Origin recognition complex subunit 1

Overview
NameOrigin recognition complex subunit 1
Smed IDSMED30023092
Length (bp)3810
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Origin recognition complex subunit 1 (SMED30023092) t-SNE clustered cells

Violin plots show distribution of expression levels for Origin recognition complex subunit 1 (SMED30023092) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Origin recognition complex subunit 1 (SMED30023092) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Origin recognition complex subunit 1 (SMED30023092) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023092

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023092SMESG000024931.1 Contig6560uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023092SMESG000024931.1 Contig6560newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023092SMESG000024931.1 Contig4941GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30023092SMESG000024931.1 dd_Smed_v4_4826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023092SMESG000024931.1 dd_Smed_v4_4826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023092SMESG000024931.1 dd_Smed_v4_4826_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Match: NISCH (nischarin [Source:HGNC Symbol;Acc:HGNC:18006])

HSP 1 Score: 200.29 bits (508), Expect = 2.750e-54
Identity = 116/381 (30.45%), Postives = 202/381 (53.02%), Query Frame = 2
Query:  197 NWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
             W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R++ LE+Y+ ++++      PR LA FL    YEI+GIT  LA+ LF+ GE LL    +F I  L +Y++ +++    PT        D G++L+     K +K       V G++  +GTSNI+ + LPFD+SIF  +  +E++     +++GL      +  L   +   S++++L  +         +     GP       W +  + D S+NS++ ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG++K L L GN L  L+ + +++SL  LD+ DN I + + +  +  L CLE++ +  NP+
Sbjct:   43 EWTVKHRYSDFHDLHEKLVAERKIDKNLLPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGL--HTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPL 414          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Match: NISCH (nischarin [Source:HGNC Symbol;Acc:HGNC:18006])

HSP 1 Score: 200.29 bits (508), Expect = 1.099e-53
Identity = 116/381 (30.45%), Postives = 202/381 (53.02%), Query Frame = 2
Query:  197 NWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
             W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R++ LE+Y+ ++++      PR LA FL    YEI+GIT  LA+ LF+ GE LL    +F I  L +Y++ +++    PT        D G++L+     K +K       V G++  +GTSNI+ + LPFD+SIF  +  +E++     +++GL      +  L   +   S++++L  +         +     GP       W +  + D S+NS++ ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG++K L L GN L  L+ + +++SL  LD+ DN I + + +  +  L CLE++ +  NP+
Sbjct:   43 EWTVKHRYSDFHDLHEKLVAERKIDKNLLPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGL--HTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPL 414          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Match: NISCH (nischarin [Source:HGNC Symbol;Acc:HGNC:18006])

HSP 1 Score: 201.445 bits (511), Expect = 1.522e-51
Identity = 116/381 (30.45%), Postives = 202/381 (53.02%), Query Frame = 2
Query:  197 NWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
             W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R++ LE+Y+ ++++      PR LA FL    YEI+GIT  LA+ LF+ GE LL    +F I  L +Y++ +++    PT        D G++L+     K +K       V G++  +GTSNI+ + LPFD+SIF  +  +E++     +++GL      +  L   +   S++++L  +         +     GP       W +  + D S+NS++ ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG++K L L GN L  L+ + +++SL  LD+ DN I + + +  +  L CLE++ +  NP+
Sbjct:   43 EWTVKHRYSDFHDLHEKLVAERKIDKNLLPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGL--HTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPL 414          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Match: NISCH (nischarin [Source:HGNC Symbol;Acc:HGNC:18006])

HSP 1 Score: 201.445 bits (511), Expect = 1.522e-51
Identity = 116/381 (30.45%), Postives = 202/381 (53.02%), Query Frame = 2
Query:  197 NWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
             W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R++ LE+Y+ ++++      PR LA FL    YEI+GIT  LA+ LF+ GE LL    +F I  L +Y++ +++    PT        D G++L+     K +K       V G++  +GTSNI+ + LPFD+SIF  +  +E++     +++GL      +  L   +   S++++L  +         +     GP       W +  + D S+NS++ ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG++K L L GN L  L+ + +++SL  LD+ DN I + + +  +  L CLE++ +  NP+
Sbjct:   43 EWTVKHRYSDFHDLHEKLVAERKIDKNLLPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGL--HTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPL 414          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Match: STK11IP (serine/threonine kinase 11 interacting protein [Source:HGNC Symbol;Acc:HGNC:19184])

HSP 1 Score: 84.7297 bits (208), Expect = 8.578e-16
Identity = 64/201 (31.84%), Postives = 109/201 (54.23%), Query Frame = 2
Query:  719 PFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDN-LHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            P  I  F  ++ LEL  V +  L GL  + + +E L     L++LE++L       S+   D  +   PW++  SA+FS N++T +D S+  L  +  LNLS NQ+ +    L  L  L  LD+S N L+L   +  S    ++  LIL+GN+L  L+ ++++ +L +LD++ N +   + L PL  L+ L  L+++ NP+
Sbjct:  101 PIKIFPFKSLRHLELRGVPLHCLHGLRGIYSQLETLICSRSLQALEELL-------SACGGDFCSAL-PWLALLSANFSYNALTALDSSLRLLSALRFLNLSHNQVQDCQGFLMDLCELHHLDISYNRLHLVPRMGPSG--AALGVLILRGNELRSLHGLEQLRNLRHLDLAYNLLEGHRELSPLWLLAELRKLYLEGNPL 291          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Celegans
Match: F13E9.1 (pep chromosome:WBcel235:IV:10864331:10873632:1 gene:WBGene00008750.1 transcript:F13E9.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13E9.1)

HSP 1 Score: 174.096 bits (440), Expect = 5.193e-46
Identity = 123/416 (29.57%), Postives = 205/416 (49.28%), Query Frame = 2
Query:  200 WKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNY--------VPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRI----FEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFY-----GPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEID-NLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINS 1393
            W + +RYS+F   YD    LD   K + PPK+    K    + +R+  LE Y+  ++ +   Y        +P   AKF +  +YEIH I  +L+  L   G+  L +++     FE + + +++I +R+  P PT        D GN ++ +   + +KI        G     GTSNI   SL   +    G+++L +    +  + G+  +   +  L  HY +K ++D+LF +        EDL           W   +  D S N I   D+S+  L +V  LN+S+N I+EI  NL +L  LTELDLSNN L   +   ++ KLG++KKLIL  N +  L+ + +++SLEYLD   NNI     +  + +L CLE L ++ NPI     + + + ++F ++   +K++ 
Sbjct:   46 WTVERRYSDF-DAYDVHRFLDRK-KSFLPPKKRLGNKDLEFIEERRLELEKYVRALLELEVWYQKQKNVHSLPLITAKFFDFHQYEIHSIVDDLSLRLGNLGDGWLESSQTSPKYFEFTPIELHAITERLRLPEPTAPDVNMVADIGNTIDFLHRVRALKI-------RGQKGYVGTSNIVWNSLDMSLYFCKGLKALWIADSDVCRINGIKSIRETLRRLVVHYSMKKIKDLLFDE--------EDLETGMLVEEMDTWKCLEEVDLSFNEIKCFDESMKLLPEVRVLNVSYNSITEIGSNLAFLSSLTELDLSNNTLTKID--GWNEKLGNIKKLILSENAIEDLSGLGKLYSLEYLDAKGNNIQNLDAVQGIGKLPCLEILLLRDNPIRKLVEYRTKVLELFGERSSELKLDG 442          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 53.9138 bits (128), Expect = 4.343e-7
Identity = 48/150 (32.00%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  872 DLVH-RSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            DL H R+ +I DL  F  P +  +     NN +  I  +I +L  +++L+L  NQ++EI +L  L+ L  LDLS N +     I+  +KL  ++ L L  NK+ K+  ++ +  L+ L++ DN I + +    +  L  L+ LFI +N I
Sbjct:   42 DLTHTRADHIPDLTGF--PKI--EELRMRNNLLVSISPTISSLVTLTSLDLYENQLTEISHLESLVNLVSLDLSYNRI---RQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIEN---IGHLVNLDELFIGKNKI 181          

HSP 2 Score: 50.8322 bits (120), Expect = 4.297e-6
Identity = 54/190 (28.42%), Postives = 99/190 (52.11%), Query Frame = 2
Query:  773 KITNLKGLYKMN---AVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNES 1333
            K+T L+ LY ++     +ENL+A   LK LE    GD  +R   IE++    G  ++        N I  ++  + TL+++S L+L  N+I +I+N+  L  L EL LS+  L   ++I     L ++  L +  N++   + ++R+ SL     +DN +  F  +  L +L  L+ ++++RNP   N++
Sbjct:  123 KLTKLETLYLVSNKIEKIENLEALTQLKLLE---LGD--NRIKKIENI----GHLVNLDELFIGKNKIRQLE-GVETLQKLSVLSLPGNRIVKIENVEQLNNLKELYLSDQGL---QDIHGVEPLTNLLLLDVANNEIKTFSGVERLESLNDFWANDNKVESFSEIEQLSKLKGLQTVYLERNPFYFNDT 299          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 50.8322 bits (120), Expect = 4.132e-6
Identity = 36/98 (36.73%), Postives = 56/98 (57.14%), Query Frame = 2
Query:  995 LKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGL---LPLCRL 1279
            L  +++L    NQI++++NL  L+ L  LDLS N +   EN+    KL  +K L    NK++K+  +D +  LEYL++ DN I + + L   L L RL
Sbjct:   75 LTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLE---KLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRL 169          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Fly
Match: CG11807 (gene:FBgn0033996 transcript:FBtr0087363)

HSP 1 Score: 144.821 bits (364), Expect = 3.604e-36
Identity = 118/468 (25.21%), Postives = 222/468 (47.44%), Query Frame = 2
Query:   80 MANWFSDNSQTKFRVTVPKYF---FNKPFTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVP------YNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAH-YCLKSLEDILFGDLVHRSSNIEDL----------------RNFYG-----PWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKIN 1390
            MA ++  ++ T   VTVPK+     +   T Y++ V+    + W + +RY +F  L+++L    S  K   PPK++   K    L QR+  LE+Y+ E++      +PR LA+FL+  KY+I  +  +LAK+  + G++LLS+ + + +S L +Y+I++R+  P P ++      DF +VL+       + + P      Y    +  D     SNI    L F+++ F  +++L+ +++   N+  +  +   ++ +  H   ++++  +L  D +H+  ++  L                 N         W      D + N +T ID S+ T  ++  L L  N+I  + NL  L  L  L LS N +  C  + +   +G++  L L  NK+  L+ + ++ SL  LD+S N I E   +  +  L  LE L +  NP+  +  + S +   F ++   I ++
Sbjct:    1 MACYYRQHADTT--VTVPKFSNESSSGGVTYYDIKVRV-GKVEWLVERRYRDFANLHEKLVGEISISKKLLPPKKLVGNKQPSFLEQRREQLEIYLQELLIYFRTELPRALAEFLDFNKYDIIYLLQDLAKLFNESGDALLSSKKEYNLSALEVYAISERLSLPCPPSLDRGGKYDFSHVLDFCTQLVALVVTPVKDNASYAQDYNTVDVPIDRSNIIPNRLSFNLNAFRNLKTLKFSALSTENIVDIELLKPTLQTICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILASPSGSGPSTSNGSALVSADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQNLAELPQLQLLSLSGNLIAEC--VDWHLTMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAEISLD 463          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Fly
Match: CG11807 (gene:FBgn0033996 transcript:FBtr0310140)

HSP 1 Score: 144.821 bits (364), Expect = 3.604e-36
Identity = 118/468 (25.21%), Postives = 222/468 (47.44%), Query Frame = 2
Query:   80 MANWFSDNSQTKFRVTVPKYF---FNKPFTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVP------YNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAH-YCLKSLEDILFGDLVHRSSNIEDL----------------RNFYG-----PWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKIN 1390
            MA ++  ++ T   VTVPK+     +   T Y++ V+    + W + +RY +F  L+++L    S  K   PPK++   K    L QR+  LE+Y+ E++      +PR LA+FL+  KY+I  +  +LAK+  + G++LLS+ + + +S L +Y+I++R+  P P ++      DF +VL+       + + P      Y    +  D     SNI    L F+++ F  +++L+ +++   N+  +  +   ++ +  H   ++++  +L  D +H+  ++  L                 N         W      D + N +T ID S+ T  ++  L L  N+I  + NL  L  L  L LS N +  C  + +   +G++  L L  NK+  L+ + ++ SL  LD+S N I E   +  +  L  LE L +  NP+  +  + S +   F ++   I ++
Sbjct:    1 MACYYRQHADTT--VTVPKFSNESSSGGVTYYDIKVRV-GKVEWLVERRYRDFANLHEKLVGEISISKKLLPPKKLVGNKQPSFLEQRREQLEIYLQELLIYFRTELPRALAEFLDFNKYDIIYLLQDLAKLFNESGDALLSSKKEYNLSALEVYAISERLSLPCPPSLDRGGKYDFSHVLDFCTQLVALVVTPVKDNASYAQDYNTVDVPIDRSNIIPNRLSFNLNAFRNLKTLKFSALSTENIVDIELLKPTLQTICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILASPSGSGPSTSNGSALVSADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQNLAELPQLQLLSLSGNLIAEC--VDWHLTMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAEISLD 463          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Fly
Match: CG11807 (gene:FBgn0033996 transcript:FBtr0310139)

