MORN repeat-containing protein 3

Overview
NameMORN repeat-containing protein 3
Smed IDSMED30023091
Length (bp)972
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MORN repeat-containing protein 3 (SMED30023091) t-SNE clustered cells

Violin plots show distribution of expression levels for MORN repeat-containing protein 3 (SMED30023091) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MORN repeat-containing protein 3 (SMED30023091) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MORN repeat-containing protein 3 (SMED30023091) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023091

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023091SMESG000011788.1 SmedASXL_004868SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30023091SMESG000011788.1 dd_Smed_v4_3784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023091SMESG000011788.1 dd_Smed_v4_3784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023091SMESG000011788.1 dd_Smed_v4_3784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023091SMESG000011788.1 dd_Smed_v4_3784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30023091SMESG000011788.1 dd_Smed_v4_3784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023091SMESG000011788.1 dd_Smed_v6_3784_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023091SMESG000011788.1 dd_Smed_v4_3784_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30023091SMESG000011788.1 dd_Smed_v4_3784_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MORN repeat-containing protein 3 vs. Ensembl Human
Match: AC084018.3 (MORN repeat-containing protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q6PF18])

HSP 1 Score: 220.705 bits (561), Expect = 1.501e-70
Identity = 101/228 (44.30%), Postives = 157/228 (68.86%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYF 876
              +  +  W   D+KA + GL   +Y VNGD YVG+W +N+K+G+GT     +G +YEGDWK  K++G+G LS+   +     ++YSG WK + + G+G  ++   E+YEG+W   +R+GWGRMY ++G++YEG+WEND+  G+GMLR KNGNRYEG W+ GM+NG G+++++D GQ+ +G WV+N++KCG + D+ R+ AP PT+FP+  +++  P  V+ EA   F
Sbjct:    6 CPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMF 233          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Human
Match: AC084018.3 (MORN repeat-containing protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q6PF18])

HSP 1 Score: 220.705 bits (561), Expect = 1.501e-70
Identity = 101/228 (44.30%), Postives = 157/228 (68.86%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYF 876
              +  +  W   D+KA + GL   +Y VNGD YVG+W +N+K+G+GT     +G +YEGDWK  K++G+G LS+   +     ++YSG WK + + G+G  ++   E+YEG+W   +R+GWGRMY ++G++YEG+WEND+  G+GMLR KNGNRYEG W+ GM+NG G+++++D GQ+ +G WV+N++KCG + D+ R+ AP PT+FP+  +++  P  V+ EA   F
Sbjct:    6 CPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMF 233          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Human
Match: MORN3 (MORN repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:29807])

HSP 1 Score: 220.705 bits (561), Expect = 1.501e-70
Identity = 101/228 (44.30%), Postives = 157/228 (68.86%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYF 876
              +  +  W   D+KA + GL   +Y VNGD YVG+W +N+K+G+GT     +G +YEGDWK  K++G+G LS+   +     ++YSG WK + + G+G  ++   E+YEG+W   +R+GWGRMY ++G++YEG+WEND+  G+GMLR KNGNRYEG W+ GM+NG G+++++D GQ+ +G WV+N++KCG + D+ R+ AP PT+FP+  +++  P  V+ EA   F
Sbjct:    6 CPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMF 233          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Human
Match: MORN3 (MORN repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:29807])

HSP 1 Score: 132.109 bits (331), Expect = 2.809e-37
Identity = 64/141 (45.39%), Postives = 97/141 (68.79%), Query Frame = 1
Query:  217 FWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLR 636
             W   D+KA + GL   +Y VNGD YVG+W +N+K+G+GT     +G +YEGDWK  K++G+G LS+   +     ++YSG WK + + G+G  ++   E+YEG+W   +R+GWGRMY ++G++YEG+WEND+  G+GMLR
Sbjct:   13 LWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLR 153          

