + V   +   +        +  G   V+Y+P   G+  I V +    +PGSP++  ++   +  +  +   G      H ++ ++P        D   + L   +  P+       +    DG     +     G + V V  G ++VP SPF V V +       +    G  L E    +     V+T+ AG G +     GP  + V    E+   G   V Y P + G Y + + F +E IP          P  Q                   + E S+     PV         P+      + NC + R+  PR+  +G  +++        G           P  G  FK Y
Sbjct:  707 YTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSH-DASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPL---DLGKIRVEGLGTKLE---MGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSG---VQVFGPGVEKGTTFLPPPLHSSCSLSD---SHSLLELYRSDPNQQPEHLKWKLLFVY---YSPSFKMTFTCLFKYIKAVRLTPVLPTKLHKQKTTTTSITKASSQAPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTY-AVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGL-GLHVEGPGEAHVAFE-EDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALD----VTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKE---AGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYV-DEMDGPSVTAYGPGLSHG--MVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEIS----CQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGST----HDVSLRIPD-------DTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGP--SRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVSGPGRQ-------------------KEEVSLCQAAAPVAVVGSTCSLPLAIPGNELFNCTAQRQLPPRVTRSGHYSVSRWLWRVGRGAAGGSDARLASPKIGETFKIY 2113          

HSP 7 Score: 209.92 bits (533), Expect = 3.536e-54
Identity = 188/643 (29.24%), Postives = 294/643 (45.72%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASG-------PGIEPVGN-----EVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSK---------TSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQI---------KKVSPCLYE-------CSYIPQRPGPYVVDIKYGNNPIHL-SPFNVDVAPYKESKIKAFGPGLTGGIVSKPAFFEVET-NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNV--IEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPI 2737
            ++ RVR  G G+   G     P  FT+DT  AG   L I +++P G      + D    +  +S SY+P + G Y + + +   E+P SPF V+   A GD SK   +        PG+   G      ++G  T   V   EAG G V C +L  +  +  V   +   ++  F I +T  + G + + V F G  I +SPF V+V +          T+        A GRG+  E    R  +E    +ED     L         SL K  I         +K SP + +        S+ P   G + +DIKY  + I   SP    V       + A+GPGL+ G+V K A F ++T +   G L  +++GPS+A+I C DN DG+ +V+Y PT PG+Y++ +    ++IP SPYMA+I       D L+ +    G    +S   P D          P+ + A+    +G+     ++  +DG     ++PK  G+H V V  G  ++P SPF+V V   E G+A  ++  G G+E A+T     F+VD + AG G + +S+  E    V +  +D  DG   + Y P   G  +   I F+E +IP SPF V + S    +K +++      P+
Sbjct: 1421 DAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLD--GGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHA-FATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVD-VVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLC-ERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGE---DSLRASLLSRGSTHDVSLRIPDDT--------DPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSM--EGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLA-IKFAEEQIPGSPFTV-LVSGPGRQKEEVSLCQAAAPV 2043          

HSP 8 Score: 135.961 bits (341), Expect = 9.394e-32
Identity = 124/420 (29.52%), Postives = 184/420 (43.81%), Query Frame = 2
Query: 1190 PNSPF--KVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGV----NVYGPG--RSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVA-PYKESKIKAFGPGLT--GGIVSKPAFFEVET-NGETGALGFSIKGP-SEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIR----DNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA 2398
            P +P   K+N KNA        A GPG+E VGN V R   F V T  AG G V   + D +G K+  +       +  F+  Y  +  G H V V FAG  I  SPF V+V+    + DA +  A G G++P G        F + T   G           V  P   R   +  +++    +  C+Y P  PGP++V + Y    +  SPF+V++         +A G GL   G  V   A F V T    +G L   ++ P  E  +   + G+G     Y P   G + + I    ++IP+SP+   +  +     P KV A+GPGL +G++  + ADF+V        + V    F + G   P Q R    D  DG+   RY P  PG + V V     ++  SPF  +++ A
Sbjct:  147 PGAPLRPKLNPKNA-------HAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPP--HGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEA---GPQKVRAWGPGLETGMA-GRSADFVVEAIG----TDVGTLGFSIEG---PSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPA 546          

HSP 9 Score: 123.635 bits (309), Expect = 4.954e-28
Identity = 113/417 (27.10%), Postives = 182/417 (43.65%), Query Frame = 2
Query: 3191 KAELRKPNVTAYGEGLVKGVANT---PASFIIDSTEEPPAPLGVTIEGPM----EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTV-NAKPIDFNGKGIVKAIITNPFNQRSTC--TVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITK--QPQKFTVDLEGAGQGGLGLSIEGP-ADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVL---NSCEPEKV 4393
            + +L   N  A+G G V+ V N+    A F++++       + V +E P     EA++   ++   +    Y P+  G + V VL+  +HI  SPF V + P         D  KVTA GPG+ P+G      + F +  A      G G V   + +P  +R     T++   D    C+Y P V G H + + Y G  V  SP+ V + +  +P   RA G GL+    +      F V  + AG G L + +  P  +  ++  +  +G    +Y P   G + ++I +  KHIP SPF V +       KV+ +GPGLE         + F V+A       L  ++   +   +           G  DV Y+P   G+  + VL +   V  SPF+ ++L     C PE+V
Sbjct:  152 RPKLNPKNAHAFGPG-VEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH------GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETG--MAGRSADFVVEAIGTDVGTLGFSIEGPSQARIA----CDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV 555          

HSP 10 Score: 122.094 bits (305), Expect = 1.502e-27
Identity = 117/450 (26.00%), Postives = 193/450 (42.89%), Query Frame = 2
Query: 3710 PAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEE--GITKQPQKFTVDLEGAGQGGLGLSIEGPA----DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTV---PIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTV----DASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKP 5020
            P VD +H +       P AK     P+    +P    A+GPG+E      ++  +F V+ E AG G + + +E P     +A++   ++K  +    Y P+  G + V++ F  +HI  SPF V   P H   D  KV   GPG+E +G+     + F +    D + AG   + V V+D   +       L +    +   TY P   G   + V Y    VP SPF  N+  +C P     +G G++  RG  + +   + F + T+ AG  +L +++  P  E   +     G+G    +YK    G + + + +G K++P SPF V V +EA P++    GP L     G++    V       G L     GP    + C    +  G   V YVP + G Y V ++ ++E++       +          ER  H  + +   P
Sbjct:  126 PNVD-EHSVMTYLSQFPKAKLKPGAPLRPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHG--DAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQ-SRGVRVGDA--AGFRVLTKQAGSGELNVLLRNPRGEE-PMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGD--GSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVRHRPSAKPPLP 566          

HSP 11 Score: 116.701 bits (291), Expect = 6.002e-26
Identity = 105/373 (28.15%), Postives = 163/373 (43.70%), Query Frame = 2
Query: 1544 KQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQI-----KKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK--ESKIKAFGPGL--TGGIVSKPAFFEVET-------------------NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLIS-GISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGT 2575
            K A+A G G++  G  V   AEF V TE+AG  ++ V V  P    E+ ++     K+ S   +   Y P+  GP+ V + +    I  SPF V VAP      K+ A GPG+  +G +  K  +F++ T                    G   A+  +++   +A + C          TY P VPG + V +      +P SP+   I    +  +P    A G GL S G+     A F V TK AGS   +     +  G+  P++ R+  +G +   Y P   G H + +++G  +IP SPF+V V        ++ +GPG+E         FVV+      G +G S+  E      +  DD GDG+
Sbjct:  158 KNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRS---FVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRC----------TYRPLVPGPHIVSVGYAGAAVPHSPFSVNIG---EACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGS-GELNVLLRNPRGEE-PMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSI--EGPSQARIACDDRGDGS 510          

HSP 12 Score: 109.383 bits (272), Expect = 1.061e-23
Identity = 98/373 (26.27%), Postives = 156/373 (41.82%), Query Frame = 2
Query: 1394 ITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCL-----------YECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAP---YKESKIKAFGPGLTGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVP---GEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPS---TVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKT 2452
            I K   +   ++YT    G  ++ VFF+  +++ SPFG+ V     + DA +    G GI   GV     A F V+T  AG A+L V         E  ++    P L           Y   Y P + G   + + YG + +  SPF V VAP     + +++  G  L  G   +         G  G L   +  P+  K+ C       A            G + + +  D   +P SP++ +  L     +P KV  +G GL  G     PA+F V+T  AG      TV+  C         ++  D+ DGT S  Y P   G++ V + + + ++P SPF   V  +   + ++V+GPG+E+  T
Sbjct:  695 IIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDV---VPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQ-------FEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMG-CEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPA---NPSKVRVWGEGLRGG-EVGIPAEFCVDTTAAGVGGLGLTVEGPC------EARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTT 1046          

HSP 13 Score: 101.293 bits (251), Expect = 2.734e-21
Identity = 186/831 (22.38%), Postives = 319/831 (38.39%), Query Frame = 2
Query: 5285 AYGPGLSY--GRPDMHAHFTIVTKDAGAGGLSLAVEGPS----KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPF---TAKIFGEPKKRSQICVGT--TSDVPLRISETDI-----------NNLNAIVISPTGREESC--TLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECH-DNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLI-DGGPHKVHIMGSGVER--GLANDANQFTIYTREAGA--GSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG--------HTGRINEFFVDTSNAGNGALTVTIDGP---SKVQLNCQE----NESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEF-IVDAGLAGGDVLYVGVSGPVR---PCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPF--EIVVP 7624
            A+GPG+       +  A F + T++AG G + + VE P     +A +   ++K  +    Y P   G + + + F  +HI  SPF    A   G+  K +    G   + +V  + +  DI            ++   V+ P GR ++   TL++ ++  L  ++ P   G H+V+V  +G  +P+SPF + +GE     A R    G       V +   F V T+ AG G L++ +  P   E   H +  +G     YKP   G ++I + +   ++P SPF V +    + +  +++       E    G   +  +   G +      S+  PS +   C+     D    +R++P E G + V V  D   V  SPF   + P   D  P +V    S      GL          T++      +L +    P K E+  +    G+  V+ R    G  V  +  +   +    F++ + ++P +  ++  K  +   + +  IS   +     ++G K               +A  + P + +    I K DN+  +V + P   G   + V  +   +  SPF + V     + +    G           +   F V T  AG   L V  + P   + V +   E    ++  Y   Y P   G   + + YGG+ H+ GSPF V ++                              P     ++ EG G K+ E+G   E  +V  G  G   L   +  P R   PC    +             + E G H + V +  H VPGSPF  E V+P
Sbjct:  162 AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVS---AEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACD--DRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVRHRPSAKPPLPGLPRAPQPLKTKTKKQPWPFAALYLTWALPLKFEVVSRSTMRGN-SVSDRA---GSNVIIVSSSRIIIIIIIFLIDVTQSPLTVCTRESKCFSTKVS-ANAISPVVVPPGDVSVGIKC--------------AAGAMVPVDSDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGD-HVPGSPFPVTVAP-----------------------------PLDLGKIRVEGLGTKL-EMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAE--AAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLP 935          