HSP 1 Score: 144.821 bits (364), Expect = 3.604e-36
Identity = 118/468 (25.21%), Postives = 222/468 (47.44%), Query Frame = 2
Query:   80 MANWFSDNSQTKFRVTVPKYF---FNKPFTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVP------YNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAH-YCLKSLEDILFGDLVHRSSNIEDL----------------RNFYG-----PWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKIN 1390
            MA ++  ++ T   VTVPK+     +   T Y++ V+    + W + +RY +F  L+++L    S  K   PPK++   K    L QR+  LE+Y+ E++      +PR LA+FL+  KY+I  +  +LAK+  + G++LLS+ + + +S L +Y+I++R+  P P ++      DF +VL+       + + P      Y    +  D     SNI    L F+++ F  +++L+ +++   N+  +  +   ++ +  H   ++++  +L  D +H+  ++  L                 N         W      D + N +T ID S+ T  ++  L L  N+I  + NL  L  L  L LS N +  C  + +   +G++  L L  NK+  L+ + ++ SL  LD+S N I E   +  +  L  LE L +  NP+  +  + S +   F ++   I ++
Sbjct:    1 MACYYRQHADTT--VTVPKFSNESSSGGVTYYDIKVRV-GKVEWLVERRYRDFANLHEKLVGEISISKKLLPPKKLVGNKQPSFLEQRREQLEIYLQELLIYFRTELPRALAEFLDFNKYDIIYLLQDLAKLFNESGDALLSSKKEYNLSALEVYAISERLSLPCPPSLDRGGKYDFSHVLDFCTQLVALVVTPVKDNASYAQDYNTVDVPIDRSNIIPNRLSFNLNAFRNLKTLKFSALSTENIVDIELLKPTLQTICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILASPSGSGPSTSNGSALVSADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQNLAELPQLQLLSLSGNLIAEC--VDWHLTMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAEISLD 463          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Fly
Match: CG9044 (gene:FBgn0031752 transcript:FBtr0333231)

HSP 1 Score: 79.7221 bits (195), Expect = 1.761e-14
Identity = 83/305 (27.21%), Postives = 144/305 (47.21%), Query Frame = 2
Query:  449 TNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIES-TKKIKIVPYNVLVHGSDSLYGTSNIKSESLP--------FDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLIL---KGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSN 1327
            T LA +L ++G+ +LS+     +S   + ++N      A T I            +V++    K  + P   LVH  D +  T+ +K    P         DI+ F  ++ LE+N + I  + G+  +   +++L    C+KSL  +   D++ R     D  N +  W   K+ADFS NS+  +D ++   + + +LNL  N+++ +  + +L  L  LDLS NCL           + + K+L L     N + +L  + ++ +L  LD+SDN + E   LLPL  L  L  L ++ NP+  N
Sbjct:    7 TELANLLRQNGDKILSSEFTLTLSGSLLRALNDSFTLIADTEIGTGAGYLQPQSFQVVKPINAKSSVFPDLQLVH--DFVQKTTLLKLTYFPSEHYFEGAIDIAKFRALRRLEVNKINIGQVVGIQPLRGQLQHL---ICVKSLTSV--DDIITRCGG--DNSNGF-VWNELKTADFSYNSLRSVDTALEFAQHLQHLNLRHNKLTSVAAIKWLPHLKTLDLSYNCLTHLPQF----HMEACKRLQLLNISNNYVEELLDVAKLDALYNLDLSDNCLLEHSQLLPLSALMSLIVLNLQGNPLACN 297          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Fly
Match: CG9044 (gene:FBgn0031752 transcript:FBtr0273412)

HSP 1 Score: 79.337 bits (194), Expect = 1.937e-14
Identity = 83/305 (27.21%), Postives = 144/305 (47.21%), Query Frame = 2
Query:  449 TNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIES-TKKIKIVPYNVLVHGSDSLYGTSNIKSESLP--------FDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLIL---KGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSN 1327
            T LA +L ++G+ +LS+     +S   + ++N      A T I            +V++    K  + P   LVH  D +  T+ +K    P         DI+ F  ++ LE+N + I  + G+  +   +++L    C+KSL  +   D++ R     D  N +  W   K+ADFS NS+  +D ++   + + +LNL  N+++ +  + +L  L  LDLS NCL           + + K+L L     N + +L  + ++ +L  LD+SDN + E   LLPL  L  L  L ++ NP+  N
Sbjct:    7 TELANLLRQNGDKILSSEFTLTLSGSLLRALNDSFTLIADTEIGTGAGYLQPQSFQVVKPINAKSSVFPDLQLVH--DFVQKTTLLKLTYFPSEHYFEGAIDIAKFRALRRLEVNKINIGQVVGIQPLRGQLQHL---ICVKSLTSV--DDIITRCGG--DNSNGF-VWNELKTADFSYNSLRSVDTALEFAQHLQHLNLRHNKLTSVAAIKWLPHLKTLDLSYNCLTHLPQF----HMEACKRLQLLNISNNYVEELLDVAKLDALYNLDLSDNCLLEHSQLLPLSALMSLIVLNLQGNPLACN 297          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: nisch (nischarin [Source:ZFIN;Acc:ZDB-GENE-050208-570])

HSP 1 Score: 188.734 bits (478), Expect = 6.479e-48
Identity = 125/427 (29.27%), Postives = 218/427 (51.05%), Query Frame = 2
Query:  197 NWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLK 1456
            +W ++ RYS+F +L+++L       K   PPK++    S+ ++ +R++ LE+Y+  ++S      P+ L+ FL    YEI+GI   LA+ LF +GE LL+   +F +  L +Y++ Q++    PT        D G++L+     K +KI        G  S  GTSNI+ +SL FD+SIF  +  +E++      ++GL  +   +  L  H   KS+++IL  +    +    +  +   P       W    + D S N I  ID+S+  + +V  L+LS N++S ++NL +L  L  LDLS N L + E +    KLG++K L L  N+L  L+ + +++SL  LD+S N + +   +  +  L CLE L +  NP+C    + + +   F D+   + +      D  + T++E+     LK
Sbjct:   39 SWSVKHRYSDFHELHEKLTVEKKIDKHLLPPKKIIGKNSKSLVEKRQKELEVYLQTLLSRFPATTPKVLSNFLLFHLYEINGIAAALAEELFHNGEQLLAAGEVFLLKPLQLYAVTQQLRLAKPTCANGDAKADLGHILDFTCRLKYLKIP-------GKKSTVGTSNIEEQSLLFDLSIFKALLQIEISDCDAGQIRGLPSLKPTLATLSIHLSAKSMKEILVPEASEFAQWEPEGVDTDCPVTAIIPTWKMLTTLDMSRNYIRCIDESVKLIPEVEFLDLSHNELSLVENLEHLYNLVHLDLSFNKLTVLEGV--HTKLGNIKTLNLSENQLETLSGLSKLYSLVNLDLSSNKLTQLDEIKHIGLLPCLEKLNLANNPMCIIPDYRTKVLAQFCDRASEVCL------DATITTEKELDTVEVLK 450          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: nisch (nischarin [Source:ZFIN;Acc:ZDB-GENE-050208-570])

HSP 1 Score: 175.252 bits (443), Expect = 1.127e-43
Identity = 127/454 (27.97%), Postives = 222/454 (48.90%), Query Frame = 2
Query:  197 NWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSV--------KITN-------------------LKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLK 1456
            +W ++ RYS+F +L+++L       K   PPK++    S+ ++ +R++ LE+Y+  ++S      P+ L+ FL    YEI+GI   LA+ LF +GE LL+   +F +  L +Y++ Q++    PT        D G++L+     K +KI        G  S  GTSNI+ +SL FD+SIF  +  +E+ ++         I+N                   ++GL  +   +  L  H   KS+++IL  +    +    +  +   P       W    + D S N I  ID+S+  + +V  L+LS N++S ++NL +L  L  LDLS N L + E +    KLG++K L L  N+L  L+ + +++SL  LD+S N + +   +  +  L CLE L +  NP+C    + + +   F D+   + +      D  + T++E+     LK
Sbjct:   39 SWSVKHRYSDFHELHEKLTVEKKIDKHLLPPKKIIGKNSKSLVEKRQKELEVYLQTLLSRFPATTPKVLSNFLLFHLYEINGIAAALAEELFHNGEQLLAAGEVFLLKPLQLYAVTQQLRLAKPTCANGDAKADLGHILDFTCRLKYLKI-------PGKKSTVGTSNIEEQSLLFDLSIFKALLQIEVETLLMGFWVRLMISNCVSEVYLFIFQISDCDAGQIRGLPSLKPTLATLSIHLSAKSMKEILVPEASEFAQWEPEGVDTDCPVTAIIPTWKMLTTLDMSRNYIRCIDESVKLIPEVEFLDLSHNELSLVENLEHLYNLVHLDLSFNKLTVLEGVH--TKLGNIKTLNLSENQLETLSGLSKLYSLVNLDLSSNKLTQLDEIKHIGLLPCLEKLNLANNPMCIIPDYRTKVLAQFCDRASEVCL------DATITTEKELDTVEVLK 477          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:ZFIN;Acc:ZDB-GENE-040426-1022])

HSP 1 Score: 63.929 bits (154), Expect = 1.474e-9
Identity = 66/241 (27.39%), Postives = 119/241 (49.38%), Query Frame = 2
Query:  737 FNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDIL---FGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELD---LSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISN 1441
            F  ++ LEL  +    L+GL  + + +E       + SLE++L    GDL   SS +        PW+  ++ +FS NSI+ +D+S+  L  +  L+LS N+I   D   +L  LTEL+   L+ N L     +  S +   +  LIL+ N+L  +N ++++ SL+ LD++ N + E   L PL  L  L  L +   P+  ++  +       + Q+    + +++ D    Q  Q++S+
Sbjct:  108 FKSLKHLELKRIPPHCLEGLRGVYSQLEVFTCSKGVSSLEELLSLCGGDL---SSAL--------PWLELQTLNFSYNSISCLDESLSLLNVLKWLDLSHNKIE--DCAEFLKPLTELEHLNLAYNNLQRAPVLGLSAQ-AKLTTLILRNNELETINGVEQLSSLQCLDLAYNLLMEHSQLAPLSLLHNLNTLQLDGTPLSQSDLLLIPKPGQLVGQLSHTSLVAMAQD----QDGQDVSS 330          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:ZFIN;Acc:ZDB-GENE-040426-1022])

HSP 1 Score: 60.4622 bits (145), Expect = 1.400e-8
Identity = 62/200 (31.00%), Postives = 104/200 (52.00%), Query Frame = 2
Query:  737 FNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDIL---FGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELD---LSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            F  ++ LEL  +    L+GL  + + +E       + SLE++L    GDL   SS +        PW+  ++ +FS NSI+ +D+S+  L  +  L+LS N+I   D   +L  LTEL+   L+ N L     +  S +   +  LIL+ N+L  +N ++++ SL+ LD++ N + E   L PL  L  L  L ++ NP+
Sbjct:  108 FKSLKHLELKRIPPHCLEGLRGVYSQLEVFTCSKGVSSLEELLSLCGGDL---SSAL--------PWLELQTLNFSYNSISCLDESLSLLNVLKWLDLSHNKIE--DCAEFLKPLTELEHLNLAYNNLQRAPVLGLSAQ-AKLTTLILRNNELETINGVEQLSSLQCLDLAYNLLMEHSQLAPLSLLHNLNTLTLEGNPL 293          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:ZFIN;Acc:ZDB-GENE-040426-1022])

HSP 1 Score: 58.151 bits (139), Expect = 1.920e-8
Identity = 61/193 (31.61%), Postives = 100/193 (51.81%), Query Frame = 2
Query:  737 FNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDIL---FGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELD---LSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENL 1297
            F  ++ LEL  +    L+GL  + + +E       + SLE++L    GDL   SS +        PW+  ++ +FS NSI+ +D+S+  L  +  L+LS N+I   D   +L  LTEL+   L+ N L     +  S +   +  LIL+ N+L  +N ++++ SL+ LD++ N + E   L P   LS L NL
Sbjct:  108 FKSLKHLELKRIPPHCLEGLRGVYSQLEVFTCSKGVSSLEELLSLCGGDL---SSAL--------PWLELQTLNFSYNSISCLDESLSLLNVLKWLDLSHNKIE--DCAEFLKPLTELEHLNLAYNNLQRAPVLGLSAQ-AKLTTLILRNNELETINGVEQLSSLQCLDLAYNLLMEHSQLAP---LSLLHNL 283          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:394784])