HSP 2 Score: 54.6842 bits (130), Expect = 1.513e-8
Identity = 39/108 (36.11%), Postives = 56/108 (51.85%), Query Frame = 1
Query:  448 YSGGWKNNLRHGFG-ENWYSSNEFYEGEWYEGKRNGWGRMYEADGN------VYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNN 750
            Y G WK+N++HG G + W      YEG+W  GKR+G+G +   D        VY G W+ D+  G G+        YEG W    R+G G+ YY + G + +G W N+
Sbjct:   38 YVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSN-GDIYEGQWEND 144          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Human
Match: MORN3 (MORN repeat containing 3 [Source:HGNC Symbol;Acc:HGNC:29807])

HSP 1 Score: 132.109 bits (331), Expect = 2.809e-37
Identity = 64/141 (45.39%), Postives = 97/141 (68.79%), Query Frame = 1
Query:  217 FWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLR 636
             W   D+KA + GL   +Y VNGD YVG+W +N+K+G+GT     +G +YEGDWK  K++G+G LS+   +     ++YSG WK + + G+G  ++   E+YEG+W   +R+GWGRMY ++G++YEG+WEND+  G+GMLR
Sbjct:   13 LWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLR 153          

HSP 2 Score: 54.6842 bits (130), Expect = 1.513e-8
Identity = 39/108 (36.11%), Postives = 56/108 (51.85%), Query Frame = 1
Query:  448 YSGGWKNNLRHGFG-ENWYSSNEFYEGEWYEGKRNGWGRMYEADGN------VYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNN 750
            Y G WK+N++HG G + W      YEG+W  GKR+G+G +   D        VY G W+ D+  G G+        YEG W    R+G G+ YY + G + +G W N+
Sbjct:   38 YVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSN-GDIYEGQWEND 144          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Celegans
Match: jph-1 (JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667])

HSP 1 Score: 50.8322 bits (120), Expect = 7.452e-7
Identity = 26/60 (43.33%), Postives = 37/60 (61.67%), Query Frame = 1
Query:  502 SSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGM 681
            SS E Y GEW    R+G+G    +DG  Y+GEW N+  CG G+   K+G + EG++KN +
Sbjct:  278 SSIETYMGEWKNDMRSGFGVCERSDGLKYQGEWANNAKCGYGVTTFKDGTKEEGRYKNNI 337          

HSP 2 Score: 49.2914 bits (116), Expect = 2.421e-6
Identity = 44/134 (32.84%), Postives = 64/134 (47.76%), Query Frame = 1
Query:  355 GLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGN-VYEGEWENDQMCGQGMLRNKNGN-RYEGQWKNGMRNGEGKYYYID----KGQMLKGI 738
            G  Y G W++ K +G GV +  + K  Y    +G W           W S N  Y+G+W  GKR+G G   E  G  +Y+GEW        G+ ++ N   RY+G W  G  +G G   Y+D    +GQ L+G+
Sbjct:   11 GGTYVGGWEEGKAHGHGVCTGPQAKGEY----AGAWHYGFEVSGVYTWPSGNT-YQGQWQNGKRHGLG--IEQRGRWLYKGEWTQGYKGRYGVRQSANSQARYQGTWSAGFHDGYGTEIYVDSGSYQGQWLRGM 137          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Fly
Match: CG30429 (gene:FBgn0050429 transcript:FBtr0072450)

HSP 1 Score: 118.627 bits (296), Expect = 8.217e-31
Identity = 76/228 (33.33%), Postives = 119/228 (52.19%), Query Frame = 1
Query:  220 WYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRG---TMYLTSQ----------GLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNR-ETAPHPTEFPLRNIELESPYKVIKE 861
            ++  +K     G   T Y+  G  Y G W  N   G G   T   T Q           L+YEGDW  +K+ G G +  K+G +  + IYSG W ++++ G G+ +YS    Y G+W + +R+G G  +  DGN+Y GEWE D   G G++   NGNRYEG +  G +NGEG +Y++  GQ+ KG+W N+  K   + D  +       T +P+    L+ P +++++
Sbjct:    8 FFCPNKPVCSSGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMNKRQGVGSMLRKRGTEV-QLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWENDNLKTSVVQDEPKIRCNAVITSYPIPRNYLKYPNEIMRD 234          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Fly
Match: CG14490 (gene:FBgn0034281 transcript:FBtr0086801)