HSP 14 Score: 95.1301 bits (235), Expect = 1.964e-19
Identity = 95/324 (29.32%), Postives = 140/324 (43.21%), Query Frame = 2
Query:  932 NSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPK-GQKEP---CEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEA-GPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKE-SKIKAFGPGLTGGIVSKP 1885
            ++ +VR  GPG+   G     PA FTV T  AGK  LD+   +P+ G   P    EI D  N + +Y+  Y P  +G   + + +    +P SPF V V     D  K+   G G +    E+G      V T  A G G ++  +L    +K                      E G H ++V + G  +  SPF +M +   +N    + +  G G++  G  V   AEF V T  AG   LG+ V GP  +  +C       C    SY+P + G Y V+I + +  +  SPF   V P  E S ++ FGPG+  G    P
Sbjct:  740 DASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIID--NHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPL-DLGKIRVEGLGTK---LEMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCS-SEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPF-LMEAVLPANPSKVRVW--GEGLR--GGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTC--SVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTTFLP 1049          

HSP 15 Score: 91.6633 bits (226), Expect = 2.115e-18
Identity = 79/284 (27.82%), Postives = 113/284 (39.79%), Query Frame = 2
Query: 6818 ISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG------HTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQEN-ESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVA---------EIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            +   V++PS      S++   +  Y+V +VP   G H V V    + +P SPFRV V +         HG       T R N F +DT  AG G L + ++GP +  +  +E+ E G+   Y   +PG+Y   I YGG     GSPF V +        D +                       P  V+C G GL ++           G    F VD   AG   L V   GP    E V +    +    + Y     G + L V++   DVP SPF + V
Sbjct: 1162 VRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPV-------RDEV----------------------NPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDV 1416          

HSP 16 Score: 85.5001 bits (210), Expect = 2.021e-16
Identity = 95/357 (26.61%), Postives = 151/357 (42.30%), Query Frame = 2
Query: 1754 YVVDIKYGNNPIHLSPFNVDVAPYKESKIKAFGPGL--TGGIVSKPAFFEVETNGETGALGFSIKGPSEAKIDC----VDNGDGSANVTYWPTVPGEYAVH---ILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQT-IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNV-NIPESPFKVNV------------------IEAG--------------------NAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPI 2677
            Y V +++ +  I  SPF + V    E   +    GL  +G  V+ PA F V  NG  G +   +  PS +  +C    +D    S     +  VP E  VH   + CD  ++P SP+  ++       D   V+A+GPGL  G +T  PA+F+V+T  AG  S   A    + G + + V   +  +G + C Y P  PG + V + YG   +I  SP++  V                  +EAG                    +++ ++ +GPG+  A    +  F VDC  AGS  + + VL   +    V     G   F + Y  K  G    I + + +  +P SPF+V +
Sbjct: 2272 YEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSGLLESGWKVNHPASFAVHLNGAKGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARF--VPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERG-TTGSPAEFVVDTSGAGPGSLAVA----IDGPSKVRVDCSEGPEGYHFC-YLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLI-VKWGDQHVPGSPFRVTV 2619          

HSP 17 Score: 80.4925 bits (197), Expect = 6.111e-15
Identity = 93/359 (25.91%), Postives = 140/359 (39.00%), Query Frame = 2
Query: 1151 EYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGR-KDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHL--SPFNVDVA-----------------------------------PYK----ESKIKAFGPGLTGGIVSKPAFFEVETNGETGA--LGFSIKGPSE--AKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQI 2089
            +Y + ++F +  IP SPF + V     +  +V  SG  +   G +V     F V    A  G ++  +    G  ++    +I K   +     +  +E G+H V+V   G  +  SPF V V      +DA    A G G+  E       AEF V T  AG   L V + GP +    C      P  Y   Y+P  PG Y+V I YG  P H+  SP+   V                                    P K     SK+++ GPGL+  +V K   F V+  G  G+  L   + GPS    ++     G     VTY     G Y + +   D+++P SP+   +
Sbjct: 2271 DYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSG--LLESGWKVNHPASFAVHLNGA-KGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGL--ERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCS---EGPEGYHFCYLPTAPGLYLVSICYG-GPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDC-GRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2619          

HSP 18 Score: 75.8702 bits (185), Expect = 1.510e-13
Identity = 52/171 (30.41%), Postives = 86/171 (50.29%), Query Frame = 2
Query: 2024 EYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQT---IPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAAN---IKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISV 2518
            +Y V +  +DE+IP SP++  + +D    +  +V   G  L SG   N PA F V+    G+   ++A+    +G        +I  +     + R+ P+  G H V V+    ++P SPF+V V E G+AA+   +  +GPG+ER  T     FVVD   AG G + +++
Sbjct: 2271 DYEVSVRFEDEHIPGSPFL--LTVDGVCEESRRVAVSGL-LESGWKVNHPASFAVHLN--GAKGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAI 2436          

HSP 19 Score: 73.1738 bits (178), Expect = 1.095e-12
Identity = 90/346 (26.01%), Postives = 152/346 (43.93%), Query Frame = 2
Query: 2057 NIPKSPYMAQIQLDTKLFDPLKVTAYGPGLIS-GISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDG--TYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA-GNAANIKVYGPGIERAK--TNIETYFVV----DCKLAGSGDIGISVLDEK-MRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNL---NNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVA-GFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEY----PETETPLL-ISADYAID 3034
              PK+       L  KL +P    A+GPG+ + G S  + A+F+V T+NAG    V     D  G     ++   ND   ++   Y P++ G H V V +   +I  SPF V V    G+A  +   GPG+E +       TYF +    D   AG GD+ ++VLD +  RD   +T +                  + + + ++ A +P SPF V I    +    + +     +    +G    F +LT   GS     +++++P G   P++ +E   G     + P  +GPH +T+   G  I  SP++V+ +     ++     P  ET +   SAD+ ++
Sbjct:  139 QFPKAKLKPGAPLRPKL-NPKNAHAFGPGVEAVGNSVERAAEFVVETENAGL-GEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSG-ELNVLLRNPRGEE-PMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVE 480          

HSP 20 Score: 70.4774 bits (171), Expect = 6.174e-12
Identity = 81/326 (24.85%), Postives = 130/326 (39.88%), Query Frame = 2
Query:  962 GLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFD-SPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNA--AGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILD--TKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGV-QIQSSPFGVMVSSK-----------------------------------TSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV 1816
            GL   G  + +PA F V   N  KG ++  V  P G  E C + +   +K    +  ++P   G + + +    + +P SPF+V V     A D + V+A GPG+E      G    F V T+ AGPGS+  V +D  +K R D        +    +   Y     GL+ V++ + G   I  SP+   V+                                      + SD+ +  + G G+    V  ++   F V    AG   L V V GP    E+  +K      +  +Y  +  G Y++ +K+G+  +  SPF V V
Sbjct: 2306 GLLESGWKVNHPASFAVH-LNGAKGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLE--RGTTGSPAEFVVDTSGAGPGSL-AVAIDGPSKVRVD------CSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNA--FTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2619          

HSP 21 Score: 65.855 bits (159), Expect = 1.744e-10
Identity = 53/206 (25.73%), Postives = 95/206 (46.12%), Query Frame = 2
Query: 3137 SNFEPNEEIIYPVQRTNEKA---------ELRKPN-------VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYND-EHIKDSPFNVTIY-PDTKSSSNIDDVAK--VTAYGPGLNPTGVFKDSFS-KFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGT 3691
            + F P E  ++PV  T + A          + +P        V+A+G GL +G   +PA F++D++   P  L V I+GP + ++D  +  +G     YLP  PG Y+V++ Y    HI  SP+   +  P      N+ + +   V A  P     G+  +    K T ++  ++ +G G+  A++     +++  TVD    G+
Sbjct: 2360 ARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGY-HFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALV----GKQNAFTVDCGRAGS 2560          

HSP 22 Score: 65.4698 bits (158), Expect = 1.995e-10
Identity = 103/432 (23.84%), Postives = 160/432 (37.04%), Query Frame = 2
Query: 6392 PHKVHIMGSGVERGLAND---ANQFTIYTREAGAGSLSIAIEGPS----KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQI-----DENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLA--SISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGH--------TGRINEFFVDTSNAGNGALTVTIDGP--SKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVS--GPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPF 7609
            P   H  G GVE  + N    A +F + T  AG G + + +E P     +A +  +++K  S    YR    G +  ++ F  +H+  SPF + +     D    ++    V+    +   + Y  I    D                          V+ P  +      ++ +  +      + P+  G H V V    + +P SPF V +GE    G     G          G    F V T  AG+G L V +  P   +   + +  E  + F Y P A G + I+I +GG  HI  SPF V +S                           + GP K   V+  G GL+    G+  +F+V+A   G DV  +G S  GP +    +     G+    V Y   E G + + V     DV  SPF
Sbjct:  157 PKNAHAFGPGVE-AVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVT--------------VLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGK-HIPRSPFEVLVS--------------------------AEAGPQK---VRAWGPGLETGMAGRSADFVVEA--IGTDVGTLGFSIEGPSQ--ARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPF 539          

HSP 23 Score: 58.9214 bits (141), Expect = 1.780e-8
Identity = 61/234 (26.07%), Postives = 90/234 (38.46%), Query Frame = 2
Query:  929 TNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFAN-SEIPNSPFKVNVKN-----------------AAGDP--------------------SKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMV 1516
             ++  V A+GPGLE    T G+PA F VDT  AG G+L + +  P   +  C   + P     Y   Y+PT  G Y + I +     I  SP++  V                    AG+P                    SKV + GPG+      VG++  F V    AG   +   +L      + V   +      +F + Y  KE G + + V +    +  SPF V V
Sbjct: 2397 ADAALVSAFGPGLER--GTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCS--EGPE---GYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTA--LVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEV--HVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2619          

