C2 domain

Overview
NameC2 domain
Smed IDSMED30023103
Length (bp)1787
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2 domain (SMED30023103) t-SNE clustered cells

Violin plots show distribution of expression levels for C2 domain (SMED30023103) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2 domain (SMED30023103) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2 domain (SMED30023103) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023103

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023103SMESG000063814.1 SmedASXL_013559SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30023103SMESG000063814.1 dd_Smed_v4_10352_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2 domain vs. TrEMBL
Match: A0A0X3PUM6 (C2 domain (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR102387 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 8.229e-21
Identity = 59/151 (39.07%), Postives = 89/151 (58.94%), Query Frame = 3
Query:  114 GNSIKKVMVQILRADNLIS--ANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDE--PKNSR 554
            G   K V V++ RA  L++   + KK  K +KWRV + + KKK+ SD V   AG P W+ EV +K+ K   EP+ + + DS     GQVIIP+ KI  +P    +  + P +L   ELEPT+K  N  G+L+Y ++A +FY ++  PK+S+
Sbjct:   21 GRVPKTVSVRVQRASGLVNPYVDGKKKGKTLKWRVAVKAGKKKLESDSVVDSAGNPSWDFEVTLKIAKID-EPVAIKVTDSDGRHIGQVIIPLIKIPPRPADPCKRPSSPSRLCVAELEPTRKISNVTGTLYYWVWAEDFYDEDGPPKSSK 170          
BLAST of C2 domain vs. TrEMBL
Match: A0A1S8X6E0 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01876 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 3.986e-19
Identity = 48/120 (40.00%), Postives = 74/120 (61.67%), Query Frame = 3
Query:  201 KWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQ--DEPKNSR 554
            KW+V  +  KKK+ S  +   AG P W+ EV  K V  + EPI +++ DS  +  GQV+IP+  +  +P  +SE  T+P +L+  +LEPTKK  NP+G+L+Y ++  E+    DE K+SR
Sbjct:   70 KWKVVFLGGKKKMSSGSILAPAGNPVWDYEVTFK-VAARGEPISLLVTDSEDHHVGQVVIPVTAMPPRPANSSERPTDPSRLRVADLEPTKKVENPIGTLYYWVWVEEYRAEDDEKKSSR 188          
BLAST of C2 domain vs. TrEMBL
Match: A0A5J4NA89 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0008740 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.113e-17
Identity = 55/154 (35.71%), Postives = 88/154 (57.14%), Query Frame = 3
Query:  102 MNDEGNSIKKVMVQILRADNL-ISANDKKMKKPI-KWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQ-DEPKNSR 554
            M   G   K V V++ +A++L I   D K KK   KW+V+ +  K+   +  V   AG P W+ EV +K V  +  P+V+++ DS  +  GQV+IP   +  +P  + E  T+  +L+  +LEPTKK  NPLG+L+Y ++  E+   D+ K+SR
Sbjct:    1 MALAGGVPKIVSVRVQKAEHLRIVPKDGKQKKITQKWKVQFLGFKESAHTKPVLAPAGNPVWDYEVTLK-VAVRGGPVVLLVTDSEDHHVGQVVIPASSMPPRPTNSYERPTDASRLRVSDLEPTKKVSNPLGTLYYWVWVEEYRAVDDVKSSR 153          
BLAST of C2 domain vs. TrEMBL
Match: A0A2H1CB78 (C2 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_08957 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.988e-17
Identity = 61/191 (31.94%), Postives = 98/191 (51.31%), Query Frame = 3
Query:  132 VMVQILRADNLISANDKKMKKPI-KWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDSEKIPKRLSIFK 701
            V V+      +I  +D K KK   KW+V  +  KKK+ +  V    G P W+ EV  KL  ++ +P+V+++ DS  +  GQV++P+  I  +P    E  T+  +L+  +LEPTKK  +P G L+Y I+  E Y+ E  +S+ +    LSI  SK     +   S    GS + +     +K  K+  +FK
Sbjct:   14 VRVKCAEGLKIIPKSDHKQKKLTQKWKVHFVGGKKKMSTSSVLDTYGNPQWDYEVTFKLA-SKSDPVVLLVTDSEDHHVGQVVVPLVTIPPRPPNVVERPTDSNRLRRADLEPTKKVASPHGMLYYWIWVEE-YRSEESDSKSSRGSMLSISSSKNKRASSVADSLNYSGSVISVGSAQGDKKEKKHHLFK 202          
BLAST of C2 domain vs. TrEMBL
Match: A0A074ZQ02 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_07149 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.052e-16
Identity = 56/148 (37.84%), Postives = 88/148 (59.46%), Query Frame = 3
Query:  126 KKVMVQILRADNL---ISANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFY--QDEPKNSR 554
            K V V++ +A+ L     A+ K+ K   KW+V  +  KKK+ S  +   AG P W+ EV  K V  + EPI +++ DS  +  GQV+IP+  +  +P  +SE  T+P +L+  +LEPTKK  NP+G+L+Y ++  E+    DE K+SR
Sbjct:   10 KIVSVRVQKAERLRIIPKADGKQRKYTQKWKVVFLGGKKKMSSGSILAPAGNPVWDYEVTFK-VAARGEPISLLVTDSEDHHVGQVVIPVTAMPPRPANSSERPTDPSRLRVADLEPTKKVENPIGTLYYWVWVEEYRAEDDEKKSSR 156          
BLAST of C2 domain vs. Planmine SMEST
Match: SMESG000063814.1 (SMESG000063814.1)