HSP 1 Score: 111.309 bits (277), Expect = 4.318e-29
Identity = 61/164 (37.20%), Postives = 93/164 (56.71%), Query Frame = 1
Query:  283 GDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLK-GIWVNNVSKCGQL 771
            G QY G W     +G G    TS GL+YEG W+  +++G G L  K+     E+IY G W+ N R G G+ +Y     Y G+W   +R+G G +++ADG +Y GEW  D+M  +G+L    GNRY GQ++ G ++G G +Y+   GQ ++ G W  ++ +   L
Sbjct:   19 GGQYQGKWLGQQPHGFGVKQ-TSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGCKSGSGVFYHASNGQRIQHGFWSKDICRTSLL 181          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0079861)

HSP 1 Score: 63.5438 bits (153), Expect = 8.226e-11
Identity = 56/190 (29.47%), Postives = 89/190 (46.84%), Query Frame = 1
Query:  355 GLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGF---GENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNK--NGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWN-RETAP------------HPTEFPLRNIELESPYKVIKEAEE 870
            G  Y G W + K +G GV +  K    ++  Y+G W     +GF   G   + S   YEG+W  G+R+G G + +    +Y GEW  D   G+  +R    +  +YEG W  G ++G G   Y D G+  +G W     + G+ H +  R +AP            H +   LR+ E  +  K++++AEE
Sbjct:   57 GGTYCGGWDEGKAHGHGVCTGPK----HQGAYAGAWN----YGFEVSGSYIWPSGSHYEGQWQNGRRHGLG-VEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKY-QGQW-----QEGKRHGYGIRTSAPFGLASHHRRKNLHASLSSLRSGENGNAAKMVEKAEE 231          

HSP 2 Score: 58.151 bits (139), Expect = 5.207e-9
Identity = 37/116 (31.90%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNL---RHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGM 630
            Y G WN   +      Y+   G  YEG W++ +++G GV  + +      +IY G W  +    R+G  E+  S+ + YEG W EG ++G G    ADG  Y+G+W+  +  G G+
Sbjct:   84 YAGAWNYGFEVSGS--YIWPSGSHYEGQWQNGRRHGLGVEQIGR------QIYRGEWSKDGHKGRYGVRESTVSTAK-YEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGI 190          

HSP 3 Score: 57.3806 bits (137), Expect = 9.732e-9
Identity = 43/143 (30.07%), Postives = 56/143 (39.16%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWY-EGKRNGWG-RMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEG 696
            F +G  Y G W+    +G G          Y G W      GF V             Y G W+N  RHG G       + Y GEW  +G +  +G R        YEG W      G G     +G +Y+GQW+ G R+G G
Sbjct:   54 FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWN----YGFEVSGSYIWPSGSH--YEGQWQNGRRHGLGVEQIG-RQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYG 189          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0079860)

HSP 1 Score: 63.5438 bits (153), Expect = 8.226e-11
Identity = 56/190 (29.47%), Postives = 89/190 (46.84%), Query Frame = 1
Query:  355 GLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGF---GENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNK--NGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWN-RETAP------------HPTEFPLRNIELESPYKVIKEAEE 870
            G  Y G W + K +G GV +  K    ++  Y+G W     +GF   G   + S   YEG+W  G+R+G G + +    +Y GEW  D   G+  +R    +  +YEG W  G ++G G   Y D G+  +G W     + G+ H +  R +AP            H +   LR+ E  +  K++++AEE
Sbjct:   57 GGTYCGGWDEGKAHGHGVCTGPK----HQGAYAGAWN----YGFEVSGSYIWPSGSHYEGQWQNGRRHGLG-VEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKY-QGQW-----QEGKRHGYGIRTSAPFGLASHHRRKNLHASLSSLRSGENGNAAKMVEKAEE 231          

HSP 2 Score: 58.151 bits (139), Expect = 5.207e-9
Identity = 37/116 (31.90%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNL---RHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGM 630
            Y G WN   +      Y+   G  YEG W++ +++G GV  + +      +IY G W  +    R+G  E+  S+ + YEG W EG ++G G    ADG  Y+G+W+  +  G G+
Sbjct:   84 YAGAWNYGFEVSGS--YIWPSGSHYEGQWQNGRRHGLGVEQIGR------QIYRGEWSKDGHKGRYGVRESTVSTAK-YEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGI 190          