HSP 24 Score: 56.6102 bits (135), Expect = 1.082e-7
Identity = 94/384 (24.48%), Postives = 140/384 (36.46%), Query Frame = 2
Query: 6515 SKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISK--IDNNQYS--VHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG-----HTGRINEFFVDTSNAG-NGALTVTIDGPSKVQLNCQENESGYNFTYVPNAP----GDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCE-EVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            S    D   N + +  V Y     G +   + F+++ V  SPF   ID  P    SK V+ E    N +           G      A+F +   G     +      P     +  +    IDN+ YS  V + P + G   + V      +PGSPF V V      G+    G       G   E  V T  AG  G L   +  P++ ++ C              A     G + + + Y G+  + GSPF                    L + V          P+ P  V+  G+GL+  E+G   EF VD   AG   L + V G   PCE  +     G+    V+Y   + G + + + + +  VPGSPF  VV
Sbjct:  689 SDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPF--GIDVVPSHDASK-VRVEGPGINAT-----------GVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHP-VPGSPF--------------------LMEAVL---------PANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEG---PCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVV 1025          
BLAST of Filamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001908.1 (pep scaffold:Pmarinus_7.0:GL483086:279:38879:-1 gene:ENSPMAG00000001731.1 transcript:ENSPMAT00000001908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 484.182 bits (1245), Expect = 1.822e-147
Identity = 335/956 (35.04%), Postives = 492/956 (51.46%), Query Frame = 2
Query:  716 GLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSK--------TSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVA-PYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDT---KLFDP----LKVTAYGPGLISG-ISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGN--AANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLN-NTTPIGQLNEFEILTPFDGSKVRP---EIIVKSPNGSRVPVKLQETNNGFVA-GFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPET-----ETPLLISA--DYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQRSN------FEPNEEIIYPVQRTNEKAEL-RKP------------NVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYN 3430
            GLCP+W  WD +  + NA+EA+  A++ L V  +I P E+++P VDE ++MTYL+QFP A+L   APL PK N  + RA+GPG+E  GN +  PA FTV+T +AG+G + + V +P G KE  ++    +K   YS  Y P + G +++ + FA   I  SPF+V+V     D SKVTA GPG+E  G   G+ T+F++ TA AG G V   I D +GR D+V  ++  + E+ F   Y    EG HSV V + G  I  SPF V V+           SN   +         +PE V +R V    ++ ++ G  D  V  +   +  E+ Q+K + P    C Y+P   G +VV + +    I  SPF V+V  P  E K++A+GPGL  G+V  PA F VE  G + G LGFSI+GPS+A+I+C D GDGS +V YWP   G+YAVH++CDD++I  SP+MA+I ++T    LF P     KV  +GPGL SG +   KP +F V+ + AG  +  K    D  G  I VQ++DN DGT+ CRYTP+   KHT + ++G V++P SP +V  + AG      ++V GPG++  +      F VD + AG G +G++V  E  R+  +  +DNGDGT             + + + F+   +P SPF+  I    D  +          + +G+   F +    D SK       + V S +G R  VK +   +G  A  FTP   GPHTV++   G P+ + P KV     V+T     +     E  +   A   + +D +A  +     +   +T V   +      P K + +      + P E  ++ V    E   + R P             V  +G GL  G+ N P  F +++       LG+ IEGP EA I   DN DG+C V Y+P+  G Y V V Y 
Sbjct:    1 GLCPDWETWDARPPVDNAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLAQFPKAKLKPGAPLRPKLNPKKARAFGPGVEAMGNMVMKPAAFTVETISAGQGEVLVFVEDPAGHKEEAKVSPVKDKNQTYSVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADASKVTARGPGLELNGVIAGKPTYFDIHTAGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNVAQACRVHLCHVCSNGQRESDLQ-----KPEMVDIRPV----IYEKERG--DGSVKTFIISKGKERNQVKPLGP-TRSCEYMPSVQGKHVVSVTWAGQHIPRSPFEVEVGPPAGEQKVRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIEGPSQARIECQDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEI-VETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDAR-AGGRAPFKVYAQDAEGTPIDVQVKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQ-LXAGRHPQRGVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTV--EGPREARIECEDNGDGTC-SVAYTPAEAGEHLVNVLFAGQHVPGSPFRALIHPTFDPSRVLATGRGLEKSKMGEPATFNV----DCSKAGDGDLAVDVVSDSGKRADVKTRRGPDGLHAVTFTPVTHGPHTVSLTYGGKPVPHFPAKVAVDPAVDTSGIKVSGPGVEERGVFCEAITGFTVDARALGRAGNGARV--VTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDEGCDPSRVRVHGPGLKSGITNQPNRFTVETRGAGTGGLGLQIEGPTEAIISCTDNKDGSCLVEYVPETAGDYDVLVTYG 932          

HSP 2 Score: 309.686 bits (792), Expect = 4.494e-88
Identity = 265/888 (29.84%), Postives = 404/888 (45.50%), Query Frame = 2
Query: 2402 NAANIKVYGPGIERAKTNI--ETYFVVDCKLAGSGDIGISVLD----EKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPI---ESDNDFKKYKINNLN-NTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNG---FVAGFTPTVIGPHTVTVECKGNPIGNSPY--KVIATDRV-------NTKEYPETETPLLISADYAIDNKAYN------------------KPSIPVQSAKLTP-VERSNVK--TFSNPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDV--AKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSR-IRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTP-GLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESD----LELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFN 4912
            N    + +GPG+E     +     F V+   AG G++ + V D    ++   V  V D N                 + + + F+   I +SPF+V +   ++D      +   L  N    G+   F+I T   G      + +  P G    V ++  + G   F   +   + G H+V V   G  I  SP+   V    RV       N +   + + P ++     I  K                     KP  P +S +  P V+  +V   T++  +  RS FE   E+  P              V A+G GL  G+ + PA F++++  +    LG +IEGP +A+I+  D GDG+C V Y P E G Y V+V+ +D+ IK SPF   I         + +    KV  +GPGL    V      +FTV+A+     G+   K    +         V +N DGT+ C Y+P    +H    T+ GV V  SP+ V +  G  P R +R  GPGL+ G   +P +F+VD  GAG GGLGL++EGP +A+I+C DN DGTCSV Y P + G + V++ F  +H+PGSPF   IH   D S+V   G GLE+  S++  P+ F VD SKAG+  L V+V+   + S K A +  +  P GL  VT+ P   G   + + Y    VP  P    V  + +   + V+G GV   RG  +  +  + FT++ R  G +     +   VTGP+   ++  V   GDGT+  +Y     G +TV VL+ +  VP SPF + V     P +  + GP L      +     V T+ AG G L  +  GP   I+ C+  + + G   V YVP+  G Y+V + + 
Sbjct:   73 NPKKARAFGPGVEAMGNMVMKPAAFTVETISAGQGEVLVFVEDPAGHKEEAKVSPVKDKN---QTYSVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADASKVTARGPGLELNGVIAGKPTYFDIHTAGAGMG-DVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNVAQACRVHLCHVCSNGQRESDLQKPEMVDIRPVIYEKERGDGSVKTFIISKGKERNQVKPLGPTRSCEYMPSVQGKHVVSVTWAGQHIPRSPFE--VEVGPPAGEQK---------VRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIEGPSQARIECQDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDAR---AGGRAPFKVYAQDAEGTPIDVQVKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQLXAGRHPQRGVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTVEGPREARIECEDNGDGTCSVAYTPAEAGEHLVNVLFAGQHVPGSPFRALIHPTFDPSRVLATGRGLEK--SKMGEPATFNVDCSKAGDGDLAVDVV---SDSGKRADVKTRRGPDGLHAVTFTPVTHGPHTVSLTYGGKPVPHFPAKVAVDPAVDTSGIKVSGPGVE-ERG--VFCEAITGFTVDARALGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDEGCDPSRVRVHGPGLKSGITNQPNRFTVETRGAGTGGLGLQIEGPTEAIISCT--DNKDGSCLVEYVPETAGDYDVLVTYG 932          

HSP 3 Score: 299.671 bits (766), Expect = 9.218e-85
Identity = 247/838 (29.47%), Postives = 371/838 (44.27%), Query Frame = 2
Query: 3068 QSAKLTPVERSNVKTFS--------NPNKQRSNFEPNEEIIYPVQRTNEKAELRKPNVTAYGEGL-VKGV-ANTPASFIIDSTEEPPAPLGVTIEGPM----EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDF---NGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDI---------VDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKV--PSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAV--VNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKF 5491
            + AK++PV+  N +T+S         P+K    F        P + +  K +     VTA G GL + GV A  P  F I +       + VTI  P        ++  D G+      Y     G++ V V Y    I  SPF V +    +       +  V + G   +      D      V+ +P+ +    G G VK  I +   +R+          T SC Y P+V G+H + +T+ G  + +SP+ V V   +   ++RA+GPGL  G+   P  F V+  G   G LG SIEGP+ A+I+C D  DG+C V Y P + G Y V +  +++ I  SPF   I +             +KVK +GPGLE     V  P +FTVDA   G AP KV   D     +   Q+      G F   Y P           +  + VPGSP    +     P++      GVR     L + +V  P+ F+++TR AG+  L L V GP      ++ +++GDGT +  Y     G + V VL+  ++VPGSPF   +H    P +    G  L +  +G+  T  V+   AGDG L+   V   G            G   V++ P   G + V L +  + +P+   +  A  P    S  + +     E+           VD +  +G   +  R V  V  PS       +   GDGT  V+Y P E G+H ++V +   P+  SPF+  VD      +V  +GPGL  G  +    FT+ T+ AG GGL L +EGP++A I C DNK+G+C V Y+P   GDY + + +
Sbjct:  121 EEAKVSPVKDKN-QTYSVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADASKVTARGPGLELNGVIAGKPTYFDIHTAGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNVAQACRVH-----LCHVCSNGQRES------DLQKPEMVDIRPVIYEKERGDGSVKTFIISKGKERNQVKPLGP---TRSCEYMPSVQGKHVVSVTWAGQHIPRSPFEVEVGPPAGEQKVRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIEGPSQARIECQDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDARAGGRAPFKVYAQDAEGTPID-VQVKDNGD-GTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQLXAGRHPQR------GVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTVEGPRE--ARIECEDNGDGTCSVAYTPAEAGEHLVNVLFAGQHVPGSPFRALIHPTFDPSRVLATGRGLEKSKMGEPATFNVDCSKAGDGDLAVDVVSDSGKRADVKTRRGPDGLHAVTFTPVTHGPHTVSLTYGGKPVPHFPAK-VAVDPAVDTSGIKVSGPGVEERGVFCEAITGFTVDARA-LGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDEGCDPSRVRVHGPGLKSGITNQPNRFTVETRGAGTGGLGLQIEGPTEAIISCTDNKDGSCLVEYVPETAGDYDVLVTY 931          

HSP 4 Score: 251.521 bits (641), Expect = 6.881e-69
Identity = 233/818 (28.48%), Postives = 354/818 (43.28%), Query Frame = 2
Query: 4340 PGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGP--NNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHS-EAKPEQCYIEGP--ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKI--GAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRA-------VVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTA--------------------KIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASR-VKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGV-ERGLANDA-NQFTIYTR---EAGAGSLSIA-IEGPSKAEID--FQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDEN 6664
            PG+P  +  LN   P+K    G GV    G+++    P+ FT+ T  AG+ ++ + V  P  + E   +      + T++  Y   V G + V VL+  +++  SPF V V   +A   +    GP   LN V  GK     ++T  AG G +      P G      +E E  G S      + +  GA+ V + +    IP     +  F      +      H  +   +     +  +VD + PV  +++  R        +++    R  V  L      T + +Y PS  G H + V + GQ I  SPF+  V       +V A+GPGL  G  D  AHF +       G L  ++EGPS+A I+C D  +G+CDV Y P   GDY + +   D+ I  SPF A                    K+FG   +  ++ VG   +  +                  G      +K   +G     +TP++  +H       G  +P SP ++ +      +  R V++ G GL  G V    QF VDTR AG GGL L++EGP +  IEC DN DGTC V Y P E G +++NV +A  +VPGSPF   I  +P+   + R+L      E S++G     N+        +    V+S SG     +     D   ++ F P   G HTVS+    + V   P +  V P +D     + + G GV ERG+  +A   FT+  R    AG G+  +  + GPS A +D   +   DG+  V Y   E G +   + F D  VP SPF + +DE 
Sbjct:   64 PGAPL-RPKLN---PKKARAFGPGVE-AMGNMVMK--PAAFTVETISAGQGEVLVFVEDPAGHKEEAKVSPVKDKNQTYSVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADASKVTARGPGLELNGVIAGKPTYFDIHTAGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIP-----RSPFPVNVAQACRVHLCHVCSNGQRESDLQKPEMVDIR-PV--IYEKERGDGSVKTFIISKGKERNQVKPL----GPTRSCEYMPSVQGKHVVSVTWAGQHIPRSPFEVEVGPPAGEQKVRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIEGPSQARIECQDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDARAGGRAPFKVYAQDAEGTPIDVQVKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQLXAGR--HPQRGVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTVEGPREARIECEDNGDGTCSVAYTPAEAGEHLVNVLFAGQHVPGSPFRALI--HPTFDPS-RVLATGRGLEKSKMGEPATFNVDCSKAGDGDLAVDVVSDSGKRADVKTRRGPDGLHAVTFTPVTHGPHTVSLTYGGKPVPHFPAKVAVDPAVD--TSGIKVSGPGVEERGVFCEAITGFTVDARALGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDEG 855          