HSP 1 Score: 92.8189 bits (229), Expect = 2.655e-18
Identity = 99/374 (26.47%), Postives = 176/374 (47.06%), Query Frame = 2
Query:  455 LAKMLFKHGESLLSNNRIFEISILSIYSIN---QRMISPAP-TNIYNKPSEDFGNV--------LEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIF--NGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILF---GDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTEL---DLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKESTMFDFNNLQTQFECSGEI 1516
            LA++L +HG+ +L  +RI  +    +  +    +++    P T     P+    +V        L++++ T  +K      LVH ++              FD++IF    ++SLEL  +    L+GL  + + +E L  + C+ SLE+++    GDL   SS +        PW+   + DFS N++ ++D S+  L  +  L+LS NQI+E  +  YL  L+EL   +L  N L     +S  N    +  LILK N+LS  + ++ + +L++LD+S N + E   L  L RL  L+ LF++ NP+     +    +     Q  S K +     D  + +  EI N +   E      ++  T+  C+G++
Sbjct:   13 LAQILHEHGDKVLDGSRILALLTPCLQVVTRLFEQLFPRGPGTGFQALPAHPADSVPILRAQFMLDMLQKTPSLK------LVHPAECPRQ----------FDVNIFPFKSLRSLELRCLPPHCLRGLRSVYSQLEVLTCYRCVSSLEEVIALCGGDL---SSAL--------PWLVLHTLDFSYNTLKNLDGSLELLNSLKILDLSHNQITECGS--YLKVLSELQYLNLGYNHLTAVPELSVGNT-AKLHSLILKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPL-----YFQKDYRALTAQHLSHKASDNVLLDGKLLSSSEIMNAQAFGEKVRLQPSSSATESSCTGDL 351          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:394784])

HSP 1 Score: 92.8189 bits (229), Expect = 2.702e-18
Identity = 99/378 (26.19%), Postives = 177/378 (46.83%), Query Frame = 2
Query:  443 ITTNLAKMLFKHGESLLSNNRIFEISILSIYSIN---QRMISPAP-TNIYNKPSEDFGNV--------LEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIF--NGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILF---GDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTEL---DLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKESTMFDFNNLQTQFECSGEI 1516
            +   LA++L +HG+ +L  +RI  +    +  +    +++    P T     P+    +V        L++++ T  +K      LVH ++              FD++IF    ++SLEL  +    L+GL  + + +E L  + C+ SLE+++    GDL   SS +        PW+   + DFS N++ ++D S+  L  +  L+LS NQI+E  +  YL  L+EL   +L  N L     +S  N    +  LILK N+LS  + ++ + +L++LD+S N + E   L  L RL  L+ LF++ NP+     +    +     Q  S K +     D  + +  EI N +   E      ++  T+  C+G++
Sbjct:    9 LVQALAQILHEHGDKVLDGSRILALLTPCLQVVTRLFEQLFPRGPGTGFQALPAHPADSVPILRAQFMLDMLQKTPSLK------LVHPAECPRQ----------FDVNIFPFKSLRSLELRCLPPHCLRGLRSVYSQLEVLTCYRCVSSLEEVIALCGGDL---SSAL--------PWLVLHTLDFSYNTLKNLDGSLELLNSLKILDLSHNQITECGS--YLKVLSELQYLNLGYNHLTAVPELSVGNT-AKLHSLILKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPL-----YFQKDYRALTAQHLSHKASDNVLLDGKLLSSSEIMNAQAFGEKVRLQPSSSATESSCTGDL 351          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:394784])

HSP 1 Score: 84.7297 bits (208), Expect = 5.112e-17
Identity = 70/207 (33.82%), Postives = 114/207 (55.07%), Query Frame = 2
Query:  722 FDISIF--NGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILF---GDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTEL---DLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            FD++IF    ++SLEL  +    L+GL  + + +E L  + C+ SLE+++    GDL   SS +        PW+   + DFS N++ ++D S+  L  +  L+LS NQI+E  +  YL  L+EL   +L  N L     +S  N    +  LILK N+LS  + ++ + +L++LD+S N + E   L  L RL  L+ LF++ NP+
Sbjct:   87 FDVNIFPFKSLRSLELRCLPPHCLRGLRSVYSQLEVLTCYRCVSSLEEVIALCGGDL---SSAL--------PWLVLHTLDFSYNTLKNLDGSLELLNSLKILDLSHNQITECGS--YLKVLSELQYLNLGYNHLTAVPELSVGNT-AKLHSLILKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPL 279          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:394784])

HSP 1 Score: 88.1965 bits (217), Expect = 7.710e-17
Identity = 83/275 (30.18%), Postives = 136/275 (49.45%), Query Frame = 2
Query:  722 FDISIF--NGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILF-----GDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTEL---DLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKESTMFDFNNLQTQFECSGEI 1516
            FD++IF    ++SLEL  +    L+GL  + + +E L  + C+ SLE  LF     GDL   SS +        PW+   + DFS N++ ++D S+  L  +  L+LS NQI+E  +  YL  L+EL   +L  N L     +S  N    +  LILK N+LS  + ++ + +L++LD+S N + E   L  L RL  L+ LF++ NP+     +    +     Q  S K +     D  + +  EI N +   E      ++  T+  C+G++
Sbjct:   93 FDVNIFPFKSLRSLELRCLPPHCLRGLRSVYSQLEVLTCYRCVSSLEMYLFIALCGGDL---SSAL--------PWLVLHTLDFSYNTLKNLDGSLELLNSLKILDLSHNQITECGS--YLKVLSELQYLNLGYNHLTAVPELSVGNT-AKLHSLILKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPL-----YFQKDYRALTAQHLSHKASDNVLLDGKLLSSSEIMNAQAFGEKVRLQPSSSATESSCTGDL 348          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:394784])

HSP 1 Score: 83.1889 bits (204), Expect = 2.715e-15
Identity = 77/271 (28.41%), Postives = 132/271 (48.71%), Query Frame = 2
Query:  722 FDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILF---GDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTEL---DLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKESTMFDFNNLQTQFECSGEI 1516
            F + +     SL+L  +    L+GL  + + +E L  + C+ SLE+++    GDL   SS +        PW+   + DFS N++ ++D S+  L  +  L+LS NQI+E  +  YL  L+EL   +L  N L     +S  N    +  LILK N+LS  + ++ + +L++LD+S N + E   L  L RL  L+ LF++ NP+     +    +     Q  S K +     D  + +  EI N +   E      ++  T+  C+G++
Sbjct:   75 FMLDMLQKTPSLKLRCLPPHCLRGLRSVYSQLEVLTCYRCVSSLEEVIALCGGDL---SSAL--------PWLVLHTLDFSYNTLKNLDGSLELLNSLKILDLSHNQITECGS--YLKVLSELQYLNLGYNHLTAVPELSVGNT-AKLHSLILKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPL-----YFQKDYRALTAQHLSHKASDNVLLDGKLLSSSEIMNAQAFGEKVRLQPSSSATESSCTGDL 326          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 204.912 bits (520), Expect = 1.650e-56
Identity = 126/427 (29.51%), Postives = 214/427 (50.12%), Query Frame = 2
Query:  188 SNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSS-NIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNR 1444
             N  W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R+R LE+Y+  +++   +  PR LA FL    YE++G+T  LA+ LF+ GE LL    +F I  L +Y+I +++    PT        D G++L+     K +K       V G++  +GTSNIK + LPFD+SIF  +  +E++     +++GL      +  +   +   S++++L  +         E      GP       W +  + D S+NSI  ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG+VK L L GN L  L+ + +++SL  +D+ DN I +   +  +  L CLE L +  NP+     + + +   F ++   +   S S      Q K  +S +
Sbjct:   41 GNHEWTIKHRYSDFHDLHEKLVAERKIDKSLLPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPTWQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLSSLEGV--HTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEVSPRSSSRAQRDWQGKPSLSAK 458          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 203.371 bits (516), Expect = 1.660e-55
Identity = 122/412 (29.61%), Postives = 211/412 (51.21%), Query Frame = 2
Query:  188 SNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSS-NIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLS 1399
             N  W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R+R LE+Y+  +++   +  PR LA FL    YE++G+T  LA+ LF+ GE LL    +F I  L +Y+I +++    PT        D G++L+     K +K       V G++  +GTSNIK + LPFD+SIF  +  +E++     +++GL      +  +   +   S++++L  +         E      GP       W +  + D S+NSI  ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG+VK L L GN L  L+ + +++SL  +D+ DN I +   +  +  L CLE L +  NP+     + + +   F ++   I ++ ++
Sbjct:   41 GNHEWTIKHRYSDFHDLHEKLVAERKIDKSLLPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPTWQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLSSLEGV--HTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEICLDDVA 443          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 204.912 bits (520), Expect = 1.008e-52
Identity = 122/412 (29.61%), Postives = 211/412 (51.21%), Query Frame = 2
Query:  188 SNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSS-NIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLS 1399
             N  W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R+R LE+Y+  +++   +  PR LA FL    YE++G+T  LA+ LF+ GE LL    +F I  L +Y+I +++    PT        D G++L+     K +K       V G++  +GTSNIK + LPFD+SIF  +  +E++     +++GL      +  +   +   S++++L  +         E      GP       W +  + D S+NSI  ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG+VK L L GN L  L+ + +++SL  +D+ DN I +   +  +  L CLE L +  NP+     + + +   F ++   I ++ ++
Sbjct:   41 GNHEWTIKHRYSDFHDLHEKLVAERKIDKSLLPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPTWQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLSSLEGV--HTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEICLDDVA 443          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 158.688 bits (400), Expect = 5.573e-42
Identity = 87/297 (29.29%), Postives = 152/297 (51.18%), Query Frame = 2
Query:  188 SNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSS-NIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNL 1054
             N  W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R+R LE+Y+  +++   +  PR LA FL    YE++G+T  LA+ LF+ GE LL    +F I  L +Y+I +++    PT        D G++L+     K +K       V G++  +GTSNIK + LPFD+SIF  +  +E++     +++GL      +  +   +   S++++L  +         E      GP       W +  + D S+NSI  ID+S+  + ++  L+LS N +  +DNL
Sbjct:   41 GNHEWTIKHRYSDFHDLHEKLVAERKIDKSLLPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPTWQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNL 330          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Match: Nisch (nischarin [Source:MGI Symbol;Acc:MGI:1928323])

HSP 1 Score: 80.8777 bits (198), Expect = 9.285e-15
Identity = 51/158 (32.28%), Postives = 86/158 (54.43%), Query Frame = 2
Query:  926 WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLS 1399
            W +  + D S+NSI  ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG+VK L L GN L  L+ + +++SL  +D+ DN I +   +  +  L CLE L +  NP+     + + +   F ++   I ++ ++
Sbjct:   43 WQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLSSLEGV--HTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEICLDDVA 198          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q4G017|NISCH_RAT (Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch PE=2 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 3.722e-52
Identity = 120/411 (29.20%), Postives = 213/411 (51.82%), Query Frame = 2
Query:  188 SNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLS 1399
             N  W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R++ LE+Y+  ++    +  PR LA FL    YEI+G+T  LA+ LF+ GE LL    +F I  L +Y+I +++    PT        D G++L+     K +K       V G++  +GTSNI+ + LPFD+SIF  +  +E++     +++GL      +  +   +   S++++L  +         +     GP       W +  + D S+NSI+ ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG+VK L L GN L +L+ + +++SL  LD+ DN I +   +  +  L CLE++ +  NP+     + + +   F ++   I ++ ++
Sbjct:   41 GNHEWTIKHRYSDFHDLHEKLVAERKIDKTLLPPKKIIGKNSRSLVEKREKDLEVYLQTLLKTFPDVAPRVLAHFLHFHLYEINGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIREQLLPFDLSIFKSLHQVEMSHCDAKHVRGLVTSKPTLATMSVRFSAASMKEVLVPEASEFDEWEPEGTTLGGPVTAVIPTWQALTTLDLSHNSISEIDESVKLIPKIEYLDLSHNGVLVVDNLQHLYNLVHLDLSYNKLSSLEGV--HTKLGNVKTLNLAGNFLERLSGLHKLYSLVNLDLRDNRIEQLDEVKSIGNLPCLEHVALLNNPLSIIPDYRTKVLSQFGERASEICLDDVA 442          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q80TM9|NISCH_MOUSE (Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 7.054e-52
Identity = 122/412 (29.61%), Postives = 211/412 (51.21%), Query Frame = 2
Query:  188 SNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSS-NIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLS 1399
             N  W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R+R LE+Y+  +++   +  PR LA FL    YE++G+T  LA+ LF+ GE LL    +F I  L +Y+I +++    PT        D G++L+     K +K       V G++  +GTSNIK + LPFD+SIF  +  +E++     +++GL      +  +   +   S++++L  +         E      GP       W +  + D S+NSI  ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG+VK L L GN L  L+ + +++SL  +D+ DN I +   +  +  L CLE L +  NP+     + + +   F ++   I ++ ++
Sbjct:   41 GNHEWTIKHRYSDFHDLHEKLVAERKIDKSLLPPKKIIGKNSRSLVEKRERDLEVYLQTLLTTFPDVAPRVLAHFLHFHLYEVNGVTAALAEELFEKGEQLLGAGEVFAIRPLQLYAITEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIKEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVTSKPTLATMSVRFSATSMKEVLAPEASEFDEWEPEGTATLGGPVTAIIPTWQALTTLDLSHNSICEIDESVKLIPKIEYLDLSHNGLRVVDNLQHLYNLVHLDLSYNKLSSLEGV--HTKLGNVKTLNLAGNFLESLSGLHKLYSLVNVDLRDNRIEQLDEVKSIGSLPCLERLTLLNNPLSIIPDYRTKVLSQFGERASEICLDDVA 443          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q9Y2I1|NISCH_HUMAN (Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=3)