HSP 3 Score: 57.3806 bits (137), Expect = 9.732e-9
Identity = 43/143 (30.07%), Postives = 56/143 (39.16%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWY-EGKRNGWG-RMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEG 696
            F +G  Y G W+    +G G          Y G W      GF V             Y G W+N  RHG G       + Y GEW  +G +  +G R        YEG W      G G     +G +Y+GQW+ G R+G G
Sbjct:   54 FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWN----YGFEVSGSYIWPSGSH--YEGQWQNGRRHGLGVEQIG-RQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYG 189          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0304056)

HSP 1 Score: 63.5438 bits (153), Expect = 8.226e-11
Identity = 56/190 (29.47%), Postives = 89/190 (46.84%), Query Frame = 1
Query:  355 GLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGF---GENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNK--NGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWN-RETAP------------HPTEFPLRNIELESPYKVIKEAEE 870
            G  Y G W + K +G GV +  K    ++  Y+G W     +GF   G   + S   YEG+W  G+R+G G + +    +Y GEW  D   G+  +R    +  +YEG W  G ++G G   Y D G+  +G W     + G+ H +  R +AP            H +   LR+ E  +  K++++AEE
Sbjct:   57 GGTYCGGWDEGKAHGHGVCTGPK----HQGAYAGAWN----YGFEVSGSYIWPSGSHYEGQWQNGRRHGLG-VEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKY-QGQW-----QEGKRHGYGIRTSAPFGLASHHRRKNLHASLSSLRSGENGNAAKMVEKAEE 231          

HSP 2 Score: 58.151 bits (139), Expect = 5.207e-9
Identity = 37/116 (31.90%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNL---RHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGM 630
            Y G WN   +      Y+   G  YEG W++ +++G GV  + +      +IY G W  +    R+G  E+  S+ + YEG W EG ++G G    ADG  Y+G+W+  +  G G+
Sbjct:   84 YAGAWNYGFEVSGS--YIWPSGSHYEGQWQNGRRHGLGVEQIGR------QIYRGEWSKDGHKGRYGVRESTVSTAK-YEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGI 190          

HSP 3 Score: 57.3806 bits (137), Expect = 9.732e-9
Identity = 43/143 (30.07%), Postives = 56/143 (39.16%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWY-EGKRNGWG-RMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEG 696
            F +G  Y G W+    +G G          Y G W      GF V             Y G W+N  RHG G       + Y GEW  +G +  +G R        YEG W      G G     +G +Y+GQW+ G R+G G
Sbjct:   54 FEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWN----YGFEVSGSYIWPSGSH--YEGQWQNGRRHGLGVEQIG-RQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYG 189          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Zebrafish
Match: morn3 (MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-050417-152])

HSP 1 Score: 211.46 bits (537), Expect = 5.901e-67
Identity = 96/216 (44.44%), Postives = 147/216 (68.06%), Query Frame = 1
Query:  232 DKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLS-VKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYF 876
            D+KA K GLHHT+Y VNGDQY G+W +N K+G+G       G++Y+GDW+  K++GFG LS +      Y ++Y G W+N+ + G G  +YS++ FYEG+W   +R+GWGRM   +G +YEGEW  D+  G+G++   NGNR+ G W +G +NG G+ +++D+GQ+ +G WV++V+KCG + D+ RETA  PT +P+  + L+    V+ EA+ YF
Sbjct:   18 DRKAQKYGLHHTVYSVNGDQYTGEWMDNKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGSWRNDKKEGAGSYFYSASAFYEGQWSGDERSGWGRMQYENGELYEGEWLRDKHHGEGLILLANGNRFVGTWSDGKKNGHGQLFFLDRGQLYEGFWVDDVAKCGSISDFGRETAVRPTVYPIPKVCLQDSQAVLMEAQAYF 233          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Zebrafish
Match: morn3 (MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-050417-152])

