Bcl2-like protein

Overview
NameBcl2-like protein
Smed IDSMED30023094
Length (bp)804
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bcl2-like protein (SMED30023094) t-SNE clustered cells

Violin plots show distribution of expression levels for Bcl2-like protein (SMED30023094) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Bcl2-like protein vs. TrEMBL
Match: C9WPR4 (Bcl2-like protein OS=Schmidtea mediterranea OX=79327 GN=bcl2-1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.431e-11
Identity = 46/145 (31.72%), Postives = 82/145 (56.55%), Query Frame = 2
Query:  335 LLNGLI-----------SNEEKDEIIKSILMLMKLAEKMTKGHQIDYNSILKLSSIELKRKSFKKVFEMLFDHQMKWSRILMGFLYMKHMLLQSGSDFENYFQWSVEII--------EDNGDWQVLI*ISTKSRKSIETVEKVMK 712
            LLNGL+            N   D+I++ +  L+  A+   K    +++SIL   + + K++SF  V E LF+  ++WSR+++ F+Y+  +L  S ++++ YF+WSVE+I         +NG W+ ++ IS K+R  +E V + MK
Sbjct:   20 LLNGLVKLAGIDQQLNDRNCLNDDIVQCLHSLVVEAQDRGKDTISNFSSILNKPTDDDKKQSFYIVVESLFNDCIRWSRVIVAFMYIIQVLKISKNEYKKYFEWSVELILTKIYPWVRENGGWEQIVQIS-KNRNHLEEVTETMK 163          
BLAST of Bcl2-like protein vs. Planmine SMEST
Match: SMESG000004697.1 (SMESG000004697.1)

HSP 1 Score: 109.768 bits (273), Expect = 7.101e-27
Identity = 56/150 (37.33%), Postives = 92/150 (61.33%), Query Frame = 2
Query:  350 ISNEEKDEIIKSILMLMKLAEKMTKGHQIDYNSILKLSSIELKRKSFKKVFEMLFDHQMKWSRILMGFLYMKHMLLQSGSDFENYFQWSVEII--------EDNGDWQVLI*ISTKSRKS---IETVEKVMKLTIGFGFVYIFYRTCRKI 766
            I   E+D+IIK++  ++   EK+ +    DY  IL L+++E K+ SF+ +F  +FD   KW RI++  +YMKH++L+SGSD+ENYFQW +E+I        E NG W  +I +S ++++S   IE  + ++KL  G   +Y+    C K+
Sbjct:  806 IPIREEDDIIKNMKFMVNRTEKIVEDIPFDYEKILNLTTLEKKKNSFQSIFSYMFDENNKWMRIIVELMYMKHLILKSGSDYENYFQWFIEVIETKIDPWVETNGGWSAIIQVSAEAKRSDIYIENCKFLLKLLTGASVLYL----CNKV 951          
BLAST of Bcl2-like protein vs. Planmine SMEST
Match: SMESG000081267.1 (SMESG000081267.1)

HSP 1 Score: 107.071 bits (266), Expect = 4.904e-26
Identity = 49/98 (50.00%), Postives = 71/98 (72.45%), Query Frame = 2
Query:  329 IDLLNGLISNEEKDEIIKSILMLMKLAEKMTKGHQIDYNSILKLSSIELKRKSFKKVFEMLFDHQMKWSRILMGFLYMKHMLLQSGSDFENYFQWSVE 622
            I LLN L+SN  +D+IIK+I  ++   EK+ +    DY  IL L ++E ++KSF+ +F  +FD   KW RI++G +YMKHM+L+SGSD+ENYFQWS+E
Sbjct:  169 ITLLNELVSNNREDDIIKNIKFMVNRTEKIVEDIPFDYEKILNLPTLE-RKKSFQSIFSYMFDENNKWMRIIVGLMYMKHMILKSGSDYENYFQWSIE 265          
BLAST of Bcl2-like protein vs. Planmine SMEST
Match: SMESG000038292.1 (SMESG000038292.1)