HSP 1 Score: 201.445 bits (511), Expect = 7.309e-51
Identity = 116/381 (30.45%), Postives = 202/381 (53.02%), Query Frame = 2
Query:  197 NWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
             W ++ RYS+F  L+++L +     K   PPK++    S  ++ +R++ LE+Y+ ++++      PR LA FL    YEI+GIT  LA+ LF+ GE LL    +F I  L +Y++ +++    PT        D G++L+     K +K       V G++  +GTSNI+ + LPFD+SIF  +  +E++     +++GL      +  L   +   S++++L  +         +     GP       W +  + D S+NS++ ID+S+  + ++  L+LS N +  +DNL +L  L  LDLS N L   E +    KLG++K L L GN L  L+ + +++SL  LD+ DN I + + +  +  L CLE++ +  NP+
Sbjct:   43 EWTVKHRYSDFHDLHEKLVAERKIDKNLLPPKKIIGKNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLHFHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLK-------VSGTEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEPEGTTLEGPVTAVIPTWQALTTLDLSHNSVSEIDESVKLIPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSSLEGL--HTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRDNRIEQMEEVRSIGSLPCLEHVSLLNNPL 414          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q6P4K6|S11IP_XENTR (Serine/threonine-protein kinase 11-interacting protein OS=Xenopus tropicalis OX=8364 GN=stk11ip PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.180e-17
Identity = 99/374 (26.47%), Postives = 176/374 (47.06%), Query Frame = 2
Query:  455 LAKMLFKHGESLLSNNRIFEISILSIYSIN---QRMISPAP-TNIYNKPSEDFGNV--------LEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIF--NGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILF---GDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTEL---DLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKESTMFDFNNLQTQFECSGEI 1516
            LA++L +HG+ +L  +RI  +    +  +    +++    P T     P+    +V        L++++ T  +K      LVH ++              FD++IF    ++SLEL  +    L+GL  + + +E L  + C+ SLE+++    GDL   SS +        PW+   + DFS N++ ++D S+  L  +  L+LS NQI+E  +  YL  L+EL   +L  N L     +S  N    +  LILK N+LS  + ++ + +L++LD+S N + E   L  L RL  L+ LF++ NP+     +    +     Q  S K +     D  + +  EI N +   E      ++  T+  C+G++
Sbjct:   13 LAQILHEHGDKVLDGSRILALLTPCLQVVTRLFEQLFPRGPGTGFQALPAHPADSVPILRAQFMLDMLQKTPSLK------LVHPAECPRQ----------FDVNIFPFKSLRSLELRCLPPHCLRGLRSVYSQLEVLTCYRCVSSLEEVIALCGGDL---SSAL--------PWLVLHTLDFSYNTLKNLDGSLELLNSLKILDLSHNQITECGS--YLKVLSELQYLNLGYNHLTAVPELSVGNT-AKLHSLILKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPL-----YFQKDYRALTAQHLSHKASDNVLLDGKLLSSSEIMNAQAFGEKVRLQPSSSATESSCTGDL 351          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q8N1F8|S11IP_HUMAN (Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens OX=9606 GN=STK11IP PE=1 SV=4)

HSP 1 Score: 84.7297 bits (208), Expect = 4.119e-15
Identity = 64/201 (31.84%), Postives = 109/201 (54.23%), Query Frame = 2
Query:  719 PFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDN-LHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            P  I  F  ++ LEL  V +  L GL  + + +E L     L++LE++L       S+   D  +   PW++  SA+FS N++T +D S+  L  +  LNLS NQ+ +    L  L  L  LD+S N L+L   +  S    ++  LIL+GN+L  L+ ++++ +L +LD++ N +   + L PL  L+ L  L+++ NP+
Sbjct:  101 PIKIFPFKSLRHLELRGVPLHCLHGLRGIYSQLETLICSRSLQALEELL-------SACGGDFCSAL-PWLALLSANFSYNALTALDSSLRLLSALRFLNLSHNQVQDCQGFLMDLCELHHLDISYNRLHLVPRMGPSG--AALGVLILRGNELRSLHGLEQLRNLRHLDLAYNLLEGHRELSPLWLLAELRKLYLEGNPL 291          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: V4B568 (PX domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_222459 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.162e-62
Identity = 140/420 (33.33%), Postives = 232/420 (55.24%), Query Frame = 2
Query:  122 VTVPKYFFNKPFTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSI 1381
            + +P+    + FT Y + V       W +  RYS+F +L+D+L S     K   P K++F  +++  + +R+  LE Y+  I+  +   +P  LA FLE E+YEIHG+T +LA+ L+  GES+L     + +S L +Y++ +R+  P PT       +D G++L+ I   K +K       V+G +   G+SNI    L FD+++F  ++ +E+ +   + +KGL  +   ++ L  H  L  + +IL  D  H  +  ED       W S +  D S+NSI+ ID+SI  +  V  L+LS N+I E+ +  +L  LT LDLS+N L   E  S   KLG++K L L GNKL+ L    ++FSLE LD+S N+I + + + P+  L CLENL ++ NP+     + + +F++F D++  +
Sbjct:   17 IRIPRAEARENFTVYIIEVNVGC-YTWTVEHRYSDFHELHDKLVSTHRLDKNLLPKKKVFGNQNDAFIKKRQADLESYLQTILYYVAQKIPSVLASFLEFEEYEIHGLTQSLAEELYNKGESILQLRETYTLSALQLYALTERLKLPEPTCDSGDVKKDLGHILDFITRLKYLK-------VYGGNEDVGSSNINMNKLIFDLTLFKSLEYVEILNCSASAVKGLETVKQTLQTLSVHNTLTDIREILLPDARHWKA--EDGTLVVSYWDSLEQVDISHNSISFIDESIQMVPNVERLDLSRNKIREMKHFQWLSQLTYLDLSHNMLDNPE--SLHTKLGNLKTLKLAGNKLTHLQAFSKLFSLETLDISHNDITKIEDVAPVNGLPCLENLLLRGNPVTMVLDYRTKVFELFADRVTEV 424          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: A0A210R4A0 (Nischarin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10837 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 7.812e-62
Identity = 145/438 (33.11%), Postives = 238/438 (54.34%), Query Frame = 2
Query:   80 MANWFSD----NSQTKFRVTVPKYFFNKPFTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSI 1381
            MA++  D    +S    R+   ++  N      EV V    +  W ++ RY++FL L+++L S+    K   PPK++F  +SE  + +R+  LE Y+  ++  + + VP  LA FLE  +YEIHGIT  +A+ L+  G++LL    ++E++ L ++S+ +R+  P PT       +D G++L+ I   K +K+V       GS    G+SNI    L FD+S+F  +Q LE++      + G+  +   ++ +  HYC+  + DIL  DL    ++   L   Y  W     ADFS+N+IT ID S+  + +V  LNL  N I  I +L++L  LT LDLS N     +  +   K+G++K LIL GNKL  L  + ++FSLE LDVS N I +   +L +C+L CLE L +  NP+ +   + + +  +F+D+   +
Sbjct:    1 MAHFGKDIDHFSSSRTVRIKGSEFVDNHTVYTVEVSV---GSYTWMVKHRYNDFLILHEKLVSICKIDKTLLPPKKLFGNQSEGFIKKRQAELEAYLQTVLYYMAHKVPPVLASFLEFSRYEIHGITQGMAEDLYNRGDTLLQAREMYEVTPLQLFSLTERLKLPEPTCDSGDVKKDIGHILDFITRVKYLKVV-------GSTDPVGSSNIDMSQLKFDLSLFKSLQYLEVSFSIALQISGIETIKQTMDRISLHYCVSKIRDILLQDLPQWKADDGTLLVSY--WDKLTEADFSHNTITDIDDSVQLMPRVEVLNLGHNHIKSIQHLNWLSRLTFLDLSYNTFRSLD--ALHTKIGNLKTLILAGNKLDSLQGLSKLFSLENLDVSHNEISQMTEVLHVCKLPCLEELHMNNNPVTTVLDYRTKVLSMFMDRASEV 424          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: A0A1S3I2R1 (nischarin isoform X2 OS=Lingula unguis OX=7574 GN=LOC106160481 PE=4 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 2.118e-60
Identity = 136/425 (32.00%), Postives = 242/425 (56.94%), Query Frame = 2
Query:  170 VLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPR---PLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEI 1435
            +L  +  + +W +R RYSEF +L++ L +     K   PPK++F  ++E  + +R+  LE+Y+     ++ +Y+P+    LA FL+ +KYEIHGIT  LA+ LF+ GE +L + + F +S L + ++ QR+  P PT       +D G++L+     K +KI+       G+    GTSNI+   L F+++ F  +  LEL+   I  +  +  +   +++L  H  L++L+D+L  D+V+  +   +       W S ++ADFS+N I  ID+S+  + ++  L+LS NQ+S++ +LHYL  L++++L++N L   E  S   +LG+VK L L GN+L  L  + +++SLE L+VS N + E + +  + +L CLENL ++ NPI +   +   + ++F D+   + +      D    T+QE+
Sbjct:   32 ILEVYCGSYSWTVRHRYSEFHELHERLVTKYKIDKTLLPPKKVFGNQNEEFIKKRQADLELYLQ----VLMHYLPKLPPELAFFLDFDKYEIHGITQLLAEHLFEKGEKILQSQQTFVVSPLHLNAVTQRLKLPEPTCDTGDMRKDLGHILDFFTRLKYLKIL-------GTKEPLGTSNIEVNQLSFEMNCFKSLTVLELDQCNIGTISVVDTVKKTLKHLIVHGSLQALKDMLLRDIVYWQTEDTEETAVLPVWESLQAADFSHNEIKEIDESVRLMPRLEYLDLSRNQLSDVQHLHYLPALSQVNLAHNRLRTLE--SLHVRLGNVKILNLSGNQLDTLEGLSKLYSLETLNVSKNKLAEVENVQCIGKLPCLENLILRDNPIRTVVDYRVAVLELFGDRAKEVLL------DKEATTQQEL 437          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: A0A1S3I3Z6 (nischarin isoform X1 OS=Lingula unguis OX=7574 GN=LOC106160481 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 5.727e-59
Identity = 138/430 (32.09%), Postives = 244/430 (56.74%), Query Frame = 2
Query:  170 VLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPR---PLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTN----IYNKP-SEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEI 1435
            +L  +  + +W +R RYSEF +L++ L +     K   PPK++F  ++E  + +R+  LE+Y+     ++ +Y+P+    LA FL+ +KYEIHGIT  LA+ LF+ GE +L + + F +S L + ++ QR+  P PT     IY     +D G++L+     K +KI+       G+    GTSNI+   L F+++ F  +  LEL+   I  +  +  +   +++L  H  L++L+D+L  D+V+  +   +       W S ++ADFS+N I  ID+S+  + ++  L+LS NQ+S++ +LHYL  L++++L++N L   E  S   +LG+VK L L GN+L  L  + +++SLE L+VS N + E + +  + +L CLENL ++ NPI +   +   + ++F D+   + +      D    T+QE+
Sbjct:   32 ILEVYCGSYSWTVRHRYSEFHELHERLVTKYKIDKTLLPPKKVFGNQNEEFIKKRQADLELYLQ----VLMHYLPKLPPELAFFLDFDKYEIHGITQLLAEHLFEKGEKILQSQQTFVVSPLHLNAVTQRLKLPEPTCDHILIYTGDMRKDLGHILDFFTRLKYLKIL-------GTKEPLGTSNIEVNQLSFEMNCFKSLTVLELDQCNIGTISVVDTVKKTLKHLIVHGSLQALKDMLLRDIVYWQTEDTEETAVLPVWESLQAADFSHNEIKEIDESVRLMPRLEYLDLSRNQLSDVQHLHYLPALSQVNLAHNRLRTLE--SLHVRLGNVKILNLSGNQLDTLEGLSKLYSLETLNVSKNKLAEVENVQCIGKLPCLENLILRDNPIRTVVDYRVAVLELFGDRAKEVLL------DKEATTQQEL 442          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: A0A433SNA0 (PX domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_021580 PE=4 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.480e-55
Identity = 135/423 (31.91%), Postives = 233/423 (55.08%), Query Frame = 2
Query:  155 FTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQT 1423
            FT Y + V   S  +W ++ RYSEF +L+++L +     K   PPK++F  ++E  + +R+R LE+Y+  II  + +++P  LA FL+ +KYEIHGIT ++A+ L+  GE+LL +   +E + L +YS+ +R+  P PT       +D G++L+ I   K +K+      V       GTSNI    +PFD+++F  +Q+L +    +  + GL  +   +  L+ H    S++++L  D  H  +  ED     G W     A+FS NS + I +SI  L  +  L+LS N +  I NL +L  LT LDLS+N +   +  S   KLG++K L++  N+L  L+   ++FSL+ LD+S N+I   K L  + +L C+E+L +  N + ++  + +   ++F D++  + ++    D   + T
Sbjct:   59 FTLYVITVTVGS-YSWTVKHRYSEFHELHEKLTASYKLDKSLLPPKKLFGNQTESFIKKRQRELEIYLQTIILYLAHHIPSCLAYFLDFDKYEIHGITQSMAEDLYNRGEALLFSKEFYEATSLQLYSLTERLKLPEPTCESGDVKKDLGHILDFITRCKYLKVTCEREPV-------GTSNILMNKVPFDLTLFKSLQTLHVQGCNMRLILGLEVVKQTLTKLEVHKSTSSMKEVLLQDAHHWRA--EDGGIIVGHWDLVTEANFSTNSFSEIHESIQLLPNLERLDLSHNVLESIQNLQWLSQLTYLDLSHNNIRTLD--SLHTKLGNLKCLLVSHNRLEHLHGFAKLFSLQTLDISHNSISTIKELWFVSQLPCVESLIVTGNAVTNSLDYRTKTLEMFGDRVREVVLDKEPSDQKELDT 469          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Cavefish
Match: nisch (nischarin [Source:NCBI gene;Acc:103045858])