HSP 1 Score: 1082.78 bits (2799), Expect = 0.000e+0
Identity = 541/542 (99.82%), Postives = 541/542 (99.82%), Query Frame = 3
Query:  102 MNDEGNSIKKVMVQILRADNLISANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDSEKIPKRLSIFKSNEKSTKYNQTRSKAKSLANIHVIEDVDQSMSSDSDCENRHYMPPDDIYNEVIRNHGWVRVEDLAXXXXXXXXXXXXXHEIEHEKVDLFSVQPDNGPMTGNFSVVMEGSNFKSGLFELTYICIDGLEPVDATTCTKILSDTELLLVMPSVSSPGPVNIHLELLDGSKVHCSKTFHYFDPTVDSMLDNVMTPREFVSKQKNNSVSIDDELDDSVSLPRESYRPQQSEIGVTPENITDNFNIHDRRKLSDYGSQGSFRSDRTSSIRRKVKKSNLSKMELHEEVECLRKEVSELRVQIKEIESTTSVQILTLKYQLESRETEIDNISRTLCNLKMQLLEDGLTKY 1727
            MNDEGNSIKKVMVQILRADNLISANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDSEKIPKRLSIFKSNEKSTKYNQTRSKAKSLANIHVIEDVDQSMSSDSDCENRHYMPPDDIYNEVIRNHGWVRVEDLANDNNKFNFDSFSSHEIEHEKVDLFSVQPDNGPMTGNFSVVMEGSNFKSGLFELTYICIDGLEPVDATTCTKILSDTELLLVMPSVSSPGPVNIHLELLDGSKVHCSKTFHYFDPTVDSMLDNVMTPREFVSKQKNNSVSIDDELDDSVSLPRE YRPQQSEIGVTPENITDNFNIHDRRKLSDYGSQGSFRSDRTSSIRRKVKKSNLSKMELHEEVECLRKEVSELRVQIKEIESTTSVQILTLKYQLESRETEIDNISRTLCNLKMQLLEDGLTKY
Sbjct:    1 MNDEGNSIKKVMVQILRADNLISANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDSEKIPKRLSIFKSNEKSTKYNQTRSKAKSLANIHVIEDVDQSMSSDSDCENRHYMPPDDIYNEVIRNHGWVRVEDLANDNNKFNFDSFSSHEIEHEKVDLFSVQPDNGPMTGNFSVVMEGSNFKSGLFELTYICIDGLEPVDATTCTKILSDTELLLVMPSVSSPGPVNIHLELLDGSKVHCSKTFHYFDPTVDSMLDNVMTPREFVSKQKNNSVSIDDELDDSVSLPREGYRPQQSEIGVTPENITDNFNIHDRRKLSDYGSQGSFRSDRTSSIRRKVKKSNLSKMELHEEVECLRKEVSELRVQIKEIESTTSVQILTLKYQLESRETEIDNISRTLCNLKMQLLEDGLTKY 542          
BLAST of C2 domain vs. Planmine SMEST
Match: SMESG000063814.1 (SMESG000063814.1)