HSP 5 Score: 246.899 bits (629), Expect = 2.246e-67
Identity = 228/842 (27.08%), Postives = 364/842 (43.23%), Query Frame = 2
Query: 3710 PAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEE--GITKQPQKFTVDLEGAGQGGLGLSIEGPA----DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHD-IVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIAN-------KVPSLFTIN----TRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIR--------QYAFQPQEQYSIERTTHHYTTEQSKPIIRT--EYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDS-TIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTA---------KIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLND-GMVNETCQ-FVVDTRNAGYGG----LSLSIEGPSKVEIEC--HDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPF--AVNIGGYPS 6091
            P VD +H +       P AK     P+    +P + RA+GPG+E    +  +P  FTV+   AGQG + + +E PA    +A++    +K+ T SV Y P+  G + V++ F  +HI  SPF V +     D SKV   GPGLE NG     P+ F +  + AG   + V + D   +S      L      +F   Y     G   + V Y    +P SPF  NV  +C            R H  H+ +N       + P +  I      ++ G+  ++  +     E   +        T +C+Y   V G + V V +  +++P SPF V V   A  ++    GP L    V       V       G L     GP    + C  ++   G   V Y P + G Y V ++ +D++I +            +  F P    + +        E  K ++    E++V        P   Y +     P + +    + +NGDGT   +Y P ++  H     + G  + GSP +  + +   P   V   GPGL  G     A F++ T+ AG GGL L VEGP +A I+C DN +GTC V+Y P   G++ + + F  +H+ GSPF A         ++    +   +  +G  +   +  S+    +L   V+S +G+      +R  +G   ++FTP   G H V++   G+ +P+ P K+ V  +   + S +K+ G G+ + G+  E    F VD R  G  G    +   + GPS   ++       DGT  V Y P E G + ++V + D+ VP SPF  AV+ G  PS
Sbjct:   43 PNVD-EHSVMTYLAQFPKAKLKPGAPLRPKLNPKKARAFGPGVEAMGNMVMKPAAFTVETISAGQGEVLVFVEDPAGHKEEAKVSPVKDKNQTYSVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADASKVTARGPGLELNGVIAGKPTYFDIHTAGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNVAQAC------------RVHLCHVCSNGQRESDLQKPEMVDIRPVIYEKERGDGSVKTFIISKGKERNQVKPLGP---TRSCEYMPSVQGKHVVSVTWAGQHIPRSPFEVEVGPPAGEQKVRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIEGPSQARIEC--QDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPN-ALTTKVKVFGPGLESGKVVVGKPIEFTVDARAGGRAPFKVYAQDAEGTPIDVQ----VKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQLXAGRHPQRGVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTVEGPREARIECEDNGDGTCSVAYTPAEAGEHLVNVLFAGQHVPGSPFRALIHPTFDPSRVLATGRGLEKSKMGEPATFNVDCSKAGDGDLAVDVVSDSGKRADVKTRRGPDGLHAVTFTPVTHGPHTVSLTYGGKPVPHFPAKVAV--DPAVDTSGIKVSGPGVEERGVFCEAITGFTVDARALGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDEGCDPS 859          

HSP 6 Score: 229.95 bits (585), Expect = 7.895e-62
Identity = 226/889 (25.42%), Postives = 362/889 (40.72%), Query Frame = 2
Query: 5084 VRAVVNCPSNRKDVPRL--INNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDS-TIPSGQVTAYGPGLSY-----GRPDMHAHFTIVTKDAGAGGLSLAVEGP----SKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREE------------SCTLKRLQNGYLG----ISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNI------GGYPSSSLTERILRHQDAAEVSQI--GNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPH---KVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHG--------HTGRINEFFVDT---SNAGNGALTVT-IDGPSKVQLNCQENESG---YNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNH 7588
            V   V  P+  K+  ++  + + + T +V Y P   G H++ V + GQ I  SPF+  V      + +VTA GPGL       G+P    +F I T  AG G + + +  P       +++  D        +Y  +  G + + + +    I  SPF   +      R  +C   ++       E+D+     + I P   E+            S   +R Q   LG      + P   G+H+V+V  +G+HIP SPF++ VG        +V+ +G GL  G+V+    FVV+      G L  SIEGPS+  IEC D  DG+C V Y P E G Y ++V   D ++  SPF   I      G +  ++LT ++       E  ++  G   E  +      +           G+    ++    D  F  R+ P++   HT         V GSP +      +  G H    V + G G++ G      QF++ TR AG G L + +EGP +A I+ +DN DG+C V Y   E G+++ ++ F  +HVPGSPF   I               +  F+ SR ++     ++   +G  A F ++     DG ++  V+S S K       +  +  ++V F PV +G H V +     P+P  P +V V     +      G            I  F VD      AGNGA  VT + GPS   ++      G   Y   Y P   G +T+ + +  +  +  SPF +A+                                  P  V+  G GLK     + N F V+   AG   L + + GP      ++     +    V Y  +  G + ++V +G H
Sbjct:  109 VLVFVEDPAGHKEEAKVSPVKDKNQTYSVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADASKVTARGPGLELNGVIAGKP---TYFDIHTAGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNV--AQACRVHLCHVCSNGQ----RESDLQKPEMVDIRPVIYEKERGDGSVKTFIISKGKERNQVKPLGPTRSCEYMPSVQGKHVVSVTWAGQHIPRSPFEVEVGPP--AGEQKVRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIEGPSQARIECQDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDARAGGRAPFKVYAQDAEGTPIDVQVKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQ----LXAGRHPQRGVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTVEGPREARIECEDNGDGTCSVAYTPAEAGEHLVNVLFAGQHVPGSPFRALI---------------HPTFDPSRVLATGRGLEKS-KMGEPATFNVDCSKAGDGDLAVDVVSDSGKRADVKTRRGPDGLHAVTFTPVTHGPHTVSLTYGGKPVPHFPAKVAVDPAVDTSGIKVSGPGVEERGVFCEAITGFTVDARALGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFE-DTPVPRSPFRIAVDEG-----------------------------CDPSRVRVHGPGLKSGITNQPNRFTVETRGAGTGGLGLQIEGPTEAI--ISCTDNKDGSCLVEYVPETAGDYDVLVTYGGH 934          

HSP 7 Score: 199.904 bits (507), Expect = 3.464e-52
Identity = 227/952 (23.84%), Postives = 387/952 (40.65%), Query Frame = 2
Query: 4523 NESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVP--VGKTVTIPVNTQNAGDGILSAKNVGPVGN-----IVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVP--RLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPF--------KFYVDSTIPSGQVTAYGPGLSYGRPDM-HAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI---FGEPKKRSQ---ICVGTTSDVPLRISET---DINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGN-------ASRVKLYGDGLNDG--MVNETCQFVVDTRNAGYGGLSL---SIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNI--GGYPSSSLTERILRHQD-AAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPS--KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVIS----PSNKEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFRXXXXXXXXXXXXIHHGH------TGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFT-YVPNAPGDYTISIKYGGN 7213
             E V+ +VD H   T+  Q+                K  PG+P       +  P++    GP +  +   V K     V T +AG G +      P G+     + P   +N+ Y   +V Y P+ +G ++V ++F  ++I          +PQ   S  + T      +   +I  + +  D     G     V   +  P  R D     L + G+      Y+    G H + V Y G  I  SPF        + ++     +GQ  +        +P+M      I  K+ G G +   +    K   Q +     T    Y+P   G + + + +  +HI  SPF  ++    GE K R+    +  G        + E    DI  L   +  P+     C  +   +G   + + P E G++ V+V+   + I +SPF   + E  +          ++VK++G GL  G  +V +  +F VD R  G     +     EG + ++++  DN DGT L  Y P +   +     +   +VPGSP  V +  G +P     +R +R      +  ++G   + ++   G        +V  P  +   CE     D   S+ + P E G H V+V    +HV GSPF+  + P  D  P +V   G G+E+    +   F +   +AG G L++ +   S  +A++  +   DG   VT+     G +  S+ +  + VP  P  + +D    +S  K              +S   ++++G    +   F ++   L      A V++    PS     A +    +  Y+V + P E G+H V VL  ++P+P SPFR+ V E         HG       T + N F V+T  AG G L + I+GP++  ++C +N+ G     YVP   GDY + + YGG+
Sbjct:   38 EEIVDPNVDEHSVMTYLAQFPK-------------AKLKPGAPL----RPKLNPKKARAFGPGVEAMGNMVMKPAAFTVETISAGQGEVLVFVEDPAGHKEEAKVSPVKDKNQTY---SVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADAS--KVTARGPGLELNGVIAGKPTYFDIHT-AGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNVAQACRVHLCHVCSNGQRES-----DLQKPEMVDIRPVIYEKERGDGSVKTFIISKGKERNQ-VKPLGPTRSCEYMPSVQGKHVVSVTWAGQHIPRSPFEVEVGPPAGEQKVRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIEGPSQARIEC--QDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDARAGGRAPFKVYAQDAEG-TPIDVQVKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQLXAGRHP-----QRGVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTVEGPREARIECE--DNGDGTCSVAYTPAEAGEHLVNVLFAGQHVPGSPFRALIHPTFD--PSRVLATGRGLEKSKMGEPATFNVDCSKAGDGDLAVDVVSDSGKRADVKTRRGPDGLHAVTFTPVTHGPHTVSLTYGGKPVPHFPAKVAVDPAVDTSGIK--------------VSGPGVEERGVFCEAITGFTVDARALGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDEGCDPSRVRVHGPGLKSGITNQPNRFTVETRGAGTGGLGLQIEGPTEAIISCTDNKDGSCLVEYVPETAGDYDVLVTYGGH 934          

HSP 8 Score: 98.9821 bits (245), Expect = 9.090e-21
Identity = 81/283 (28.62%), Postives = 129/283 (45.58%), Query Frame = 2
Query:  941 RVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAG-PGSVDCVILDTKGRKDSV-KPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNN 1783
            RV A G GLE   + +G PA F VD   AG G+L + V++  G++   +    P+    ++ ++ P   G + + + +    +P+ P KV V  A  D S +  SGPG+E  G      T F V     G  G+   V+    G   ++    +  + +  + +EYT  E G+H+V+V F    +  SPF + V       D  +    G G++  G+       F V T  AG   LG+ + GP  ++  C   K   CL E  Y+P+  G Y V + YG +
Sbjct:  664 RVLATGRGLEK--SKMGEPATFNVDCSKAGDGDLAVDVVSDSGKRADVKTRRGPDG--LHAVTFTPVTHGPHTVSLTYGGKPVPHFPAKVAVDPAV-DTSGIKVSGPGVEERGVFCEAITGFTVDARALGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDE---GCDPSRVRVHGPGLK-SGI-TNQPNRFTVETRGAGTGGLGLQIEGPTEAIISCTDNKDGSCLVE--YVPETAGDYDVLVTYGGH 934          