HSP 1 Score: 211.075 bits (536), Expect = 9.296e-67
Identity = 96/216 (44.44%), Postives = 147/216 (68.06%), Query Frame = 1
Query:  232 DKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLS-VKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYF 876
            D+KA K GLHHT+Y VNGDQY G+W +N K+G+G       G++Y+GDW+  K++GFG LS +      Y ++Y G W+N+ + G G  +YS++ FYEG+W   +R+GWGRM   +G +YEGEW  D+  G+G++   NGNR+ G W +G +NG G+ +++D+GQ+ +G WV++V+KCG + D+ RETA  PT +P+  + L+    V+ EA+ YF
Sbjct:   18 DRKAQKYGLHHTVYSVNGDQYTGEWMDNKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGTWRNDKKEGAGSYFYSASAFYEGQWSGDERSGWGRMQYENGELYEGEWLRDKHHGEGLILLANGNRFVGTWSDGKKNGHGQLFFLDRGQLYEGFWVDDVAKCGSISDFGRETAVRPTVYPIPKVCLQDSQAVLMEAQAYF 233          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Zebrafish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:767792])

HSP 1 Score: 89.3521 bits (220), Expect = 3.629e-19
Identity = 66/188 (35.11%), Postives = 95/188 (50.53%), Query Frame = 1
Query:  271 YFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMY--EADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRN 825
            YF  G  Y G +++ + +G G  Y+ S GL Y+GD+K +   G G  +   G       Y G     +RHG G      +   Y G+WY GKR G G M+  +   + Y+GEW N+   G G     +GN YEGQW+N +R+GEG   +ID  Q   G W+N   +    H W R+ AP  +++P  N
Sbjct:  102 YFQGGHVYKGSFSHGLMHGYGE-YIWSDGLKYQGDFKVNVPMGHGTYTWLNGST-----YEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAP-SSQYPRMN 282          

HSP 2 Score: 64.3142 bits (155), Expect = 6.587e-11
Identity = 39/119 (32.77%), Postives = 60/119 (50.42%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGV---LSVKKGKDTYEKI--YSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQM 615
            + +G+ Y G W NN+++G GTM        Y G W +  + G G       +     Y ++  Y+G +   +RHG G+  Y+S   Y G+W   K++G GR    +G VYEGE+  D M
Sbjct:  221 YPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEFSKDCM 339          

HSP 3 Score: 60.8474 bits (146), Expect = 8.525e-10
Identity = 53/193 (27.46%), Postives = 79/193 (40.93%), Query Frame = 1
Query:  223 YDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKK------------------GKDTYEK--IYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNG-----WGRMYEADG-----NVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYY 708
            Y  D K N    H T  ++NG  Y G+ +  +++G G         +Y G W   K+ G G +   +                  GK  Y    +Y G W+NN+RHG G   W   ++ Y G+W  G + G     W R           N Y G++      GQG     +G  Y GQWK   ++G+G+Y +
Sbjct:  132 YQGDFKVNVPMGHGTYTWLNGSTYEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIF 324          

HSP 4 Score: 54.6842 bits (130), Expect = 8.062e-8
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFG-ENWY----SSNEF-----YEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQW 669
            Y G+W NN K G G     S G +YEG W+++ ++G G +   +  D  ++ YSG W N  + G G   W+     S+++     Y G++ +  R+G G+   A G +Y G+W+ D+  GQG    +NG  YEG++
Sbjct:  204 YKGEWVNNCKEGWGKRCYPS-GNVYEGQWRNNVRHGEGTM---RWID-LDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEF 334          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Zebrafish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:767792])

HSP 1 Score: 88.9669 bits (219), Expect = 3.837e-19
Identity = 66/188 (35.11%), Postives = 95/188 (50.53%), Query Frame = 1
Query:  271 YFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMY--EADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRN 825
            YF  G  Y G +++ + +G G  Y+ S GL Y+GD+K +   G G  +   G       Y G     +RHG G      +   Y G+WY GKR G G M+  +   + Y+GEW N+   G G     +GN YEGQW+N +R+GEG   +ID  Q   G W+N   +    H W R+ AP  +++P  N
Sbjct:  102 YFQGGHVYKGSFSHGLMHGYGE-YIWSDGLKYQGDFKVNVPMGHGTYTWLNGST-----YEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAP-SSQYPRMN 282          