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 299/299 (100.00%), Postives = 299/299 (100.00%), Query Frame = 3
Query:  102 MNDEGNSIKKVMVQILRADNLISANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDSEKIPKRLSIFKSNEKSTKYNQTRSKAKSLANIHVIEDVDQSMSSDSDCENRHYMPPDDIYNEVIRNHGWVRVEDLAXXXXXXXXXXXXXHEIEHEKVDLFSVQPDNGPMT 998
            MNDEGNSIKKVMVQILRADNLISANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDSEKIPKRLSIFKSNEKSTKYNQTRSKAKSLANIHVIEDVDQSMSSDSDCENRHYMPPDDIYNEVIRNHGWVRVEDLANDNNKFNFDSFSSHEIEHEKVDLFSVQPDNGPMT
Sbjct:    1 MNDEGNSIKKVMVQILRADNLISANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDSEKIPKRLSIFKSNEKSTKYNQTRSKAKSLANIHVIEDVDQSMSSDSDCENRHYMPPDDIYNEVIRNHGWVRVEDLANDNNKFNFDSFSSHEIEHEKVDLFSVQPDNGPMT 299          

HSP 2 Score: 320.857 bits (821), Expect = 2.163e-103
Identity = 161/164 (98.17%), Postives = 161/164 (98.17%), Query Frame = 3
Query: 1236 PTVDSMLDNVMTPREFVSKQKNNSVSIDDELDDSVSLPRESYRPQQSEIGVTPENITDNFNIHDRRKLSDYGSQGSFRSDRTSSIRRKVKKSNLSKMELHEEVECLRKEVSELRVQIKEIESTTSVQILTLKYQLESRETEIDNISRTLCNLKMQLLEDGLTKY 1727
            P  DSMLDNVMTPREFVSKQKNNSVSIDDELDDSVSLPRE YRPQQSEIGVTPENITDNFNIHDRRKLSDYGSQGSFRSDRTSSIRRKVKKSNLSKMELHEEVECLRKEVSELRVQIKEIESTTSVQILTLKYQLESRETEIDNISRTLCNLKMQLLEDGLTKY
Sbjct:  297 PMTDSMLDNVMTPREFVSKQKNNSVSIDDELDDSVSLPREGYRPQQSEIGVTPENITDNFNIHDRRKLSDYGSQGSFRSDRTSSIRRKVKKSNLSKMELHEEVECLRKEVSELRVQIKEIESTTSVQILTLKYQLESRETEIDNISRTLCNLKMQLLEDGLTKY 460          
BLAST of C2 domain vs. Planmine SMEST
Match: SMESG000068709.1 (SMESG000068709.1)