HSP 1 Score: 195.667 bits (496), Expect = 5.030e-50
Identity = 121/405 (29.88%), Postives = 207/405 (51.11%), Query Frame = 2
Query:  200 WKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDIL------FGDLVHRSSNIE-DLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINS 1393
            W ++ RYS+F  L+++L S     +   PPK++    S+ ++ +R++ LE+Y+  ++S      P+ L+ FL +  YEI+GI   LA+ LF  GE LL    +F +  L +Y+I Q++    PT        D G++L+     K +KI        G+  + G+SNI+   LPFD+S+F  +  +E+     T +KGL  +   +  L  H    S+++IL      F         I+  +      W    + D S N I  ID+S+  + +V  L+LS N++  ++NL +L  L  LDLS N L + E +    KLG++K L L GN+L  L+ + +++SL  LD+S N + +   +  +  L CLE LF+  NP+C    + + +   F D+   + ++ 
Sbjct:   40 WIIKHRYSDFHDLHEKLTSEKKIDRHLLPPKKIIGKNSKSLVEKRQKELEVYLQTLLSRFPVAAPKVLSVFLHLHLYEINGIAATLAEDLFHRGEQLLVAGEVFLLRPLQLYAITQQLKLAKPTCANGDAKADLGHILDFACRLKYLKIP-------GTKGVVGSSNIEEHHLPFDLSVFKSLLQIEITDCSSTQIKGLPSLKPTLATLSIHLSAASMKEILVPESAEFAQWEPEGVAIDCPVTAIIPTWKMLTTLDMSRNYICSIDESVKLIPEVEFLDLSHNKLFLVENLQHLYNLIHLDLSYNKLTVLEGV--HTKLGNIKTLNLAGNQLETLSGLSKLYSLVNLDLSSNRLAQLDEIKHIGTLPCLEKLFLTNNPMCIIPDYRTKVLAQFCDRASEVCLDG 435          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Cavefish
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:103043491])

HSP 1 Score: 63.5438 bits (153), Expect = 1.438e-9
Identity = 62/200 (31.00%), Postives = 104/200 (52.00%), Query Frame = 2
Query:  737 FNGVQSLELNSVK---ITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELD---LSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            F  +++LEL  +    +  L+G+Y    V    K+   L+ L  +  GDL   SS +        PW+   + +FS NSI+ +D+S+  L  +  L+LS N+I   D   +L  LTEL+   L+ N L     +  + K+  V  LIL+ N+L  +N ++++ SL++LD++ N + E   L PL  L  L  L ++ NP+
Sbjct:  108 FKSLKNLELKRIPPHCLEGLRGVYSQLEVFTCSKSLNSLEELLSLCGGDL---SSAL--------PWLELHTLNFSYNSISCLDESLSLLNVLKALDLSHNKIQ--DCAEFLKPLTELEHLNLAYNSLQRVPALGLNAKVKLVS-LILRNNELESINGVEQLSSLQHLDLAYNLLMEHSELAPLSLLHNLSTLTLEGNPL 293          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 54.299 bits (129), Expect = 9.975e-8
Identity = 51/172 (29.65%), Postives = 92/172 (53.49%), Query Frame = 2
Query:  803 MNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            M A +ENL++   L+ L+  L+ +++ +  N++ L N        +  D S N +  I+  + TL++V  L L  N+I++I+NL+ L  L  L++++N + + ENI     L S   L +  NK++KL  +D + +L  L +  N I + +GL  L     L+ L++  N I
Sbjct:   89 MIAQIENLESLTTLRELD--LYDNVLKKIENLDTLVNL-------EMLDISFNVLRKIE-GLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDS---LFIGKNKITKLQNLDSLTNLTVLSIQSNRITKIEGLSSLVN---LQELYLSHNGI 244          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Sea Lamprey
Match: lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:ZFIN;Acc:ZDB-GENE-050419-232])

HSP 1 Score: 53.9138 bits (128), Expect = 1.793e-7
Identity = 62/194 (31.96%), Postives = 90/194 (46.39%), Query Frame = 2
Query:  725 DISIFNG---VQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSV--KKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLE 1291
            DI I +G   +Q L+L+  KI  L  L  M  +VE   +H  L  L +               LR         K ADFS N+I+ + K +   K ++ L L  N ISEI  L     L  L L++N       I   + LGS+  + L L+GN L K+  +++++ LE +D+S N I   KGL    RL  L+
Sbjct:   37 DIGILSGYVHIQKLDLSHNKIKELSVLGNMPYLVELKVSHNQLTKLFEFSI------------LRFL-------KEADFSYNTISEM-KDMSVYKSLTKLVLDNNNISEIIGLEECGSLAYLSLAHN------RIRRLDGLGSLPLRYLCLRGNHLRKITGLEKLWKLEKVDLSGNKIRSLKGLEGHYRLQELD 204          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Yeast
Match: SDS22 (Regulatory subunit of the type 1 protein phosphatase (PP1) Glc7p; whether it functions as a positive or negative regulator of Glc7p is controversial; involved in the regulation of Glc7p nuclear localization and function [Source:SGD;Acc:S000001676])

HSP 1 Score: 49.6766 bits (117), Expect = 1.467e-6
Identity = 52/167 (31.14%), Postives = 78/167 (46.71%), Query Frame = 2
Query:  830 AHYCLKSLEDI------------LFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKL--NVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCL 1288
             H  +KSLED+            L  +L+   S +E L     P       DF +N I HI  ++  L ++++L+LSFN+I  I NL  L  L  L    N +   EN+S    L S+K L L GNK+  +  +  + + +LE + +  N+I     L PL  L  L
Sbjct:   50 VHLKIKSLEDLNLYRFKNLKQLCLRQNLIESISEVEVL-----PHDKIVDLDFYDNKIKHISSNVNKLTKLTSLDLSFNKIKHIKNLENLTDLENLYFVQNSISKIENLS---TLKSLKNLELGGNKVHSIEPDSFEGLSNLEEIWLGKNSIPRLINLHPLKNLKIL 208          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Nematostella
Match: EDO45359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ1])

HSP 1 Score: 175.252 bits (443), Expect = 2.483e-47
Identity = 125/415 (30.12%), Postives = 221/415 (53.25%), Query Frame = 2
Query:  119 RVTVPKYFFNKPFTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDI-------LFGDL--VHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESF 1336
            ++ VP       +  Y V V F +  +W +RKRY EF +L+D+L       +   PPK+ F       +  R+  LE+Y+++++    + +P  L  FLE  KY++ G+T NLAK LF+ G+ +L + + +  + L +Y I +R+  P PT   +    + GN+ + I++   +KIV      H SD++            +D+S+F  + +LE++ +++  ++GL ++   +++L  H     L+         LF  +   + SS +    NF+  W   + ADFSNN   +ID+S+  L  + +LNLS N I EI++L  L  L  LDLS+N L      + + KLG+++KL L  N+LS ++ +++++SL  LD+  N + E   ++ +  L CLENL ++ NP+    S+
Sbjct:    5 KIEVPAAEVIDGYAVYYVEV-FITEYSWLVRKRYREFRELHDKLVKEYHIDQSLLPPKKYFGNLDPDYIETRRLLLEIYLHKLLEKFEDNLPDQLDNFLEGFKYDVCGVTYNLAKELFETGDKILLDKQPYTFTPLQLYCITKRLALPVPTCDVHNIHAEIGNLYDFIQNLSHLKIVGKGQQFHLSDNV---------DFKYDLSLFKSLSNLEVSCIEMEAVQGLCQLLTQLKSLTVHQSAHLLKARIPHTTWNLFTPIGTTNGSSYLTPNSNFH-TWTDIRMADFSNNHFPYIDESVSLLPNIESLNLSHNCIEEINHLESLSELEVLDLSHNKLRAIPT-NLNAKLGNIRKLNLANNQLSCVDGLEKLYSLVELDLRSNLLTEVSSVVLIGDLPCLENLHLEGNPLTKESSY 407          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Nematostella
Match: EDO27024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAE7])

HSP 1 Score: 108.612 bits (270), Expect = 5.476e-25
Identity = 102/420 (24.29%), Postives = 194/420 (46.19%), Query Frame = 2
Query:  164 YEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYV--PRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSE-DFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDL-----------------VHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHY-LIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIF 1360
            Y++ V   SN +W + +RY EF +L+  L +L    K   PPK++      + L  R+ +LE Y+ ++++  + YV   + +  FL++  +++  +T  LAK +    +++      F ++   +Y I +++  P P     + S  + GN+   I   + +++         S S +  +N     L FDIS+F  ++SL LN   +  + GL ++   ++ L A++ LK+++++L   +                    ++ +   R    PW    + + S+N I  ID+S+  L  + +L+LSFN+   +D        LT+LDLS+N +      +    L  +K LIL  N L  L+ +D +  L  L +++N +        L  +S L  L +  NP+     +   IF  F
Sbjct:    4 YKIDVMTKSN-HWSVMRRYREFSELHKTLVNLYGIPKDMLPPKKLTANLKLHHLESRREALEHYLQKLVN-SSTYVSSSKEILAFLDVSSHDVMSVTQALAKEVSMVEDAIFVEKEHFSMTPTQLYCITKQLQLPEPIQATGETSAVELGNLYSFIYQLESLEV--NGKAEKESKSFHELAN----HLEFDISLFKVLKSLVLNGCPVKLINGLSELQTHLKYLTAYHSLKTMKELLVDRVYTKRKAPRVQGSVAAWRTQMTARLTQNRVVVQPWTHLTNLNLSHNKIVVIDESLRLLPALESLDLSFNEFESLDLQEVDCPSLTQLDLSHNSIQFVS--ATPRDLRHLKSLILNHNNLQSLSGLDCLVGLIELGIAENRVSTLTEFSKLTCMSQLRYLSVNGNPLTRETYYRVKIFHYF 413          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Nematostella
Match: EDO42476 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1B1])