HSP 9 Score: 92.4337 bits (228), Expect = 9.425e-19
Identity = 130/564 (23.05%), Postives = 211/564 (37.41%), Query Frame = 2
Query: 6212 VISPSGSFEMCEIIALSD-NQ-FSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVG-PLIDGGPHKVHIMGSGVERG--LANDANQFTIYTREAGAGSLSIAIEGP----SKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSN-KEQLASISKIDNNQYSVHFVPVENGIHNVHVLVNNSPIPGSPFR------XXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQEN--------------------------------------ESGYNFTYVPNA---------------------PGDYTISIKYGGN-------NHIIGSPFFVAISGN-------NYQSNDSIRETKSLTQTVHMISGSTQK-----GPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            V  P+G  E  ++  + D NQ +S+ + PK +G H V+V    +H+  SPF+ +V  P  D    KV   G G+E    +A     F I+T  AG G + + I  P       +++ +D  +      YR    G +  ++ +    +P SPF + +      + +  V   ++  N  R   +   + +  +I      VI      DGS+  ++IS    + Q+  +    + +Y    +P   G H V V      IP SPF           +V   G G+  G       F V+      G L  +I+GPS+ ++ CQ+                                       E+G    +VPNA                     P ++T+  + GG            G+P  V +  N        Y    +I+ T   T     + GS  +     G      V+  G GL+  E+G+  +F VD   AG   L + V GP      +  +  G+    V Y   E G HL+ V +    VPGSPF  ++
Sbjct:  113 VEDPAGHKEEAKVSPVKDKNQTYSVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADA--SKVTARGPGLELNGVIAGKPTYFDIHTAGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNV------AQACRVHLCHVCSNGQRESDLQ--KPEMVDI----RPVIYEKERGDGSVKTFIISKGKERNQVKPLGPTRSCEY----MPSVQGKHVVSVTWAGQHIPRSPFEVEVGPPAGEQKVRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIEGPSQARIECQDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDARAGGRAPFKVYAQDAEGTPIDVQVKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQLXAGRHPQRGVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTVEGPRE--ARIECEDNGDGTCSVAYTPAEAGEHLVNVLFAGQHVPGSPFRALI 656          
BLAST of Filamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004210.1 (pep scaffold:Pmarinus_7.0:GL476636:147693:235244:1 gene:ENSPMAG00000003806.1 transcript:ENSPMAT00000004210.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 506.523 bits (1303), Expect = 7.805e-146
Identity = 364/1130 (32.21%), Postives = 535/1130 (47.35%), Query Frame = 2
Query: 3554 FKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHI-PGSPFTVPIHDIVDVSKVKCYGPGLERNGS-------RVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIE-----------------GPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCS-IENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSI----------RQYAFQPQEQYSIERTTHHYTTEQ---------------SKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPI-TGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIF-GEPKKR-SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIEC---HDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSV-KSDNRHVTGSPFQFTV-GPLIDGG-----------------------------------PHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSK--AEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQI 6655
             +D+ S+F V+A+ I   G   V+  +  P    +  +V +NHDGTY+  Y P+  G H +++TY G  V +SP+ V V  G DPSR+R +GPGLE G+T +   F++D   AG GGLGL +EGP +A +   ++ +G  +V+Y    PG Y   I +    I  GSPF VP+ D V+ +KV+C GPGL  +         R   P  F+VD S+AG+A L V        + +P +++ ++  G+  +TY P  +G   + V Y    VP SPF  +VL + +  +V V+G GV       +   +P+ FTI+TR+AG++ L + +  P+       V + GDG F+  Y  DV G Y+V V YG   VPGSPF V   +     +C++                  GP +    +G+   + VN + AG G ++ + + P    +    +EN   G  ++ +   + G Y + + F  + IPN             R+       Q    R     +T Q               S   +R  + VV F    G    ++   V+ PS RK  PR+I+N DGT++V + P E GLHE+++ YNG  I TGSP +FYVD  +    VTAYGPGLS+G    HA FTI TKDAG GGLSLAVEGPSKAEI C DNK+GTC VSYLP APGDY I +KF  +HI GSP+ A+I  GE   R S +  G+T DV LRI E    +                   L++G   + + P E G++ V+V     HIP SPF + V +     + RV + G   +   VN    F V   N   G +   +  PS     C     + D      + P E G + ++V    ++VPGSPF V +G    ++    +       E    G+  E  +   G    +   ++  PS     C   +     +   ++P   G++ VS+      H+ GSP++  V GP + GG                                     KV   G G+   L    N FT+    AG+  L + + GPS    E+  +        VTY V E G Y+  +K+ D+HVPGSPF + +
Sbjct: 1148 LRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTA-QGPHGTREPVEVV-QAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGV---SASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQ---IGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKG----HITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDE-MDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGSTHDVSLRILELHCED-------------------LEDGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPFLLTV-DGVCEESRRVAVSGLLESGWKVNHPASFAVHL-NGAKGRIEAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDC---SEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2240          

HSP 2 Score: 447.973 bits (1151), Expect = 2.436e-127
Identity = 249/551 (45.19%), Postives = 343/551 (62.25%), Query Frame = 2
Query:  455 DSSDITDCRLKLILGLIWTLILHYSITMPLWEGEDANQQDGQGKGPSPKQRLLGWINSKMPHKPVKNFTTDWNDGTAIGALVDACAPGLCPNWSQWDPKQALKNAKEAINTAEEHLNVAPLIQPHEMINPKVDEKAMMTYLSQFXXXXXXXXXXXXXKTNSMRVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFT----AEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV-APYKESKIKAFGPGLTGGIVSKPAFFEVETNG-ETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQI 2089
            DS  I D  LKLILGL+WTLILHYSI+MP+WE    +++D + K  +PKQRLLGWI  K+P  P+ NF+ DW DG A+GALVD+CAPGLCP+W  WD  Q + NA+EA+  AE+ L VA +I P E+++P VDE ++MTYLSQFP A+L   APL PK N     A+GPG+E  GN++   A F V+T NAG G + + V +P+G KE   +    +K+ ++   Y P + G +++ + FA   I  SPF V V    GD  KVTA GPG+EP GN  G+ T+F++ T    A AG G V   +LD +GR+D+V+  + ++ +      Y     G H V+V +AG  +  SPF V +    +    +   A+GRG+Q  GVRV D A F+V T+ AG  +L V +  P R  E  + ++V   ++E  Y P   GP+V+ I +G   I  SPF V V A     K++A+GPGL  G+  + A F VE  G + G LGFSI+GPS+A+I C D GDGS +V Y PT PG+YAVH+LCD+E++  SP+MA I
Sbjct:    1 DSKAIVDGNLKLILGLVWTLILHYSISMPVWE----DEEDDEAKKQTPKQRLLGWIQHKLPDLPISNFSQDWKDGRALGALVDSCAPGLCPDWEIWDVHQPIDNAREAMQQAEDWLGVAQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACR---ASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNP-RGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHI 543          

HSP 3 Score: 391.349 bits (1004), Expect = 9.199e-110
Identity = 331/1149 (28.81%), Postives = 501/1149 (43.60%), Query Frame = 2
Query: 4454 SLFTINTRD---AGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTH-HYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRA-------VVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSY-GRP-DMHAHFTIVTKDAGAGGLSLAVEGPS--KAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIF--GEPKK---------------------RSQICVGTTSDVPLRISETDINNLNAIVISPTGREESC-TLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEI-------------------ECH------------DNHDGTCLVTYKPTEPGTYIINVKYADSNVP-GSP--FAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQY-SVHFVPVENGIHNVHVLVNNSPIPGSPFR---------XXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGYNFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLT----QTVHMISGSTQ-----KGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYVQEKGRHLLMVRWGNHDVPGSPFEIVVP 7624
            S F ++ R     G   +   V  P+  +    V ++ DGT+  +Y     G + V+V Y    VP SPF V V     P +  + GP L      +     ++T+ AG G L     GP    V  + E +  G  TV Y     G Y   + +    I  GS      + +   +  R +           ++    +     F V    D  RA           P   ++   ++   DG   + Y PS  G + L V Y GQ +  SPF   V +   +G+V   G G+S  G P  +   FTI T++AG   LS+ +  P       + +D  +G   VSYLP   G Y + + +    + GSPF    F  G+  K                        I +G  + V +   E     +   V++P   E     ++   +G   I FT  + G +++ V   G+ IPNSPF + V  + +   +R       L         Q    ++  G  GLSL++      E                    E H            DN DGT  V++ P E G + +++KY   ++P GSP  F V+    PS +     L H        +G      +      +   + +V  PS +   C+     D   S+ ++P   G ++++VK   +H+ GSP+   +   I G   +  +  S + RG  +D              SL I        E+  +D +DG C V Y   EPGDY  S++F DEH+PGSPF+L +D                +  +SR ++++ L + G+ +   A+F ++ +G   G I A V +PS   +   +S+ID +++ +  FVP ENG+H V V  + + +PGSPFR              V+  G G+  G TG   EF VDTS AG G+L V IDGPSKV+++C E   GY+F Y+P APG Y +SI YGG +HI GSP+   ++G       ++ ET S      +    ++G        K  S    V+  G GL  A +GK+N F VD G AG +VL VGV GP  PCEEV++KH G  RF V Y V+E+G +LL+V+WG+  VPGSPF + VP
Sbjct: 1153 SEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHV--AFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSV----DCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTL----WARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSH------GMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQ--DNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARI---IAG---EDSLRASLLSRGSTHDV-------------SLRIL-------ELHCEDLEDGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPFLLTVDG---------------VCEESRRVAVSGLLESGWKVNHPASFAVHLNG-AKGRIEAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTVP 2241          

HSP 4 Score: 342.043 bits (876), Expect = 1.616e-94
Identity = 292/1130 (25.84%), Postives = 496/1130 (43.89%), Query Frame = 2
Query: 3299 APLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPV-AKSPYFVPVYQGSDPSRIRAYGPGLEEGITK-----------QPQKFTVDLEGAGQGGLGLSIEGPADAQ--IQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGE-------GVRPHRGHLIANKV--PSLFTINTRDAGESDLELMVTGPNNESVNLDV-DNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGIL--------SAKNVGPVGNIVPCSIE---------------------NERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIER----TTHHYTTEQSKPIIRT-EYSVVDFKFPV-GPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICVGTTSDVPLRISE-----TDIN----NLNAIVISPTGREESCTLKRL-QNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGE-NEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYAD-SNVPGSPFAVNIGG-----------------------------------YPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTV 6370
            AP G+T EG +       DN DGT +V Y+P   G + V V Y    +  SPF V +       ++  D ++V  +GPGL   G      + F+++ +     G G+    +  P    +    + + +G ++  Y     G++   ITY G  + A SP+ VPV    +P+++R  GPGL  G++             PQ F+VD   AG   L ++ +GP   +  ++     DG  ++ Y P   G Y + +++  + +P SPF V +    D  +V+  G G+  +G     P+ FT+D  +AG+APL + ++D      + A++L     GLF V+Y+P+  G   + V Y   +VPGSPF  +   + +  K  +          GV    G   A ++  P+L  +N ++AG   +   V  P    +++DV +N  DGTF+  +    PG Y + V +G + +P SPF V V +   P       P   +    +   +   +Q  GD  L        S +++ P   +VP S+                      + R G  +VS+ P + G +E+ + +N  +IP GS  Q+     +  S+       +H    + +   I T +         V GP     +A ++C  N+          DGT +V Y P+  G + + V + GQ I GSP+     + I +G+ +     LS G           T D     +SL +      E+ C D ++G C V Y P  PGDY + ++F D+HI GSPF   + G  ++  ++ V    +   +++        +N     + A V +P+G  E+C +  + ++ ++   F P+E G H V+V   G  +P SPF++ VGE     +A+ V  +G GL  G      +FVVDT  AG G L+++I+GPSKV ++C +  +G     Y PT PG Y++++ Y    ++ GSP+   + G                                     ++S + ++  H      + +G      +             V+ PS   E   +      +F++ +  KE G + + VK  ++HV GSPF+ TV
Sbjct: 1176 APSGITTEGSV------TDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAV-------ADGCDPSRVRVHGPGLE--GGLTHRANVFSIDTRAAGCGGLGL---HVEGP--GEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGL--GLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRR-ARVL-DGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRT--SPLARRTRPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGP----SKAEISCQDNK----------DGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYM----ARIIAGEDSLRASLLSRGS----------THD-----VSLRI-----LELHCEDLEDGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSGLLESGWKVNHPASFAVHLNGAKGRIEAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFC-YLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2240          