HSP 2 Score: 64.3142 bits (155), Expect = 7.081e-11
Identity = 39/119 (32.77%), Postives = 60/119 (50.42%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGV---LSVKKGKDTYEKI--YSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQM 615
            + +G+ Y G W NN+++G GTM        Y G W +  + G G       +     Y ++  Y+G +   +RHG G+  Y+S   Y G+W   K++G GR    +G VYEGE+  D M
Sbjct:  221 YPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEFSKDCM 339          

HSP 3 Score: 60.8474 bits (146), Expect = 9.412e-10
Identity = 53/193 (27.46%), Postives = 79/193 (40.93%), Query Frame = 1
Query:  223 YDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKK------------------GKDTYEK--IYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNG-----WGRMYEADG-----NVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYY 708
            Y  D K N    H T  ++NG  Y G+ +  +++G G         +Y G W   K+ G G +   +                  GK  Y    +Y G W+NN+RHG G   W   ++ Y G+W  G + G     W R           N Y G++      GQG     +G  Y GQWK   ++G+G+Y +
Sbjct:  132 YQGDFKVNVPMGHGTYTWLNGSTYEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIF 324          

HSP 4 Score: 54.6842 bits (130), Expect = 8.355e-8
Identity = 45/136 (33.09%), Postives = 73/136 (53.68%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFG-ENWY----SSNEF-----YEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQW 669
            Y G+W NN K G G     S G +YEG W+++ ++G G +   +  D  ++ YSG W N  + G G   W+     S+++     Y G++ +  R+G G+   A G +Y G+W+ D+  GQG    +NG  YEG++
Sbjct:  204 YKGEWVNNCKEGWGKRCYPS-GNVYEGQWRNNVRHGEGTM---RWID-LDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEF 334          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Zebrafish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 82.0333 bits (201), Expect = 1.133e-16
Identity = 45/139 (32.37%), Postives = 75/139 (53.96%), Query Frame = 1
Query:  364 YEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYS-----SNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNR-----YEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNN 750
            Y+G W   K +G GV+    G+     +Y+G +KN    GFG+   S     S + Y+G+W +GK +G+G    A G VYEG ++++   G GMLR+   N      + GQW+   ++G G +  I +G+   G+W+++
Sbjct: 1006 YDGRWVSGKPHGRGVVKWPDGR-----MYTGTFKNGFEDGFGDYVVSNKTLNSCDHYQGQWKDGKMHGFGTFRYASGEVYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWQYDKKSGYGVFDDITRGEKYMGMWLDD 1139          

HSP 2 Score: 77.411 bits (189), Expect = 3.432e-15
Identity = 46/142 (32.39%), Postives = 68/142 (47.89%), Query Frame = 1
Query:  289 QYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGN-----VYEGEWENDQMCGQGMLRN-KNGNRYEGQWKNGMRNGEG 696
            +Y G W +   +GRG +     G MY G +K+  ++GFG   V          Y G WK+   HGFG   Y+S E YEG + +  R+G G +     N     V+ G+W+ D+  G G+  +   G +Y G W +  R G G
Sbjct: 1005 KYDGRWVSGKPHGRGVVKW-PDGRMYTGTFKNGFEDGFGDYVVSNKTLNSCDHYQGQWKDGKMHGFGTFRYASGEVYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWQYDKKSGYGVFDDITRGEKYMGMWLDDQRQGNG 1145          

HSP 3 Score: 75.8702 bits (185), Expect = 1.420e-14
Identity = 43/139 (30.94%), Postives = 76/139 (54.68%), Query Frame = 1
Query:  286 DQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQW-KNGMRNGEG 696
            D Y G W +   +G GT    S G +YEG ++D+ ++G G+L   K   T   ++ G W+ + + G+G  +  +  E Y G W + +R G G +    G  YEG + N++M G G+L +++   +EG++ ++   NG+G
Sbjct: 1055 DHYQGQWKDGKMHGFGTFRYAS-GEVYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWQYDKKSGYGVFDDITRGEKYMGMWLDDQRQGNGVVVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGEFLEDWTLNGKG 1192          

HSP 4 Score: 75.485 bits (184), Expect = 1.785e-14
Identity = 48/168 (28.57%), Postives = 80/168 (47.62%), Query Frame = 1
Query:  223 YDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGL----MYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGF-----GENWYSSNEFYEGEWYEGKRNGWGRMYE-ADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEG 696
            YD    + K      + + +G  Y G + N  ++G G   ++++ L     Y+G WKD K +GFG      G     ++Y G +++N+RHG      G+   +S   + G+W   K++G+G   +   G  Y G W +DQ  G G++  + G  YEG + N    G G
Sbjct: 1006 YDGRWVSGKPHGRGVVKWPDGRMYTGTFKNGFEDGFGDYVVSNKTLNSCDHYQGQWKDGKMHGFGTFRYASG-----EVYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWQYDKKSGYGVFDDITRGEKYMGMWLDDQRQGNGVVVTQFGLYYEGAFSNNKMMGTG 1168          

HSP 5 Score: 68.9366 bits (167), Expect = 2.580e-12
Identity = 46/157 (29.30%), Postives = 77/157 (49.04%), Query Frame = 1
Query:  265 TIYFVNGDQYVGDWNNNMKNGRGTMYL----TSQGLMYEGDWKDDKKNGFGVL-SVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWEND-QMCGQGMLRNKNGNRYEGQ----WKNGMRNGEGKYY 705
            T  + +G+ Y G + +NM++G G +      ++   ++ G W+ DKK+G+GV   + +G+      Y G W ++ R G G        +YEG +   K  G G +   D   +EGE+  D  + G+G+L   NG+  EG     W  G++   G YY
Sbjct: 1071 TFRYASGEVYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWQYDKKSGYGVFDDITRGEK-----YMGMWLDDQRQGNGVVVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGEFLEDWTLNGKGVLTMPNGDYIEGSFCGVWGTGLKM-SGSYY 1221          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Xenopus
Match: ENSXETT00000041404.1 (radial spoke head 10 homolog B (Chlamydomonas) [Source:NCBI gene;Acc:779504])

HSP 1 Score: 87.4261 bits (215), Expect = 1.720e-18
Identity = 63/165 (38.18%), Postives = 87/165 (52.73%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLM-YEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGR----MYEADG------NVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNN 750
            YVGDW+   ++G+G +Y   +G   YEGDW  +KK G+GV     G      IY G WKNN+ HG G+  W +SNE Y G+W  G +NG G     +    G      N Y G + N    GQG     NG  Y+G+WKN  ++G GK+ +   GQ+  G +V +
Sbjct:   85 YVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGN-----IYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHGLGKFVF-KNGQIYVGEFVED 243          

HSP 2 Score: 72.7886 bits (177), Expect = 1.100e-13
Identity = 63/189 (33.33%), Postives = 96/189 (50.79%), Query Frame = 1
Query:  271 YFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNE--FYEGEWYEGKRNGWGRMY--EADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRN 825
            YF +G+ Y G ++  M +G+G  Y    GL YEGD+  +   G G+     G       Y G     +RHG G  + SSN+   Y G+W++G R+G G +Y  +   + YEG+W +++  G G+    +GN YEGQWKN + +G GK  ++   +   G W N +      H W     P  T++ LRN
Sbjct:    8 YFKDGNIYRGMFSEGMMHGKGK-YTWKDGLTYEGDFYMNFPMGHGIYKWSDGSQ-----YEGEVYKAIRHGHG-IFTSSNQKVSYVGDWHKGTRHGKGVIYYNKEGTSWYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIP-GTQYSLRN 188          