HSP 1 Score: 70.8626 bits (172), Expect = 7.300e-13
Identity = 77/297 (25.93%), Postives = 123/297 (41.41%), Query Frame = 2
Query:  455 LAKMLFKHGESLLSNNRIFEISILSIYSINQRM--ISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSN------------NCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFI 1303
            LA++L  HG+ ++       +++ S+  +N R   I        +        + + ++    +K+VP N    G D L             ++S F  +Q LE+  V +  +KGL  + + +  L     + +L ++         S   DL +    W   + A+ S N I  +D+S+  L ++  L LS N I   D   Y  F +EL   N             CL LC N         +K LILK N L  L  I    +LE LDVS+N I  F+ L P+  L  L ++ I
Sbjct:   13 LARLLQTHGDHVVRGESKLCLTVSSLIYLNNRFEQIKTGQKICTDHARSAVTYLNDFLKKVVSLKLVPGNC--SGFDVL------------LNVSCFKNLQYLEIKKVPLGYIKGLQSLRSQLRGLTCQRSVIALSEVFV-------SCGGDLTSTPFLWSELREANLSYNGIEQLDESLKILPKLEVLILSHNSIKSSDRDEYWQFFSELSYLNLGYNFLEEVPRVPCLPLCVN--------KLKTLILKNNNLQNLEGIQHFSALETLDVSNNCISTFEELSPMAWLEKLTSVII 280          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Nematostella
Match: EDO40059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S882])

HSP 1 Score: 54.299 bits (129), Expect = 2.248e-7
Identity = 67/245 (27.35%), Postives = 116/245 (47.35%), Query Frame = 2
Query:  947 DFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESF------------ISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRR--------HLKESTMFD------------FNNLQTQFECSGEIFTNKDDRNLLMSIDIDMENISKK 1585
            D SNN +++I  ++ +L  +  L+LS N+IS++ ++     L ELDLS N +    +IS    L  +  L L+ N+L+ L+ + +  +L+ L +  N I   +   PL   S  E L+I  NP  S+ES             + ++  + L +  S +   L     P+   Q +S+R+         L+EST  +            FN+L T+      I T+K D+ LLM  ++ + NIS++
Sbjct:  237 DISNNKLSNIS-AVNSLSALEELDLSTNRISKVPDISRCKHLQELDLSRNQI---SDISGLRDLSGLNILRLESNQLTTLSSLGKHKNLQELYLGHNRISTVE--FPLSNSSVAE-LYIAGNPCLSSESVGYHQELHKVIPSLEIVDGVSLKRPSSSRGKPLMR---PLSASQVLSSRQVEEQLKAAMLEESTAMESLKSRFSIMRDLFNSLPTEHPKHHWITTDKADQELLMP-ELLLHNISQR 470          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 53.1434 bits (126), Expect = 3.177e-7
Identity = 48/149 (32.21%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  872 DLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            DL H    I+ ++NF       KS     N I  ++ ++ TL  +  L+   NQIS+I+NL  L+ L  LDLS N + + EN+   N L  ++KL L  NK+ ++  ++ +  L  +++  N I   +GL  L +   LE+LF+ +N I
Sbjct:   33 DLTH--GRIDKIQNFE-RLRCVKSLCLRRNEIKKLE-NLETLTSLEELDFYDNQISKIENLDRLVNLRILDLSFNVIKVIENL---NSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTK---LESLFVGKNKI 171          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: nisch (nischarin [Source:NCBI gene;Acc:101164628])

HSP 1 Score: 196.823 bits (499), Expect = 1.715e-50
Identity = 123/427 (28.81%), Postives = 219/427 (51.29%), Query Frame = 2
Query:  200 WKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKE 1459
            W ++ RYS+F +L+++L +     +   PPK++    S+ ++ +R++ LE+Y+  ++       P PLA FL    YEI+GI T LA+ LF  GE LL   ++F +  L +YSI+Q++    PT        D G++L+     + +KI        GS    GTSNI+  SLPFD+S+F  +  +E++      + GL  +   +  +        +  IL  +    S    +      P       W +  + D S+N I+ ID S+  + +V  L+LS+N++S ++NL +L  L  +DLS N L + E  +   +LG++K L L GN+L  L+ + +++SL  LD+S N + + + +  +  L CLE L +  NPIC +  + + +  +F D+   + ++  +  +  + T + +   R  KE
Sbjct:   40 WTVKHRYSDFHELHEKLTAEKKVDRGLLPPKKILGKNSKSLVERRQKELELYLQALLQQFPEATPTPLASFLLFHLYEINGIATALAEELFHRGEQLLQAGQVFCLHPLQLYSISQQLRLAKPTCFNGDAKSDLGHILDFTCRLRYLKI-------SGSRGSIGTSNIQETSLPFDLSVFKSLLQIEISDCSSQQIGGLPALRPSLVTMTVRRTTDFMTSILLPEASEFSQWEPEGLESACPVTAVIPVWRNLTTVDMSHNCISTIDSSVRVIPKVEFLDLSYNKLSSVENLQHLYNLVHVDLSFNNLRVLE--AAHTRLGNIKTLNLAGNQLECLSGLSKLYSLVNLDLSHNQLAQLEEIRNISHLPCLEKLNLSSNPICIDPDYRTKVLALFGDRAAEVCLDCKATMERELDTVEVLKAIRKAKE 457          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: nisch (nischarin [Source:NCBI gene;Acc:101164628])

HSP 1 Score: 196.823 bits (499), Expect = 2.179e-50
Identity = 123/427 (28.81%), Postives = 219/427 (51.29%), Query Frame = 2
Query:  200 WKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP-------WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKE 1459
            W ++ RYS+F +L+++L +     +   PPK++    S+ ++ +R++ LE+Y+  ++       P PLA FL    YEI+GI T LA+ LF  GE LL   ++F +  L +YSI+Q++    PT        D G++L+     + +KI        GS    GTSNI+  SLPFD+S+F  +  +E++      + GL  +   +  +        +  IL  +    S    +      P       W +  + D S+N I+ ID S+  + +V  L+LS+N++S ++NL +L  L  +DLS N L + E  +   +LG++K L L GN+L  L+ + +++SL  LD+S N + + + +  +  L CLE L +  NPIC +  + + +  +F D+   + ++  +  +  + T + +   R  KE
Sbjct:   40 WTVKHRYSDFHELHEKLTAEKKVDRGLLPPKKILGKNSKSLVERRQKELELYLQALLQQFPEATPTPLASFLLFHLYEINGIATALAEELFHRGEQLLQAGQVFCLHPLQLYSISQQLRLAKPTCFNGDAKSDLGHILDFTCRLRYLKI-------SGSRGSIGTSNIQETSLPFDLSVFKSLLQIEISDCSSQQIGGLPALRPSLVTMTVRRTTDFMTSILLPEASEFSQWEPEGLESACPVTAVIPVWRNLTTVDMSHNCISTIDSSVRVIPKVEFLDLSYNKLSSVENLQHLYNLVHVDLSFNNLRVLE--AAHTRLGNIKTLNLAGNQLECLSGLSKLYSLVNLDLSHNQLAQLEEIRNISHLPCLEKLNLSSNPICIDPDYRTKVLALFGDRAAEVCLDCKATMERELDTVEVLKAIRKAKE 457          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:101164384])

HSP 1 Score: 72.7886 bits (177), Expect = 2.391e-12
Identity = 63/204 (30.88%), Postives = 102/204 (50.00%), Query Frame = 2
Query:  719 PFDISIFNGVQSLELNSVK---ITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDN-LHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            P  I  F  ++ LEL  +    +  L+G+Y    V     +   L+ L  +  GDL   SS +        PW+   + +FS N+I  +D+SI  L  + +L+LS N+I E    L  L  L  L+L  NCL     +  S +   +  LIL+ N+L  +N ++++ SL++LD++ N + E   L PL  L CL  L ++ NP+
Sbjct:  102 PVKIFPFKSLKCLELKRIPPHLLEGLRGVYSQLEVFTCSNSLSSLEELLSLCGGDL---SSAL--------PWLELHTLNFSYNAIACLDQSISLLNVLKSLDLSHNKIQECTEFLKPLSELEHLNLGYNCLQRAPTLGPSAR-SKLLTLILRNNELETINGVEQLSSLQHLDLAYNLLLEHSQLAPLSLLHCLNTLNLQGNPL 293          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:101164384])

HSP 1 Score: 72.4034 bits (176), Expect = 2.527e-12
Identity = 63/204 (30.88%), Postives = 102/204 (50.00%), Query Frame = 2
Query:  719 PFDISIFNGVQSLELNSVK---ITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDN-LHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            P  I  F  ++ LEL  +    +  L+G+Y    V     +   L+ L  +  GDL   SS +        PW+   + +FS N+I  +D+SI  L  + +L+LS N+I E    L  L  L  L+L  NCL     +  S +   +  LIL+ N+L  +N ++++ SL++LD++ N + E   L PL  L CL  L ++ NP+
Sbjct:  102 PVKIFPFKSLKCLELKRIPPHLLEGLRGVYSQLEVFTCSNSLSSLEELLSLCGGDL---SSAL--------PWLELHTLNFSYNAIACLDQSISLLNVLKSLDLSHNKIQECTEFLKPLSELEHLNLGYNCLQRAPTLGPSAR-SKLLTLILRNNELETINGVEQLSSLQHLDLAYNLLLEHSQLAPLSLLHCLNTLNLQGNPL 293          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: stk11ip (serine/threonine kinase 11 interacting protein [Source:NCBI gene;Acc:101164384])

HSP 1 Score: 72.4034 bits (176), Expect = 2.861e-12
Identity = 63/204 (30.88%), Postives = 102/204 (50.00%), Query Frame = 2
Query:  719 PFDISIFNGVQSLELNSVK---ITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDN-LHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPI 1318
            P  I  F  ++ LEL  +    +  L+G+Y    V     +   L+ L  +  GDL   SS +        PW+   + +FS N+I  +D+SI  L  + +L+LS N+I E    L  L  L  L+L  NCL     +  S +   +  LIL+ N+L  +N ++++ SL++LD++ N + E   L PL  L CL  L ++ NP+
Sbjct:  102 PVKIFPFKSLKCLELKRIPPHLLEGLRGVYSQLEVFTCSNSLSSLEELLSLCGGDL---SSAL--------PWLELHTLNFSYNAIACLDQSISLLNVLKSLDLSHNKIQECTEFLKPLSELEHLNLGYNCLQRAPTLGPSAR-SKLLTLILRNNELETINGVEQLSSLQHLDLAYNLLLEHSQLAPLSLLHCLNTLNLQGNPL 293          
BLAST of Origin recognition complex subunit 1 vs. Planmine SMEST
Match: SMESG000024931.1 (SMESG000024931.1)