HSP 5 Score: 316.235 bits (809), Expect = 1.196e-86
Identity = 359/1429 (25.12%), Postives = 576/1429 (40.31%), Query Frame = 2
Query: 3395 EPGSYIVNVLYNDEHIKDSPFNV-TIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGS--------YDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDA---SKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNV-PGSPFIVPVHSEAKPEQCYIEGP---------ILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSVVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPF-----------KFYVDSTIP----SGQVTAYGPG--LSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAE--IQCIDN-KNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKR---------------------SQIC--VGTTSDVPLRISETDINNLNAI-------------VISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPN-SPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIA--LSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGL-ANDANQFTIYTREAGAGSLSIAIEGPSK-------AEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQIDENPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQ----YSVHFVPVENGIHNVHVLVNN-SPIPGSPFRXXXXXXXXXXXXIHH------------------------------------GHTGRINEFFVDTSNA--------GNGALTVTIDGPSKVQLNCQE----NESGYNF--TYVPNAPGDYTISIKYGGNNHIIGSPFFVAI 7249
            E G + ++V Y+   +  SPF +  + P   S        KV  +G GL   G      ++F V+       G G+    +  P   R  C   ++ DGT S SY P   G++ ++I +    V  SP+   V    + S ++ +GPG+E+G T  P         +    L    EG  +  +     K         P +P S          VSIK   +  P  P  +     +  S  + + P    + +     S+F VDA   S+ G   ++  V+  A   +     +  +  G + V Y+P + G   +EV Y   +VP SPF   V + C+P +V V G G+     H       ++F+I+TR AG   L L V GP    V  + D   +G FT +Y    PG Y   + YG   +  GSPF VPV  E  P +    GP         ++  V  G      V+   AGD  L     GP G   P  +     G   ++Y P  +G Y + + +  +++P+           +   +  +    +       + T++++   +    P    +   +  P       R+++ GDG  +V Y P  +G + + V Y    + GSPF           K ++   +P     G  T  GPG  +  G P +     +  K+AG G ++  V  P + E  +  ++N  +GT  + +    PG Y I ++F  + I  SPF   +   P  R                     SQ C   G +  +   IS   +   + +             V  P+GR+ S  +   ++G + +SF P E G H +++  +G HIP  SP + +V E    +   V  YG GL+ GMV +   F +DT++AG GGLSL++EGPSK EI C DN DGTC V+Y PT PG Y I VK+A  ++PGSP+              RI+  +D+   S +               R +T  V     S  + E+    L D +  + + P E G + VSV+ ++ H+ GSPF  TV  + +    +V + G  +E G   N    F ++   A  G +   +  PS        +EID    KD      +   E G +  S+  +   VPGSPF +++ E  +++             D+  +S      +    GS A FV++  G   GS++  +  PS         ++D ++    Y   ++P   G++ V +       I GSP+R  V    +SG    H                                     H   ++   V   NA        G+  L V + GPS   + C+E    +  G  F  TY     G Y + +K+ G+ H+ GSPF V +
Sbjct:  916 ETGPHRMDVTYDGHPVPGSPFLMEAVLPANPS--------KVRVWGEGLR--GGEVGIPAEFCVDTTAAGVGGLGLT---VEGPCEARLEC--HDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLELTEGRGETHLMYRRPKRN-------PIQPLSPCVMCLKRMSVSIK-AVRLTPVLPTKLRARPSLLSSFHQSFKPTPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVM--APSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRA-----NVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDP--EGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAP----LSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTL---VLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEM---DGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMA------------RIIAGEDSLRASLL--------------SRGSTHDV-----SLRILELHCEDLEDGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPFLLTVDGVCEES-RRVAVSGL-LESGWKVNHPASFAVHLNGA-KGRIEAKVHTPSGSVENCFVSEID----KDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAA-------------DAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSK-------VRVDCSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPS---VPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKW-GDQHVPGSPFRVTV 2240          

HSP 6 Score: 300.442 bits (768), Expect = 8.927e-82
Identity = 360/1429 (25.19%), Postives = 564/1429 (39.47%), Query Frame = 2
Query: 3668 VDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEE-GI-TKQPQKFTVDLEGAGQGGLGLSIEGP--------ADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPG--LERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIP---------------VNTQNAGDGILSAKN--VGPVGNIVPCSIENERYGHSTVS-----YVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYS--VVDFKFPVGPVFDYVRAVVNCPSNRKDVPRLINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHII-GSPFTAKIFGEPKKRSQIC-------------VGTTSDVPLRISETDINN-----LNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETC--QFVVDTRNAGYGGLSLSIEGPSKV--EIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVN---IGGYPSSSLTER--------ILRHQDAAEVSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIA-LSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIA-----------------------------IEGPS--KAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVP-GSPFMLQIDE--NPYSSYSKPVKNENIIFNDSRYISIAALQDQGFNIGSKANFVINYHGLTDGSISAYVISPSNKEQLASISKIDNNQ--YSVHFVPVENGIHNVHVLVNNSPIPGSPF--RXXXXXXXXXXXXIHHGHTGRINEFFVDTSNAGNGALTVTIDGPSKVQLNCQENESGY-NFTYVPNAPGDYTISIKYGGNNHIIGSPFFVAISGNNYQSNDSIRETKSLTQTVHMISGSTQKGPSKPYNVKCEGDGLKVAEIGKRNEFIVDAGLAGGDVLYVGVSGPVRPCEEVNIKHLGNNRFQVNYYV-QEKGRHLLMVRWGNHDVPGSPFEIVV 7621
            + N++D T +  Y+P   G+  I + +    V  SP+ + V    D S++R  GPG+   G+   +P  FTV   GAG+  L +  E P         D++I   DN D + +V+Y P + G   + + +   H+PGSPF V +   +D+ K++  G G  LE    +        V     G   L+  ++ + T+   P    P        + +     G   ++V Y+   VPGSPF+   +    P KV V GEG+R   G  +   +P+ F ++T  AG   L L V GP      L+  +HGDGT +  Y     G Y V +L+ + +VPGSPF   V    +     + GP + +   G T   P                 T+  G+  L  +     P+  + PC +  +R   S  +      +P K+ A    L          S    +F+P              T  S P +R   S   VD +       D+VR  V  PS       + +N DGT  V+Y PS +G H +EV Y G  +  SPF+  V       +V  +GPGL  G       F+I T+ AG GGL L VEGP +A +   ++  G   V Y   +PG+Y   I +    I  GSPF   +  E       C             VG       ++   D +      L+     P G  E   + +  +G   +++TP  VG + ++V  +G+ +P+SPF + V      +A RV++ G G++   V  +    F +DTR AG   LS++I  P          D  DG   V+Y P   G Y + V Y    VPGSPF V+    G      L  R        +          QIG    + +      +   T  V++P       +++   +D  FSI F   + G + ++V+   + +  SPF      L+   P           + L     Q T  ++  G   LS+A                             +  PS  KA     DN+DG+  V++   E G +   IK+N  H+P GSP    +DE   P  +   P  +  +                   +G  A F I+     +G +S  V  PS  E    IS  DN     SV ++P   G +++ V      IPGSP+  R++ GE ++    +  G T  ++                       ++L+C++ E G     Y P  PGDY +S+++  + HI GSPF + + G   +S                +SG  + G                 ++     F V    A G +    V  P    E   +  +  +++    +V +E G H + V      VPGSPF + V
Sbjct:  704 IKNDND-TLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEI--IDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVR----VVTRGAGGRGQLEARLL-SPTRQKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLR---GGEVG--IPAEFCVDTTAAGVGGLGLTVEGPCE--ARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEK---GTTFLPPPLHSSCSLSDSHSLLELTEGRGETHLMYRRPKRNPIQPLSPCVMCLKRMSVSIKAVRLTPVLPTKLRARPSLL----------SSFHQSFKP--------------TPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAY--DAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHV----LVRTSPLARRTRPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGM-------------------VGKHAAFTIDTKDAGEGGLSLAVEGPSKAE----ISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGSTHDVSLRI--------------------LELHCEDLEDGRCRVWYCPPEPGDYEVSVRF-EDEHIPGSPFLLTVDGVCEESRRV------------AVSGLLESG----------------WKVNHPASFAVHLNGAKGRI-EAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRV 2011          

HSP 7 Score: 216.083 bits (549), Expect = 3.878e-56
Identity = 270/1144 (23.60%), Postives = 453/1144 (39.60%), Query Frame = 2
Query: 2777 GSKVRPEIIVKSPNGSRVPVKLQETNNG-FVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEY----PETETPLLISAD-YAIDNKAYNKPSIPVQ----SAKLTPVERSNVKTFSNPNKQRSNFEPNEEIIY-------------PVQRTNEKAELR--KPNV-TAYGEGLVKGV-ANTPASFIIDSTEEPPAPLGVTIEGPMEAK--IDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSR----IR-------------AYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQC---FDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTP-------SQFTVDASKAGEAPLKVNVI-DTATKSVKPAQIL-------------------PKSTPGLFD-------VTYIPENIGNCEIEVLYNNMQVP-GSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKPIIRTEYSV---VDFKFPVGPVFDYVRAVVNCPSNRKDVPRLIN-NGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDS---TIPSGQVTAYGPGLSYGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKAEIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMD-KHIIGSPFTAKI--------------------FGEPKKR---------------------------SQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFV 5791
            G  VR    V +P+G      + + ++G +   + P+  GPH V V   G  +  SP++V   D  +        P  E  L   A+ ++ID +A     + +            E      F+      S  E    I Y             PV+     A++R   P +  + G G+V  V A  P  F +D +    A L VT +GP   +  ++ +   DG  ++ Y P   G Y ++V Y  + +  SPF V +           D  +V   G G++ +GV     + FT++ +     G   +   I +P        V +  DG +S SY P V G++ + + Y    V  SP+ V  +   D S+    +R               GP ++ G   +P    V+ + AG+G +   +  P   ++      +  DGT S+ +   +PG Y ++++F  + IP SPF    H +V  S        L R      TP       +Q T  +   G+A L + +  D +T+S++P  ++                    K++P + D       V++ P   G  E+++ YN   +P GSP  Q  ++  +   V   G G+     H +  K  + FTI+T+DAGE  L L V GP+   ++   DN  DGT +  Y    PG+Y++ V +  +++PGSP++  +              I  E  +  ++    +T +    IL                E+   G   V Y P + G YEV + F DE+IP               +++             ++ + + V     F   +      + A V+ PS   +   +   + D  I  ++ P E+G+H + V  +G  + GSPF+  V        +  V+A+GPGL  G     A F + T  AG G L++A++GPSK  + C +   G     YLP APG Y + I +    HI GSP+ A++                     GEP++                            S   VG  +   +       N L   V+ P+   E   +K        +++  KE G +L+ V    +H+P SPF++ V
Sbjct: 1167 GDHVR--CAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVL-------AAYDAGRVRVSGAGVSASGVPASLPTDFTIDTRE---AGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIG---EPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPF----HVLVRTSP-------LARRTRPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPL-QFYVDEMDGPSVTAYGPGLS----HGMVGKH-AAFTIDTKDAGEGGLSLAVEGPSKAEISCQ-DNK-DGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARI--------------IAGEDSLRASLLSRGSTHDVSLRILE------------LHCEDLEDGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPF---------LLTVDGVCEESRRVAVSGLLESGWKVNHPASFAVHLNGAKGRIEAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGY-HFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2240          