HSP 1 Score: 103.605 bits (257), Expect = 9.425e-25
Identity = 54/125 (43.20%), Postives = 83/125 (66.40%), Query Frame = 2
Query:  308 MSQLNFAIDLLNGLISNE-EKDEIIKSILMLMKLAEKMTKGHQIDYNSILKLSSIELKRKSFKKVFEMLFDHQMKWSRILMGFLYMKHMLLQSGSDFENYFQWSVEII--------EDNGDWQVL 655
            M +  F I LLN L++N  E+D+IIK+I  ++   + + +   I +  IL LS++E K+ SF+ +F  +FD  +KW RI++G +YMKHM+L+SGSD+EN FQWS+E+I        E+NGD + L
Sbjct:    1 MPETKFFISLLNELVANNGEEDDIIKNIKFMVNHTDNIVE--DIPFEPILNLSTLERKKNSFQSIFSYMFDKNIKWMRIIIGLMYMKHMILKSGSDYENDFQWSIEVIETKIDPWVEENGDGEQL 123          
BLAST of Bcl2-like protein vs. Planmine SMEST
Match: SMESG000079150.1 (SMESG000079150.1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.097e-19
Identity = 46/121 (38.02%), Postives = 77/121 (63.64%), Query Frame = 2
Query:  308 MSQLNFAIDLLNGLISNEEKDEIIKSILMLMKLAEKMTKGHQIDYNSILKLSSIELKRKSFKKVFEMLFDHQMKWSRILMGFLYMKHMLLQSGSDFENYFQWSVEIIED--------NGDW 646
            M+QL   I +LNGL++ E+ D++I ++  L+  A K+ + + ID++ IL  S++  K  +FK VF  L ++ MKWSR+++ F+YMK +L +SG  +E Y  WS++II++        NG W
Sbjct:    1 MNQL--IIHILNGLVTEEKGDQLISNLQFLVDEALKVYRRNPIDFSWILSRSTLNAKENAFKGVFYALLEN-MKWSRVIVAFMYMKIILQRSGDYYERYLYWSLQIIQNEISPWVAENGSW 118          
BLAST of Bcl2-like protein vs. Planmine SMEST
Match: SMESG000045949.1 (SMESG000045949.1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.383e-18
Identity = 38/100 (38.00%), Postives = 66/100 (66.00%), Query Frame = 2
Query:  326 AIDLLNGLISNEEKDEIIKSILMLMKLAEKMTKGHQIDYNSILKLSSIELKRKSFKKVFEMLFDHQMKWSRILMGFLYMKHMLLQSGSDFENYFQWSVEI 625
             I +LNGL++ E+ DE+I ++  L+  A K+ + + I++  IL  S++  K  + K VF  L ++ MKWSR+++ F+YMK +L +SG  +E YF WS+++
Sbjct:    5 TIHILNGLVTEEKGDELITNLQFLVDEAMKVYRRNPINFPWILSRSTLNAKENALKGVFYALLEN-MKWSRVIVPFMYMKIILQRSGEYYERYFYWSLQV 103          
The following BLAST results are available for this feature:
BLAST of Bcl2-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
C9WPR43.431e-1131.72Bcl2-like protein OS=Schmidtea mediterranea OX=793... [more]
back to top
BLAST of Bcl2-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bcl2-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004697.17.101e-2737.33SMESG000004697.1[more]
SMESG000081267.14.904e-2650.00SMESG000081267.1[more]
SMESG000038292.19.425e-2543.20SMESG000038292.1[more]
SMESG000079150.12.097e-1938.02SMESG000079150.1[more]
SMESG000045949.18.383e-1838.00SMESG000045949.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023094 ID=SMED30023094|Name=Bcl2-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=804bp
TCGTTCATAGCTTGAATTGCGCTCAAAATTAGGTACATTTTAATGATTGT
AATGGAAATAACAATTAGTTTTATACTAATTTTAATCAATTAGAAGTTAA
ACATACACTTTTACACCCAATTTAGTATTTTATACACCCTCATAGTATTA
TTCTAGTGCATTCGTATTGCACAAGTCCTTGTTCTTTATGTATGTTTTGT
ACCTGTCATTGTTTATTGAGTGTGTATTGTATAATTTATCCAATAAACAT
CTTTTATACATCAAATTATTAATATAAATGGATGTACATTTCAATTAATA
TTTATAAATGTCACAATTAAATTTCGCGATTGATTTATTAAACGGTTTAA
TATCCAATGAAGAAAAAGATGAGATAATCAAGAGCATTCTGATGTTGATG
AAACTTGCTGAGAAGATGACGAAAGGTCATCAGATTGACTACAACTCTAT
TCTTAAGTTGTCATCAATTGAATTGAAAAGAAAATCTTTCAAGAAAGTTT
TTGAAATGCTATTCGATCATCAAATGAAGTGGAGCCGAATTCTAATGGGT
TTCTTATATATGAAGCATATGCTTTTACAATCAGGTTCAGACTTTGAAAA
TTACTTTCAATGGTCTGTGGAGATAATTGAAGATAATGGTGACTGGCAAG
TGTTAATATAAATCTCAACCAAATCACGAAAATCAATAGAAACTGTTGAA
AAAGTAATGAAATTAACTATCGGATTCGGTTTTGTATATATTTTTTATAG
AACTTGTCGTAAAATTTAATAAACGTTTAAAATCTTATTAAATTACTTTT
GGTT
back to top

protein sequence of SMED30023094-orf-1

>SMED30023094-orf-1 ID=SMED30023094-orf-1|Name=SMED30023094-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MSQLNFAIDLLNGLISNEEKDEIIKSILMLMKLAEKMTKGHQIDYNSILK
LSSIELKRKSFKKVFEMLFDHQMKWSRILMGFLYMKHMLLQSGSDFENYF
QWSVEIIEDNGDWQVLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process