HSP 1 Score: 2484.91 bits (6439), Expect = 0.000e+0
Identity = 1218/1221 (99.75%), Postives = 1218/1221 (99.75%), Query Frame = 2
Query:   80 MANWFSDNSQTKFRVTVPKYFFNKPFTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKESTMFDFNNLQTQFECSGEIFTNKDDRNLLMSIDIDMENISKKESILYIPELYNILIYWYFTAVKRAVLPSKILWCTEIFPPNLCMRPVPVLIISCNTLSASILQCSLKVSANNSSSVLTIRPHRFYDINKSLRNLVIGADKMFIRFDMNNDNRYLYLINNSHFVDSFMGHLYHIDDEIVKFGDSRLIFLNEDDRMESLRRFIDVWRLDLVGNLLRSGNQRNINTNTESEILFCSRAMLKMQNGFHLLLTIVVTRQLLCLVDERIYDWPDLVRPTSCTDLATMTHYSPQTSSSNQFQFLRINAYFFHQIKSCIQQPAPLETLLGTWTPTFSHSLQIAFNPISSNLKEPIRLHFETIQKSDNACQIINQICENEELPTVISSSEPVSYKHVPQEIPSFLKHLNSSFQEIRLNLSLFCPKLSTIALSPIDEIVSFCYSKIEILENSKIFGILWTKFIYYKFDSNDEYEKTKEESPCLLCISPNQIHIIYETEEPVLLESECWSDPESDQPDVNNNPTKLNILSIYFDDVFKIFIGLYHQWITLCCRSSELESENRRLILIMRNTDQSKQLVNWIKSSFKDQSLDERLSEKLEYAHDDGNIDELLFQIRKVSRCEDIDLIHYTSIEDARIELPSISRSITNDSTENFTYAVVITSSNISIIRHNIVEFPVRYFGPGAVRQSPFHMQYQMMRVVPLYECVQIQLPGHDKNLLIIIIQSHCQNNSNSTYKIQLSVACQKEQKHLIDKLRQQWTKCLQTDVPLRVIVC 3742
            MANWFSDNSQTKFRVTVPKYFFNKPFTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNG QSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKESTMFDFNNLQTQFECSGEI TNKDDRNLLMSIDIDMENISKKESILYIPELYNILIYWYFTAVKRAVLPSKILWCTEIFPPNLCMRPVPVLIISCNTLSASILQCSLKVSANNSSSVLTIRPHRFYDINKSLRNLVIGADKMFIRFDMNNDNRYLYLINNSHFVDSFMGHLYHIDDEIVKFGDSRLIFLNEDDRMESLRRFIDVWRLDLVGNLLRSGNQRNINTNTESEILFCSRAMLKMQNGFHLLLTIVVTRQLLCLVDERIYDWPDLVRPTSCTDLATMTHYSPQTSSSNQFQFLRINAYFFHQIKSCIQQPAPLETLLGTWTPTFSHSLQIAFNPISSNLKEPIRLHFETIQKSDNACQIINQICENEELPTVISSSEPVSYKHVPQEIPSFLKHLNSSFQEIRLNLSLFCPKLSTIALSPIDEIVSFCYSKIEILENSKIFGILWTKFIYYKFDSNDEYEKTKEESPCLLCISPNQIHIIYETEEPVLLESECWSDPESDQPDVNNNPTKLNILSIYFDDVFKIFIGLYHQWITLCCRSSELESENRRLILIMRNTDQSKQLVNWIKSSFKDQSLDERLSEKLEYAHDDGNIDELLFQIR VSRCEDIDLIHYTSIEDARIELPSISRSITNDSTENFTYAVVITSSNISIIRHNIVEFPVRYFGPGAVRQSPFHMQYQMMRVVPLYECVQIQLPGHDKNLLIIIIQSHCQNNSNSTYKIQLSVACQKEQKHLIDKLRQQWTKCLQTDVPLRVIVC
Sbjct:    1 MANWFSDNSQTKFRVTVPKYFFNKPFTDYEVLVQFPSNINWKLRKRYSEFLKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGAQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQEISNRRHLKESTMFDFNNLQTQFECSGEICTNKDDRNLLMSIDIDMENISKKESILYIPELYNILIYWYFTAVKRAVLPSKILWCTEIFPPNLCMRPVPVLIISCNTLSASILQCSLKVSANNSSSVLTIRPHRFYDINKSLRNLVIGADKMFIRFDMNNDNRYLYLINNSHFVDSFMGHLYHIDDEIVKFGDSRLIFLNEDDRMESLRRFIDVWRLDLVGNLLRSGNQRNINTNTESEILFCSRAMLKMQNGFHLLLTIVVTRQLLCLVDERIYDWPDLVRPTSCTDLATMTHYSPQTSSSNQFQFLRINAYFFHQIKSCIQQPAPLETLLGTWTPTFSHSLQIAFNPISSNLKEPIRLHFETIQKSDNACQIINQICENEELPTVISSSEPVSYKHVPQEIPSFLKHLNSSFQEIRLNLSLFCPKLSTIALSPIDEIVSFCYSKIEILENSKIFGILWTKFIYYKFDSNDEYEKTKEESPCLLCISPNQIHIIYETEEPVLLESECWSDPESDQPDVNNNPTKLNILSIYFDDVFKIFIGLYHQWITLCCRSSELESENRRLILIMRNTDQSKQLVNWIKSSFKDQSLDERLSEKLEYAHDDGNIDELLFQIRNVSRCEDIDLIHYTSIEDARIELPSISRSITNDSTENFTYAVVITSSNISIIRHNIVEFPVRYFGPGAVRQSPFHMQYQMMRVVPLYECVQIQLPGHDKNLLIIIIQSHCQNNSNSTYKIQLSVACQKEQKHLIDKLRQQWTKCLQTDVPLRVIVC 1221          
BLAST of Origin recognition complex subunit 1 vs. Planmine SMEST
Match: SMESG000021527.1 (SMESG000021527.1)

HSP 1 Score: 204.527 bits (519), Expect = 6.206e-56
Identity = 141/434 (32.49%), Postives = 231/434 (53.23%), Query Frame = 2
Query:  164 YEVLVQFPSN-INWKLRKRYSEFLKLYDELASLDSNFK-VYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISIINNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILSIYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSDSLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGP---WMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNN---CLYLCEN----ISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQ 1429
            YE+ ++   N I W   KRYSEFL+L++ L  +D + K +YFPPK+ F   S   L +R++ LE Y+N ++       P  L  F++  +YEIHGIT NLA+  F++G+ ++     FE S+L IYSINQR+ S +PTN+ N PS DF +V+E +   + +K+        GS S  GTSNI    L  D+S F+ V  LE+ +V +  ++G   +   V+ +K    L S++ +  GDL+   +          P   W+  +  D SNN +  +D S+   K+V  + L+ N + ++ +L  L  L  L+LS N    LY   N     +   +LG++  L L  N+L    +++ ++SL  L++  N I E + L  L  L CLE+L +  NPIC    +     ++F ++ + IK++  + D++  +  Q
Sbjct:   29 YEIEIKSKENDICWSFSKRYSEFLQLHESLCKIDDSLKQIYFPPKKSFNNLSIKFLCKRRQELEEYLNILLKKFP-IPPASLGNFIDWNQYEIHGITNNLARKFFQNGDLIIKEGFQFEFSVLQIYSINQRLQSQSPTNLSNDPSLDFVHVMEFVGRVRNVKVT-------GSSSAVGTSNIVMNKLELDMSRFHSVDKLEMTNVNLKYMRGFENLKETVKLMKVSSSLYSVKLLAIGDLLSIGNGDWVFGRDSVPTNCWLKVEHLDLSNNFLQGLDPSMTLFKKVRTVKLNNNLLVDVQHLDILENLRVLNLSQNKLGLLYTSSNRIPEPTLRGRLGNITDLDLSYNELCSARLVEGLYSLIKLNLGGNKIEEIEELESLATLQCLESLILLGNPICIKSGYRKSTLELFGERFNEIKLDLRAADEIEFRQLQ 454          
BLAST of Origin recognition complex subunit 1 vs. Planmine SMEST
Match: SMESG000041551.1 (SMESG000041551.1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.081e-7
Identity = 50/138 (36.23%), Postives = 75/138 (54.35%), Query Frame = 2
Query:  947 DFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMF--SLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESFISVIFD 1354
            D S+N I  ID  I +L  ++ LNLS N+I  I++L   + L  LDLS+N +    NISF   L  +K  ++ GN+++ L  ID     S+E L +++N I +   +  L  L  L+ L IK NP C  +S   + FD
Sbjct:   70 DLSHNKIISID-GIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISF---LSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENP-CLMKSSSEMEFD 202          
BLAST of Origin recognition complex subunit 1 vs. Planmine SMEST
Match: SMESG000002561.1 (SMESG000002561.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.668e-6
Identity = 57/200 (28.50%), Postives = 92/200 (46.00%), Query Frame = 2
Query:  737 FNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESF 1336
            F+ + SL+L +++I  +K L    A +  L  H C+  L     G L+      E   +F G W      D   N +  ID S+  L Q++ L++S N +  I  +  +  L  L+ S N +     I+       +K LI+  N L  L  I     L  L+ S N I  +K +  L  L+ L+NL ++ NPICS+ ++
Sbjct:  105 FSNLVSLQLENLQIEFVKHLKLHRATLLKLCVHNCIPKL-----GSLIELCGGDE---SFSGSWSELLHLDVRYNRLKSIDNSVSLLSQLTVLDVSRNDLESISFVEKIPTLVCLNASYNFIKTLPKIAN----HCLKVLIIGYNYLEGLANIVHFQLLSTLNASYNVISTYKYMSDLNELNFLKNLILRGNPICSSSNY 292          
BLAST of Origin recognition complex subunit 1 vs. Planmine SMEST
Match: SMESG000002561.1 (SMESG000002561.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.705e-6
Identity = 57/200 (28.50%), Postives = 92/200 (46.00%), Query Frame = 2
Query:  737 FNGVQSLELNSVKITNLKGLYKMNAVVENLKAHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHIDKSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFSNKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRLSCLENLFIKRNPICSNESF 1336
            F+ + SL+L +++I  +K L    A +  L  H C+  L     G L+      E   +F G W      D   N +  ID S+  L Q++ L++S N +  I  +  +  L  L+ S N +     I+       +K LI+  N L  L  I     L  L+ S N I  +K +  L  L+ L+NL ++ NPICS+ ++
Sbjct:  124 FSNLVSLQLENLQIEFVKHLKLHRATLLKLCVHNCIPKL-----GSLIELCGGDE---SFSGSWSELLHLDVRYNRLKSIDNSVSLLSQLTVLDVSRNDLESISFVEKIPTLVCLNASYNFIKTLPKIAN----HCLKVLIIGYNYLEGLANIVHFQLLSTLNASYNVISTYKYMSDLNELNFLKNLILRGNPICSSSNY 311          
The following BLAST results are available for this feature:
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NISCH2.750e-5430.45nischarin [Source:HGNC Symbol;Acc:HGNC:18006][more]
NISCH1.099e-5330.45nischarin [Source:HGNC Symbol;Acc:HGNC:18006][more]
NISCH1.522e-5130.45nischarin [Source:HGNC Symbol;Acc:HGNC:18006][more]
NISCH1.522e-5130.45nischarin [Source:HGNC Symbol;Acc:HGNC:18006][more]
STK11IP8.578e-1631.84serine/threonine kinase 11 interacting protein [So... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F13E9.15.193e-4629.57pep chromosome:WBcel235:IV:10864331:10873632:1 gen... [more]
sds-224.343e-732.00Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
C06A8.64.132e-636.73pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG118073.604e-3625.21gene:FBgn0033996 transcript:FBtr0087363[more]
CG118073.604e-3625.21gene:FBgn0033996 transcript:FBtr0310140[more]
CG118073.604e-3625.21gene:FBgn0033996 transcript:FBtr0310139[more]
CG90441.761e-1427.21gene:FBgn0031752 transcript:FBtr0333231[more]
CG90441.937e-1427.21gene:FBgn0031752 transcript:FBtr0273412[more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nisch6.479e-4829.27nischarin [Source:ZFIN;Acc:ZDB-GENE-050208-570][more]
nisch1.127e-4327.97nischarin [Source:ZFIN;Acc:ZDB-GENE-050208-570][more]
stk11ip1.474e-927.39serine/threonine kinase 11 interacting protein [So... [more]
stk11ip1.400e-831.00serine/threonine kinase 11 interacting protein [So... [more]
stk11ip1.920e-831.61serine/threonine kinase 11 interacting protein [So... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk11ip2.655e-1826.47serine/threonine kinase 11 interacting protein [So... [more]
stk11ip2.702e-1826.19serine/threonine kinase 11 interacting protein [So... [more]
stk11ip5.112e-1733.82serine/threonine kinase 11 interacting protein [So... [more]
stk11ip7.710e-1730.18serine/threonine kinase 11 interacting protein [So... [more]
stk11ip2.715e-1528.41serine/threonine kinase 11 interacting protein [So... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nisch1.650e-5629.51nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
Nisch1.660e-5529.61nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
Nisch1.008e-5229.61nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
Nisch5.573e-4229.29nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
Nisch9.285e-1532.28nischarin [Source:MGI Symbol;Acc:MGI:1928323][more]
back to top
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4G017|NISCH_RAT3.722e-5229.20Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch P... [more]
sp|Q80TM9|NISCH_MOUSE7.054e-5229.61Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 S... [more]
sp|Q9Y2I1|NISCH_HUMAN7.309e-5130.45Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV... [more]
sp|Q6P4K6|S11IP_XENTR1.180e-1726.47Serine/threonine-protein kinase 11-interacting pro... [more]
sp|Q8N1F8|S11IP_HUMAN4.119e-1531.84Serine/threonine-protein kinase 11-interacting pro... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4B5681.162e-6233.33PX domain-containing protein OS=Lottia gigantea OX... [more]
A0A210R4A07.812e-6233.11Nischarin OS=Mizuhopecten yessoensis OX=6573 GN=KP... [more]
A0A1S3I2R12.118e-6032.00nischarin isoform X2 OS=Lingula unguis OX=7574 GN=... [more]
A0A1S3I3Z65.727e-5932.09nischarin isoform X1 OS=Lingula unguis OX=7574 GN=... [more]
A0A433SNA01.480e-5531.91PX domain-containing protein (Fragment) OS=Elysia ... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nisch5.030e-5029.88nischarin [Source:NCBI gene;Acc:103045858][more]
stk11ip1.438e-931.00serine/threonine kinase 11 interacting protein [So... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ppp1r79.975e-829.65protein phosphatase 1, regulatory (inhibitor) subu... [more]
lrguk1.793e-731.96leucine-rich repeats and guanylate kinase domain c... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SDS221.467e-631.14Regulatory subunit of the type 1 protein phosphata... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453592.483e-4730.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270245.476e-2524.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424767.300e-1325.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400592.248e-727.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449373.177e-732.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nisch1.715e-5028.81nischarin [Source:NCBI gene;Acc:101164628][more]
nisch2.179e-5028.81nischarin [Source:NCBI gene;Acc:101164628][more]
stk11ip2.391e-1230.88serine/threonine kinase 11 interacting protein [So... [more]
stk11ip2.527e-1230.88serine/threonine kinase 11 interacting protein [So... [more]
stk11ip2.861e-1230.88serine/threonine kinase 11 interacting protein [So... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024931.10.000e+099.75SMESG000024931.1[more]
SMESG000021527.16.206e-5632.49SMESG000021527.1[more]
SMESG000041551.12.081e-736.23SMESG000041551.1[more]
SMESG000002561.11.668e-628.50SMESG000002561.1[more]
SMESG000002561.11.705e-628.50SMESG000002561.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023092 ID=SMED30023092|Name=Origin recognition complex subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3810bp
ATTTAAATTATTATTTAAATATTAGTTATTCCATTTTAAATAAATATCTT
TAATATAGCCTTTATTTTAATAATATATAATGGCAAATTGGTTTTCGGAT
AATAGCCAGACAAAATTTCGTGTAACAGTTCCTAAATATTTTTTTAACAA
ACCTTTTACCGATTATGAAGTATTGGTTCAATTTCCAAGTAATATAAATT
GGAAATTAAGAAAACGTTACAGTGAATTTCTAAAACTCTACGATGAATTG
GCAAGTTTAGATAGCAATTTTAAAGTATATTTTCCTCCAAAACAAATGTT
CAAAGCTAAATCCGAATATATTCTAACCCAGCGAAAGCGTTCACTGGAAA
TGTACATGAATGAGATAATTTCCATAATCAATAATTATGTGCCTCGTCCT
CTTGCTAAATTTCTCGAGATGGAAAAATATGAAATCCACGGAATCACAAC
AAATCTTGCAAAAATGTTATTCAAACATGGCGAATCGCTATTGTCCAATA
ACCGAATTTTTGAAATATCAATTCTTTCAATCTATTCCATCAACCAAAGA
ATGATCTCACCTGCTCCTACTAATATATATAATAAGCCGAGTGAAGATTT
TGGAAATGTGCTCGAAGTTATCGAATCTACAAAGAAAATCAAAATTGTTC
CGTATAATGTATTAGTTCATGGATCTGACAGTTTATATGGAACCAGTAAC
ATCAAAAGTGAATCTTTACCATTTGACATTTCAATATTCAATGGTGTTCA
GTCTCTTGAGCTGAATAGTGTCAAGATCACCAATCTCAAAGGCCTCTATA
AAATGAACGCAGTTGTTGAAAATCTGAAAGCTCACTATTGTCTCAAATCA
CTTGAAGATATTTTATTTGGAGATTTAGTGCACAGAAGCTCCAATATTGA
AGATTTGAGAAATTTCTATGGACCTTGGATGTCTACTAAATCAGCCGATT
TTTCCAATAATTCAATCACCCATATCGATAAAAGCATTGTAACATTAAAA
CAAGTGTCTAATCTGAACCTTTCCTTTAACCAAATATCAGAAATAGACAA
TCTCCACTATTTAATATTTCTAACAGAACTTGATTTGTCTAATAATTGCC
TCTACTTATGCGAAAATATCAGTTTCTCTAATAAACTTGGTAGTGTGAAA
AAGTTGATTCTAAAAGGCAATAAGCTATCGAAACTCAATGTAATTGATCG
AATGTTCTCATTGGAGTATTTAGATGTGTCTGATAATAACATCTGTGAAT
TTAAAGGTTTGCTGCCACTATGTCGTCTTTCTTGCCTTGAGAATCTTTTC
ATTAAAAGAAACCCAATTTGTAGCAACGAAAGTTTCATATCAGTTATTTT
CGACATTTTCCTCGATCAAATGGATTCAATCAAAATCAACAGTTTATCCT
ACGACGATCTACCTGTCCAAACGAAACAAGAAATTTCCAATCGAAGACAT
TTAAAAGAATCGACCATGTTCGATTTCAATAATTTGCAAACCCAGTTCGA
ATGCAGCGGCGAAATTTTTACTAACAAAGATGACCGGAACCTTTTGATGT
CCATCGACATAGATATGGAAAATATATCTAAGAAAGAGTCAATATTGTAT
ATTCCCGAGTTGTATAATATTCTTATATATTGGTATTTCACCGCAGTGAA
ACGAGCCGTTCTTCCTAGCAAGATTTTGTGGTGCACTGAGATATTTCCCC
CCAATTTATGCATGAGGCCAGTTCCGGTTCTGATTATCAGTTGTAACACA
CTTAGTGCTTCTATCCTTCAATGTTCATTGAAAGTTTCCGCAAACAATTC
CAGCTCTGTTCTCACAATACGCCCGCATCGATTTTATGATATAAATAAGA
GTTTAAGAAATCTGGTTATTGGAGCTGACAAAATGTTTATCCGGTTTGAC
ATGAACAACGACAACCGATATCTTTATCTCATCAATAATTCGCATTTCGT
GGACTCGTTCATGGGGCACCTTTACCACATTGATGATGAAATTGTCAAAT
TTGGTGATTCTAGATTGATATTCCTTAATGAGGATGATCGAATGGAATCC
TTGAGGAGATTCATTGATGTATGGAGGCTTGACTTGGTAGGAAACCTTTT
GAGATCTGGTAACCAGAGAAATATTAATACAAATACAGAAAGTGAAATAT
TATTCTGTTCAAGAGCAATGTTAAAAATGCAAAATGGTTTCCATCTACTG
TTGACAATTGTCGTTACTCGTCAGTTGCTATGTCTTGTTGACGAACGGAT
ATACGATTGGCCTGATCTCGTTCGACCGACAAGCTGTACTGATTTAGCTA
CAATGACACATTATTCACCTCAAACCTCCTCATCTAATCAATTCCAATTC
CTTAGAATTAACGCTTATTTCTTTCATCAAATTAAATCCTGTATCCAACA
ACCAGCCCCATTAGAAACCTTGCTAGGAACGTGGACTCCAACATTTAGTC
ATTCATTGCAGATTGCTTTTAACCCGATTAGTTCTAATCTGAAAGAACCA
ATAAGACTACATTTTGAGACCATTCAAAAATCAGACAATGCTTGTCAAAT
AATCAATCAGATTTGTGAAAACGAAGAATTGCCCACTGTAATTTCTAGTT
CCGAACCTGTTTCCTATAAACATGTTCCTCAAGAAATTCCTTCATTCTTG
AAACATCTTAATTCATCCTTTCAGGAAATCCGATTGAACTTATCCTTATT
TTGCCCGAAATTATCAACTATTGCGTTGTCACCAATTGACGAAATCGTTT
CATTTTGCTATTCGAAAATTGAAATTTTAGAAAATTCGAAGATCTTTGGA
ATACTCTGGACAAAGTTCATTTATTACAAATTCGATTCAAATGATGAGTA
TGAAAAAACGAAAGAAGAAAGCCCCTGTTTGCTGTGTATATCGCCGAATC
AAATCCACATCATATATGAAACCGAAGAGCCAGTTTTATTGGAATCGGAA
TGTTGGAGTGATCCTGAATCCGACCAACCAGATGTTAACAACAATCCTAC
AAAATTGAATATTTTGTCAATATATTTTGATGATGTTTTCAAAATTTTCA
TTGGACTCTATCATCAATGGATCACATTATGCTGCAGAAGCAGTGAACTC
GAATCGGAAAATCGGAGGCTGATCTTGATAATGCGAAACACAGACCAATC
AAAGCAGTTAGTCAATTGGATCAAATCATCATTCAAAGATCAATCATTGG
ATGAAAGGTTATCGGAAAAATTGGAATACGCCCATGACGATGGCAACATT
GACGAACTGCTTTTCCAAATTAGGAAGGTTTCAAGATGTGAGGATATTGA
TCTGATTCACTATACAAGCATTGAAGATGCACGAATTGAACTGCCTTCGA
TTTCCCGTTCAATTACAAACGACTCAACAGAAAATTTCACATATGCCGTG
GTGATCACTAGCTCGAATATCTCAATAATCCGTCACAATATTGTCGAATT
TCCCGTACGATATTTCGGTCCAGGAGCGGTTCGACAATCGCCATTCCATA
TGCAGTATCAGATGATGCGAGTCGTACCTTTGTATGAATGCGTCCAGATC
CAACTGCCGGGACACGACAAAAACCTTCTGATAATTATCATTCAGTCTCA
TTGTCAGAACAATTCCAATTCCACGTACAAGATCCAGCTGTCGGTTGCTT
GCCAGAAAGAGCAGAAACATCTCATTGATAAGTTGCGGCAGCAGTGGACA
AAATGTCTGCAAACCGATGTTCCATTAAGAGTTATTGTTTGCTAGAAATC
TCTATTTTTATACTTGTGATAAATTATTTTTCTATGAGAAACTATTAATT
TGATTTTATC
back to top