HSP 8 Score: 193.356 bits (490), Expect = 3.360e-49
Identity = 283/1164 (24.31%), Postives = 458/1164 (39.35%), Query Frame = 2
Query: 1004 FTVDTF---NAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQS-SPFGVMVSSKTSNSDAKQAYATGRGIQPEG-----VRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDV-APYKESKIKAFGPGLTGGIV--SKPAFFEVETNGETGALGFSIK------GPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLD---TKLFDPLKV---------TAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQ---IRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGS----GDIGISVL------DEKMRDVPVVTD-------------------------DNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTT--------PIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVA-GFTPTVIGPHTVTVECKGNPIGNSPY--KVIATDRVNTKEYPETETPLLISADYAIDNKAYNKPSIPVQSAKLTPVERSNVKTFSNPNKQ-----RSNFE----PNEEIIYPVQRTNEKAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVN-----------YLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGL--NPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGV-PVAKSPYF--------------------------------------VPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPA--DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPI 4069
            F VD       G  ++   V+ P G      + D  N +  Y+  Y+P+  G + + + +A + +P SPF+V V +   DPS+V   GPG+E  G    R   F++ T  AG G +    L  +G  ++      +  E  F +EY     G +  ++ + G  I + SPFGV V  +  N    +    G G+   G     VR      F V    AG A L V   GP  + E  ++ +    ++  +Y P   GPY + ++Y    +  SPF VDV A Y   +++  G G++   V  S P  F ++T  E G    SI        P  A++  +D GDG  +V+Y P V G Y+V +    + +P SP+          +K F  ++V         T  GPG    I   +P   +VN K AG     K  C  +T + + +    + +  DGT+S  +T   PG + + V +G   IP SPF V V  +  A           R  T  +T +    +L  +    GD G+S+        E +R   +V                           DN DGT ++ + P   G          E +I  +   +P  S   F   +++  + T          +G+   F I T  D  +    + V+ P  S+  +  Q+  +G  +  + PT  G +++ V+  G  I  SPY  ++IA            E  L  S    +   + +  S+ +       +E    + +  P +         FE    P    +  V    E  E R+  V+   E   K   N PASF +              +G +EAK+         C V+           ++P+E G + V+V  +   +  SPF V +        +  D A V+A+GPGL    TG    S ++F V+       G G +   I  P   R  C+     +G + C Y P   G + + I Y G   +A SPY                                       +P+   SD S++ ++GPGL   +  +   FTVD   AG   L + + GP+    ++          +V Y  ++ GSY + +K+ ++H+PGSPF V +
Sbjct: 1155 FAVDARTISRCGGDHVRCAVMAPSGITTEGSVTD--NHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGC-DPSRVRVHGPGLE--GGLTHRANVFSIDTRAAGCGGLG---LHVEGPGEA-HVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEV-NPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTR-EAGDAPLSITIVDPDGFPRRARV--LDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPG--PAIQIGEPTLVLVNAKEAGR---GKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRT--------RPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKG--------LHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTK-DAGEGGLSLAVEGP--SKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIA-----------GEDSLRAS---LLSRGSTHDVSLRILELHCEDLEDGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPFLLTVDGVCE--ESRRVAVSGLLESGWK--VNHPASFAVHLN---------GAKGRIEAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRV----GEPGHAADAALVSAFGPGLERGTTG----SPAEFVVDTS---GAGPGSLAVAIDGPSKVRVDCS--EGPEGYHFC-YLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2240          

HSP 9 Score: 183.341 bits (464), Expect = 3.438e-46
Identity = 244/997 (24.47%), Postives = 405/997 (40.62%), Query Frame = 2
Query:  941 RVRAYGPGLELEGNTIGNPAPFTVDTFNAGKGNLDIIVLNPKGQKEPCEIFDSPNKELAYSCSYIPTMEGEYRIIIKFANSEI-PNSPFKVNVKNAAGDPSKVTASGPGIEPVGN-------EVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYKESKIKAF---------GPGLT--GG-----IVSKPAFFEVETN-GETGALGFSIKGPS--EAKIDCVDN-GDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQ---LDTKLFDP------------LKVTAYGPG-------LISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPE-SPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVTDDNGDGTFXXXXXXXXXXXXXXXQIFFSEAEIPQSPFKVPIESDNDFKKYKINNLNNTTPIGQLNEFEILTPFDGSKVRPEIIVKSPNGSRVPVKLQETNNGFVAGFTPTVIGPHTVTVECKGNPIGNSPYKVIATDRVNTKEYPETETPLLISADYAIDNKA-----YNKPSIPVQSAKLTP---VERSNVKTFSNPNKQRSNFEPNEEIIYPVQRTNEKA---------ELRKPN-------VTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYND-EHIKDSPFNVTIY-PDTKSSSNIDDVAK--VTAYGPGLNPTGVFKDSFS-KFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGT 3691
            RVR +GPGLE  G        F++DT  AG G L + V   +G  E    F+  + E  ++  Y     GEY   I +  + I   SPF V V++   +P+KV  SGPG+              G    F+V  + AG  ++D       G ++ V+  + +  +    + YT    G +S++V +AG  +  SPFGV V    +  DA +   +G G+   GV      +F + T +AG A L + +  P     + ++      L+  SY+P   G Y V + YG + +  SPF V      ++  K F          PG+T  GG      + +P    V       G +   +  P   E  +D V+N  DG+ ++ +  T PG Y + +    + IP SP+   ++   L  +   P            L  T+   G       +   IST     F +    +     +  E    +G+    +I DN DGT S  + P   G H + + Y   +IP  SP +  V E  +  ++  YGPG+          F +D K AG G  G+S+  E      +   DN DGT        T    Y+I + F+   IP SP+   I +  D  +  + +  +T  +       IL          E+  +     R  V            + P   G + V+V  +   I  SP+ ++  D V  +E        L+ + + +++ A      N     +++   TP   VE   V          + F P E  ++PV  T + A          + +P        V+A+G GL +G   +PA F++D++   P  L V I+GP + ++D  +  +G     YLP  PG Y+V++ Y    HI  SP+   +  P      N+ + +   V A  P     G+  +    K T ++  ++ +G G+  A++     +++  TVD    G+
Sbjct: 1234 RVRVHGPGLE--GGLTHRANVFSIDTRAAGCGGLGLHV---EGPGEAHVAFEE-DPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEV-NPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVE--VVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDV---LAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDAS-KCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEM-DGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEG--GLSLAVEGPSKAEISCQDNKDGT-CSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGSTHDV----SLRIL----------ELHCEDLEDGRCRVW-----------YCPPEPGDYEVSVRFEDEHIPGSPF-LLTVDGV-CEESRRVAVSGLLESGWKVNHPASFAVHLNGAKGRIEAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGY-HFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALV----GKQNAFTVDCGRAGS 2181          

HSP 10 Score: 174.481 bits (441), Expect = 1.632e-43
Identity = 107/319 (33.54%), Postives = 161/319 (50.47%), Query Frame = 2
Query: 3191 KAELRKPNVTAYGEGLVKGVANTPASFIIDSTEEPPAPLGVTIEGPMEAKI------DYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDN-NHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERN 4126
            K  +  P + A G    K     PA F + +     A L V  E P           + IDN D + +V Y P + G   + V Y  +H+  SPF VT+ P         D+ K+   G G       +      T  A      G+G ++A + +P  Q+  C+ +   H   +S  ++    G H++D+TYDG PV  SP+ +     ++PS++R +G GL  G    P +F VD   AG GGLGL++EGP +A+++C D+ DGTCSV YLP + G Y V+I F + H+PGSPFT  +   V+ S V+ +GPG+E+ 
Sbjct:  751 KVRVEGPGINATGVEAAK-----PAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPL-------DLGKIRVEGLGTKLEMGCEQEVRVVTRGA-----GGRGQLEARLLSPTRQKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKG 1052          

HSP 11 Score: 159.844 bits (403), Expect = 5.027e-39
Identity = 111/341 (32.55%), Postives = 176/341 (51.61%), Query Frame = 2
Query: 5132 LINNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTIPSGQVTAYGPGLS-----YGRPDMHAHFTIVTKDAGAGGLSLAVEGPSKA------EIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKIFGEPKKRSQICV---GTTSDV----PLRISETDI---NNLNAIVISPTGREESCTLK----RLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEI-GNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNI 6076
            +I N + T+TV+Y P  +G   + VF++ Q +  SPF   V  +  + +V   GPG++       +P   AHFT+ T+ AG   L +  E P         + + IDN + +  V Y P   G   +G+ +   H+ GSPF   +   P    +I V   GT  ++     +R+          L A ++SPT ++  C+ +     +++  L   FT  E G H ++V   G  +P SPF +   E  +  N S+V+++G+GL  G V    +F VDT  AG GGL L++EGP +  +ECHD+ DGTC V+Y P + G Y +N+ +AD++VPGSPF   +
Sbjct:  703 IIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVEAAKP---AHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTV-APPLDLGKIRVEGLGTKLEMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPPGHAVEHSLL---FTLLETGPHRMDVTYDGHPVPGSPFLM---EAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVV 1033          

HSP 12 Score: 146.747 bits (369), Expect = 4.671e-35
Identity = 107/354 (30.23%), Postives = 172/354 (48.59%), Query Frame = 2
Query: 1130 YIPTMEGEYRIIIKFANSEIPNSPFKVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTK--GRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAG-FADLGVNVYGPGRSLEKCQIKKVSPCL-YECSYIPQRPGPYVVDIKYGNNPIHLSPFNVD-VAPYKESKIKAFGPGLTGGIVSKPAFFEVETNGE-TGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKP 2173
            Y P   G + I++ F+  E+ +SPF ++V  +  D SKV   GPGI   G E  +   F V+T  AG   +D    D +       +  +I    +  + ++YT  ++G   + V + G  +  SPF V V+      D  +    G G + E   +    E +V T  AG    L   +  P R    C  +     + +   +     GP+ +D+ Y  +P+  SPF ++ V P   SK++ +G GL GG V  PA F V+T     G LG +++GP EA+++C D+GDG+ +V+Y P   GEYAV+IL  D ++P SP+ A ++   +      V  +GPG+  G +   P
Sbjct:  715 YTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSH-DASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPL---DLGKIRVEGLGTKLE---MGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSG---VQVFGPGVEKGTTFLPP 1058          