HSP 1 Score: 89.7373 bits (221), Expect = 9.644e-19
Identity = 61/184 (33.15%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  126 KKVMVQILRADNLI-SANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMA--NSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDS 668
            +K+ +++ +A+ L  +  + K K   K++V I+  K K  S  V    G   W     IKL K Q +P+V+++ DS  N  GQVIIPI KI  KP     S+  +    + C ELEPT KC NP G L Y ++  E++ +E    R       S+FGSK  +  ++  + LEI ++  +  + S
Sbjct:   11 RKISIKVAKAEKLKETKKEGKNKICNKFKVHILGGKNKESSPTVMSSNGNVQWLFSCMIKLHKTQNDPLVLLVEDSDGNHKGQVIIPIVKIPNKPYTYNASQEPSNSTNILCSELEPTNKCNNPSGFLLYWVWVEEYFTEEQLGKRSFNKSMGSLFGSKSKLGSSK--TNLEIKNRESLGTFGS 192          
BLAST of C2 domain vs. Planmine SMEST
Match: SMESG000068709.1 (SMESG000068709.1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.498e-18
Identity = 61/184 (33.15%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  126 KKVMVQILRADNLI-SANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMA--NSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDS 668
            +K+ +++ +A+ L  +  + K K   K++V I+  K K  S  V    G   W     IKL K Q +P+V+++ DS  N  GQVIIPI KI  KP     S+  +    + C ELEPT KC NP G L Y ++  E++ +E    R       S+FGSK  +  ++  + LEI ++  +  + S
Sbjct:   11 RKISIKVAKAEKLKETKKEGKNKICNKFKVHILGGKNKESSPTVMSSNGNVQWLFSCMIKLHKTQNDPLVLLVEDSDGNHKGQVIIPIVKIPNKPYTYNASQEPSNSTNILCSELEPTNKCNNPSGFLLYWVWVEEYFTEEQLGKRSFNKSMGSLFGSKSKLGSSK--TNLEIKNRESLGTFGS 192          
BLAST of C2 domain vs. Planmine SMEST
Match: SMESG000068709.1 (SMESG000068709.1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.107e-18
Identity = 61/184 (33.15%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  126 KKVMVQILRADNLI-SANDKKMKKPIKWRVEIISNKKKILSDFVTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQLKPMA--NSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNSRLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDS 668
            +K+ +++ +A+ L  +  + K K   K++V I+  K K  S  V    G   W     IKL K Q +P+V+++ DS  N  GQVIIPI KI  KP     S+  +    + C ELEPT KC NP G L Y ++  E++ +E    R       S+FGSK  +  ++  + LEI ++  +  + S
Sbjct:   11 RKISIKVAKAEKLKETKKEGKNKICNKFKVHILGGKNKESSPTVMSSNGNVQWLFSCMIKLHKTQNDPLVLLVEDSDGNHKGQVIIPIVKIPNKPYTYNASQEPSNSTNILCSELEPTNKCNNPSGFLLYWVWVEEYFTEEQLGKRSFNKSMGSLFGSKSKLGSSK--TNLEIKNRESLGTFGS 192          
The following BLAST results are available for this feature:
BLAST of C2 domain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PUM68.229e-2139.07C2 domain (Fragment) OS=Schistocephalus solidus OX... [more]
A0A1S8X6E03.986e-1940.00Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A5J4NA891.113e-1735.71Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A2H1CB781.988e-1731.94C2 domain-containing protein OS=Fasciola hepatica ... [more]
A0A074ZQ022.052e-1637.84Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of C2 domain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063814.10.000e+099.82SMESG000063814.1[more]
SMESG000063814.12.163e-103100.00SMESG000063814.1[more]
SMESG000068709.19.644e-1933.15SMESG000068709.1[more]
SMESG000068709.11.498e-1833.15SMESG000068709.1[more]
SMESG000068709.12.107e-1833.15SMESG000068709.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023103 ID=SMED30023103|Name=C2 domain|organism=Schmidtea mediterranea sexual|type=transcript|length=1787bp
ATTGAAATTATGCCATAATTAATTTTATGATTCAACTTAAAATATAATTC
ACACTAAAGTTTTTTTAAAAATTCAGTTTCGTTAAATTTCCAAACATAAC
AATGAATGATGAAGGGAATAGTATAAAAAAAGTTATGGTTCAAATTTTAA
GGGCCGATAATCTTATAAGTGCAAACGATAAAAAAATGAAAAAACCAATT
AAATGGCGAGTAGAAATTATAAGCAACAAGAAAAAAATTTTATCAGACTT
TGTGACATGCTTTGCTGGACAACCTTATTGGAATAATGAAGTTGAAATTA
AATTAGTAAAAAATCAAATTGAACCAATTGTTATGATCATTGTCGATTCA
TCTCACAATCAATACGGACAGGTTATAATACCGATTTGTAAAATACAATT
GAAACCGATGGCGAACAGTGAGAATGGTACCGAACCATTGCAATTACAAT
GTTGTGAACTGGAACCGACAAAGAAGTGCTTTAACCCATTAGGGAGTCTT
TTTTATCGAATATTTGCCACTGAATTCTATCAAGACGAACCAAAAAATTC
CAGGTTAAATTACGCCAAACGACTTTCAATTTTTGGATCAAAACCGGATA
TTAAGCCAAATAGAAAACAATCGTGCCTGGAAATAGGATCTCAAGTAAAA
ATTAACCACTATGATAGTGAGAAAATTCCAAAGAGATTGAGTATTTTCAA
GTCAAATGAGAAGTCAACAAAATATAATCAGACACGTTCAAAAGCCAAAT
CCCTGGCGAACATACATGTAATTGAAGATGTTGATCAGAGCATGTCGTCG
GATTCCGATTGCGAAAACCGACACTACATGCCTCCAGATGACATCTACAA
TGAAGTAATTCGCAACCACGGCTGGGTGCGTGTGGAAGACCTTGCCAATG
ACAATAACAAGTTCAATTTCGATTCGTTCAGTTCTCATGAGATTGAACAC
GAAAAGGTTGATTTATTTTCTGTTCAGCCGGACAATGGACCAATGACCGG
AAACTTTTCCGTTGTTATGGAAGGTAGCAATTTTAAATCTGGTCTTTTTG
AATTGACATACATATGCATTGATGGACTGGAACCGGTAGATGCCACAACA
TGCACAAAAATCCTTTCCGATACCGAGTTATTGTTGGTAATGCCATCGGT
GTCTTCTCCCGGGCCGGTTAATATCCACCTTGAGCTTCTTGATGGTTCAA
AAGTACATTGTTCTAAAACCTTTCACTATTTCGATCCTACTGTTGATTCA
ATGTTAGACAATGTAATGACTCCTAGAGAGTTTGTCAGTAAACAAAAAAA
CAATTCAGTGTCAATTGATGATGAGCTAGATGACTCTGTATCTTTGCCAA
GGGAGAGCTACAGGCCACAGCAATCGGAAATCGGAGTTACGCCAGAAAAT
ATAACGGATAATTTTAATATTCACGACAGGCGAAAATTAAGTGATTATGG
AAGTCAAGGATCATTTCGAAGTGATCGAACTTCAAGCATACGACGGAAAG
TGAAAAAATCAAACCTATCGAAAATGGAGTTGCATGAAGAAGTGGAATGC
CTTCGAAAAGAAGTTTCAGAATTGAGAGTGCAGATCAAAGAAATAGAATC
AACGACAAGCGTCCAAATTCTAACTCTCAAATACCAACTCGAGTCTAGGG
AGACCGAAATTGATAACATATCTCGTACTTTGTGTAATCTAAAAATGCAA
CTTCTCGAGGACGGATTAACGAAATATTTAGAATTAATCTAATTTTTTCT
TTTTTTTATATTGCACTCGATTTTGAGATATAACGCC
back to top