protein sequence of SMED30023092-orf-1

>SMED30023092-orf-1 ID=SMED30023092-orf-1|Name=SMED30023092-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1222bp
MANWFSDNSQTKFRVTVPKYFFNKPFTDYEVLVQFPSNINWKLRKRYSEF
LKLYDELASLDSNFKVYFPPKQMFKAKSEYILTQRKRSLEMYMNEIISII
NNYVPRPLAKFLEMEKYEIHGITTNLAKMLFKHGESLLSNNRIFEISILS
IYSINQRMISPAPTNIYNKPSEDFGNVLEVIESTKKIKIVPYNVLVHGSD
SLYGTSNIKSESLPFDISIFNGVQSLELNSVKITNLKGLYKMNAVVENLK
AHYCLKSLEDILFGDLVHRSSNIEDLRNFYGPWMSTKSADFSNNSITHID
KSIVTLKQVSNLNLSFNQISEIDNLHYLIFLTELDLSNNCLYLCENISFS
NKLGSVKKLILKGNKLSKLNVIDRMFSLEYLDVSDNNICEFKGLLPLCRL
SCLENLFIKRNPICSNESFISVIFDIFLDQMDSIKINSLSYDDLPVQTKQ
EISNRRHLKESTMFDFNNLQTQFECSGEIFTNKDDRNLLMSIDIDMENIS
KKESILYIPELYNILIYWYFTAVKRAVLPSKILWCTEIFPPNLCMRPVPV
LIISCNTLSASILQCSLKVSANNSSSVLTIRPHRFYDINKSLRNLVIGAD
KMFIRFDMNNDNRYLYLINNSHFVDSFMGHLYHIDDEIVKFGDSRLIFLN
EDDRMESLRRFIDVWRLDLVGNLLRSGNQRNINTNTESEILFCSRAMLKM
QNGFHLLLTIVVTRQLLCLVDERIYDWPDLVRPTSCTDLATMTHYSPQTS
SSNQFQFLRINAYFFHQIKSCIQQPAPLETLLGTWTPTFSHSLQIAFNPI
SSNLKEPIRLHFETIQKSDNACQIINQICENEELPTVISSSEPVSYKHVP
QEIPSFLKHLNSSFQEIRLNLSLFCPKLSTIALSPIDEIVSFCYSKIEIL
ENSKIFGILWTKFIYYKFDSNDEYEKTKEESPCLLCISPNQIHIIYETEE
PVLLESECWSDPESDQPDVNNNPTKLNILSIYFDDVFKIFIGLYHQWITL
CCRSSELESENRRLILIMRNTDQSKQLVNWIKSSFKDQSLDERLSEKLEY
AHDDGNIDELLFQIRKVSRCEDIDLIHYTSIEDARIELPSISRSITNDST
ENFTYAVVITSSNISIIRHNIVEFPVRYFGPGAVRQSPFHMQYQMMRVVP
LYECVQIQLPGHDKNLLIIIIQSHCQNNSNSTYKIQLSVACQKEQKHLID
KLRQQWTKCLQTDVPLRVIVC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0035091phosphatidylinositol binding
GO:0005515protein binding
GO:0005178integrin binding
GO:0042802identical protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036871PX_dom_sf
IPR001683Phox
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005768endosome
GO:0005769early endosome
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0055037recycling endosome
Vocabulary: biological process
TermDefinition
GO:0006006glucose metabolic process
GO:0006915apoptotic process
GO:0008217regulation of blood pressure
GO:0016601Rac protein signal transduction
GO:0030036actin cytoskeleton organization
GO:0030336negative regulation of cell migration
GO:0032228regulation of synaptic transmission, GABAergic
GO:0048243norepinephrine secretion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 201..342
e-value: 1.7E-8
score: 35.8
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 343..454
e-value: 1.6E-11
score: 45.8
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 9..121
e-value: 1.3E-18
score: 68.8
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 11..116
IPR001683Phox homologous domainPFAMPF00787PXcoord: 24..112
e-value: 2.7E-10
score: 40.2
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 7..119
score: 11.383
NoneNo IPR availablePANTHERPTHR15454:SF35NISCHARINcoord: 38..414
NoneNo IPR availablePANTHERPTHR15454NISCHARIN RELATEDcoord: 38..414
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 290..427
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 377..398
score: 8.259
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 355..376
score: 5.417
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 285..306
score: 4.678
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 222..243
score: 4.508
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 308..329
score: 7.997
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 330..351
score: 6.534
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 402..423
score: 4.593
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 133..153
score: 5.086