HSP 13 Score: 136.346 bits (342), Expect = 7.280e-32
Identity = 124/420 (29.52%), Postives = 184/420 (43.81%), Query Frame = 2
Query: 1190 PNSPF--KVNVKNAAGDPSKVTASGPGIEPVGNEVGRRTFFNVFTAEAGPGSVDCVILDTKGRKDSVKPKITKQSENKFLIEYTTKEEGLHSVNVFFAGVQIQSSPFGVMVSSKTSNSDAKQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGV----NVYGPG--RSLEKCQIKKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVA-PYKESKIKAFGPGLT--GGIVSKPAFFEVET-NGETGALGFSIKGP-SEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLISGISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIR----DNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEA 2398
            P +P   K+N KNA        A GPG+E VGN V R   F V T  AG G V   + D +G K+  +       +  F+  Y  +  G H V V FAG  I  SPF V+V+    + DA +  A G G++P G        F + T   G           V  P   R   +  +++    +  C+Y P  PGP++V + Y    +  SPF+V++         +A G GL   G  V   A F V T    +G L   ++ P  E  +   + G+G     Y P   G + + I    ++IP+SP+   +  +     P KV A+GPGL +G++  + ADF+V        + V    F + G   P Q R    D  DG+   RY P  PG + V V     ++  SPF  +++ A
Sbjct:  147 PGAPLRPKLNPKNA-------HAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPP--HGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEA---GPQKVRAWGPGLETGMA-GRSADFVVEAIG----TDVGTLGFSIEG---PSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPA 546          

HSP 14 Score: 135.961 bits (341), Expect = 7.656e-32
Identity = 116/380 (30.53%), Postives = 175/380 (46.05%), Query Frame = 2
Query: 5597 ISETDINNLNAIVI---SPTG-REESCTLKR--LQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGL--NDGMVNETCQFVVDTRNAGYGGLSL----SIEGPS----KVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIG-----GYPSSS---LTERILRHQDAAE---VSQIGNVCELNLIIPGYNQRNTTASVISPSGSFEMCEIIALSDNQFSIRFMPKELGVHTVSVKSDNRHVTGSPFQFTVGPLIDGGPHKVHIMGSGVERGLANDANQFTIYTREAGAGSLSIAIEGPSKAEIDFQDNKDGSCGVTYRVNEPGDYVCSIKFNDEHVPGSPFMLQI 6655
            + ET+   L  +++    P G +EE+    R   Q  ++ + + P+  G H V VL +G+HI  SPF + V     G+A +V   G G+  +  +  +   F + T   G G        ++  P      VE+      D     TY+P  PG +I++V YA + VP SPF+VNIG     G   +S   L  R +R  DAA    +++     ELN+++     RN       P G   M     + +      + P  LG H +++    +H+  SPF+  V    + GP KV   G G+E G+A  +  F +       G+L  +IEGPS+A I   D  DGSC V Y   EPGDY   +  ++E V  SPFM  I
Sbjct:  181 VVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAV-YRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH-GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLL-----RN-------PRGEEPM-RHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVS--AEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHI 543          

HSP 15 Score: 135.576 bits (340), Expect = 1.090e-31
Identity = 108/375 (28.80%), Postives = 165/375 (44.00%), Query Frame = 2
Query: 5084 VRAVVNCPSNRKDVPRLI--NNGDGTITVQYQPSESGLHELEVFYNGQPITGSPFKFYVDSTI-PSGQVTAYGPGL--SYGRPDMHAHFTIVTKDAGAGGLS-------LAVEGPSKA-EIQCIDNKNGTCDVSYLPLAPGDYHIGIKFMDKHIIGSPFTAKI-----------FGEPKKRSQICVGTTSDVPLRISETDINNLNAIVISPTGREESCTLKRLQNGYLGISFTPKEVGEHLVNVLRSGRHIPNSPFKIFVGENEIGNASRVKLYGDGLNDGMVNETCQFVVDTRNAGYGGLSLSIEGPSKVEIECHDNHDGTCLVTYKPTEPGTYIINVKYADSNVPGSPFAVNIGGYPSSSLTERILRHQDAAE 6136
            V   V  P   K+  R+   N+   +    Y+P  +G H++ V + GQ I  SPF   V      +G+VTA GPG+  S        +F I T   GAG          L   G   A E+     ++     +Y PL PG + + + +    +  SPF+  I            G   +   + VG  +   +   +     LN ++ +P G EE    + +  G     + P  +G H++ +   G+HIP SPF++ V         +V+ +G GL  GM   +  FVV+      G L  SIEGPS+  I C D  DG+C V Y PTEPG Y ++V   + +V  SPF  +I         ER+ RH+ +A+
Sbjct:  192 VLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRG-EEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAE--AGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV-RHRPSAK 562          

HSP 16 Score: 128.257 bits (321), Expect = 1.811e-29
Identity = 105/370 (28.38%), Postives = 165/370 (44.59%), Query Frame = 2
Query: 3332 EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVD----NNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPG--LEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTC---SVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGV 4414
            +   D I N + T +V Y P   G + + V ++++ ++DSPF + + P         D +KV   GPG+N TGV     + FTV  +     GK  +     +P    +   +D    +NHD +Y+  Y+P   G   + +TY G  V  SP+ V V    D  +IR  G G  LE G  ++ +  T    G GQ  L   +  P   ++ C     G     S+ +   + G + + + ++   +PGSPF +      + SKV+ +G GL   G  V  P++F VD + AG   L + V       ++          G   V+Y+P   G   + +L+ +  VPGSPF   V  S E   V V G GV
Sbjct:  698 DVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPS-------HDASKVRVEGPGINATGVEAAKPAHFTVYTR---GAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVRVVTRGAGGRGQ--LEARLLSPTRQKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGL--RGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLE----CHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGV 1049          

HSP 17 Score: 124.405 bits (311), Expect = 2.761e-28
Identity = 79/236 (33.47%), Postives = 113/236 (47.88%), Query Frame = 2
Query: 3362 DGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTVNAKPIDFNGKGIVKAIITNPFNQRSTCTVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITKQPQKFTVDLEGAGQGGLGLSIEGPADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPI 4069
            D      Y P  PG +IV+V Y    +  SPF+V I           +     A G GL   GV     + F V  K     G G +  ++ NP  +      +   +G +   Y P   G H I IT+ G  + +SP+ V V   + P ++RA+GPGLE G+  +   F V+  G   G LG SIEGP+ A+I C D  DG+C V+Y+P +PG Y V +  +E+ +  SPF   I
Sbjct:  319 DAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNI-------GEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQ---AGSGELNVLLRNPRGEEPMRHREVG-EGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHI 543          

HSP 18 Score: 123.25 bits (308), Expect = 6.565e-28
Identity = 113/417 (27.10%), Postives = 182/417 (43.65%), Query Frame = 2
Query: 3191 KAELRKPNVTAYGEGLVKGVANT---PASFIIDSTEEPPAPLGVTIEGPM----EAKIDYIDNGDGTCSVNYLPKEPGSYIVNVLYNDEHIKDSPFNVTIYPDTKSSSNIDDVAKVTAYGPGLNPTGVFKDSFSKFTV-NAKPIDFNGKGIVKAIITNPFNQRSTC--TVDNNHDGTYSCSYSPAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEEGITK--QPQKFTVDLEGAGQGGLGLSIEGP-ADAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTVPIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTVDASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVL---NSCEPEKV 4393
            + +L   N  A+G G V+ V N+    A F++++       + V +E P     EA++   ++   +    Y P+  G + V VL+  +HI  SPF V + P         D  KVTA GPG+ P+G      + F +  A      G G V   + +P  +R     T++   D    C+Y P V G H + + Y G  V  SP+ V + +  +P   RA G GL+    +      F V  + AG G L + +  P  +  ++  +  +G    +Y P   G + ++I +  KHIP SPF V +       KV+ +GPGLE         + F V+A       L  ++   +   +           G  DV Y+P   G+  + VL +   V  SPF+ ++L     C PE+V
Sbjct:  152 RPKLNPKNAHAFGPG-VEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH------GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETG--MAGRSADFVVEAIGTDVGTLGFSIEGPSQARIA----CDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV 555          

HSP 19 Score: 121.324 bits (303), Expect = 2.148e-27
Identity = 117/450 (26.00%), Postives = 193/450 (42.89%), Query Frame = 2
Query: 3710 PAVDGQHKIDITYDGVPVAKSPYFVPVYQGSDPSRIRAYGPGLEE--GITKQPQKFTVDLEGAGQGGLGLSIEGPA----DAQIQCFDNKDGTCSVQYLPQKPGSYDVSIKFNEKHIPGSPFTV---PIHDIVDVSKVKCYGPGLERNGSRVFTPSQFTV----DASKAGEAPLKVNVIDTATKSVKPAQILPKSTPGLFDVTYIPENIGNCEIEVLYNNMQVPGSPFVQNVLNSCEPEKVIVTGEGVRPHRGHLIANKVPSLFTINTRDAGESDLELMVTGPNNESVNLDVDNHGDGTFTCQYKHDVPGNYTVKVLYGNKNVPGSPFIVPVHSEAKPEQCYIEGPILNEVPVGKTVTIPVNTQNAGDGILSAKNVGPVGNIVPCSIENERYGHSTVSYVPQKIGAYEVQLMFNDENIPNGSIRQYAFQPQEQYSIERTTHHYTTEQSKP 5020
            P VD +H +       P AK     P+    +P    A+GPG+E      ++  +F V+ E AG G + + +E P     +A++   ++K  +    Y P+  G + V++ F  +HI  SPF V   P H   D  KV   GPG+E +G+     + F +    D + AG   + V V+D   +       L +    +   TY P   G   + V Y    VP SPF  N+  +C P     +G G++  RG  + +   + F + T+ AG  +L +++  P  E   +     G+G    +YK    G + + + +G K++P SPF V V +EA P++    GP L     G++    V       G L     GP    + C    +  G   V YVP + G Y V ++ ++E++       +          ER  H  + +   P
Sbjct:  126 PNVD-EHSVMTYLSQFPKAKLKPGAPLRPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHG--DAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQ-SRGVRVGDA--AGFRVLTKQAGSGELNVLLRNPRGEE-PMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGD--GSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVRHRPSAKPPLP 566          

HSP 20 Score: 116.701 bits (291), Expect = 5.750e-26
Identity = 105/373 (28.15%), Postives = 163/373 (43.70%), Query Frame = 2
Query: 1544 KQAYATGRGIQPEGVRVRDVAEFQVHTEDAGFADLGVNVYGPGRSLEKCQI-----KKVSPCLYECSYIPQRPGPYVVDIKYGNNPIHLSPFNVDVAPYK--ESKIKAFGPGL--TGGIVSKPAFFEVET-------------------NGETGALGFSIKGPSEAKIDCVDNGDGSANVTYWPTVPGEYAVHILCDDENIPKSPYMAQIQLDTKLFDPLKVTAYGPGLIS-GISTNKPADFIVNTKNAGSPSTVKAECFDVTGQTIPVQIRDNNDGTYSCRYTPKIPGKHTVIVSYGNVNIPESPFKVNVIEAGNAANIKVYGPGIERAKTNIETYFVVDCKLAGSGDIGISVLDEKMRDVPVVT