protein sequence of SMED30023103-orf-1

>SMED30023103-orf-1 ID=SMED30023103-orf-1|Name=SMED30023103-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=547bp
MNDEGNSIKKVMVQILRADNLISANDKKMKKPIKWRVEIISNKKKILSDF
VTCFAGQPYWNNEVEIKLVKNQIEPIVMIIVDSSHNQYGQVIIPICKIQL
KPMANSENGTEPLQLQCCELEPTKKCFNPLGSLFYRIFATEFYQDEPKNS
RLNYAKRLSIFGSKPDIKPNRKQSCLEIGSQVKINHYDSEKIPKRLSIFK
SNEKSTKYNQTRSKAKSLANIHVIEDVDQSMSSDSDCENRHYMPPDDIYN
EVIRNHGWVRVEDLANDNNKFNFDSFSSHEIEHEKVDLFSVQPDNGPMTG
NFSVVMEGSNFKSGLFELTYICIDGLEPVDATTCTKILSDTELLLVMPSV
SSPGPVNIHLELLDGSKVHCSKTFHYFDPTVDSMLDNVMTPREFVSKQKN
NSVSIDDELDDSVSLPRESYRPQQSEIGVTPENITDNFNIHDRRKLSDYG
SQGSFRSDRTSSIRRKVKKSNLSKMELHEEVECLRKEVSELRVQIKEIES
TTSVQILTLKYQLESRETEIDNISRTLCNLKMQLLEDGLTKYLELI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 474..501
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 406..429
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 9..102
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 282..380
e-value: 1.2E-8
score: 36.9