HSP 3 Score: 65.855 bits (159), Expect = 2.170e-11
Identity = 42/138 (30.43%), Postives = 71/138 (51.45%), Query Frame = 1
Query:  220 WYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLS-----VKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMC 618
            WY+ D  +NKK       F++G+ Y G W NN+ +G G M   +    Y G W++  +NG G  +     +   + +    Y G + N +R G G+ +Y++   Y+GEW   K++G G+    +G +Y GE+  DQ+ 
Sbjct:  109 WYEGDWISNKKEGWGVQCFISGNIYEGQWKNNIFHGMGKMRWLTSNEEYAGQWENGIQNGSGTHTWFLRRIPGTQYSLRNEYVGNFVNGIRQGQGQFYYANGAMYDGEWKNNKKHGLGKFVFKNGQIYVGEFVEDQIA 246          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 82.0333 bits (201), Expect = 9.679e-18
Identity = 55/176 (31.25%), Postives = 88/176 (50.00%), Query Frame = 1
Query:  217 FWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKG------------------KDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNG 690
            F Y+   K+ KK  H  + F +G  Y G++ +    G G  Y +S G  Y G+++  + +G GV+  K G                   D   + YSG + NN ++G G+  + + + YEG+W   +R G G +   DG++YEG+W ND   GQG++ + +G  Y+G W NG   G
Sbjct:   30 FRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWINGHPAG 205          

HSP 2 Score: 62.7734 bits (151), Expect = 6.362e-11
Identity = 52/177 (29.38%), Postives = 74/177 (41.81%), Query Frame = 1
Query:  280 NGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGK-------------------DTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNV 753
            N   Y G     +++G G     +    YEG WK  KK+G G L  K G                     +    YSG ++    HG G   Y     YEGE+  G + G G + + +G  Y G + N++  G G ++  NG+ YEG W    R G G     D G + +G W N+V
Sbjct:    4 NSRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTD-GSIYEGQWRNDV 179          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 83.5741 bits (205), Expect = 1.195e-17
Identity = 54/172 (31.40%), Postives = 87/172 (50.58%), Query Frame = 1
Query:  217 FWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKG------------------KDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNG 678
            F Y+   K+ KK  H  + F +G  Y G++ +    G G  Y +S G  Y G+++  + +G GV+  K G                   D   + YSG + NN ++G G+  + + + YEG+W   +R G G +   DG++YEG+W ND   GQG++ + +G  Y+G W NG
Sbjct:   37 FRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWING 208          

HSP 2 Score: 63.5438 bits (153), Expect = 7.064e-11
Identity = 49/155 (31.61%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  289 QYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNV 753
            +Y G W +  K+G G + L   G  YEG++ D +  G G+       + Y    SG ++    HG G   Y     YEGE+  G + G G + + +G  Y G + N++  G G ++  NG+ YEG W    R G G     D G + +G W N+V
Sbjct:   38 RYEGQWKSGKKHGHGKL-LFKDGSYYEGEFADGEITGNGLRYWSSSGNKY----SGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTD-GSIYEGQWRNDV 186          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 83.1889 bits (204), Expect = 2.268e-17
Identity = 54/172 (31.40%), Postives = 87/172 (50.58%), Query Frame = 1
Query:  217 FWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKG------------------KDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNG 678
            F Y+   K+ KK  H  + F +G  Y G++ +    G G  Y +S G  Y G+++  + +G GV+  K G                   D   + YSG + NN ++G G+  + + + YEG+W   +R G G +   DG++YEG+W ND   GQG++ + +G  Y+G W NG
Sbjct:   30 FRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWING 201          

HSP 2 Score: 64.6994 bits (156), Expect = 3.728e-11
Identity = 52/177 (29.38%), Postives = 74/177 (41.81%), Query Frame = 1
Query:  280 NGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGK-------------------DTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNV 753
            N   Y G     +++G G     +    YEG WK  KK+G G L  K G                     +    YSG ++    HG G   Y     YEGE+  G + G G + + +G  Y G + N++  G G ++  NG+ YEG W    R G G     D G + +G W N+V
Sbjct:    4 NSRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTD-GSIYEGQWRNDV 179          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 80.8777 bits (198), Expect = 2.483e-17
Identity = 54/172 (31.40%), Postives = 87/172 (50.58%), Query Frame = 1
Query:  217 FWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKG------------------KDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNG 678
            F Y+   K+ KK  H  + F +G  Y G++ +    G G  Y +S G  Y G+++  + +G GV+  K G                   D   + YSG + NN ++G G+  + + + YEG+W   +R G G +   DG++YEG+W ND   GQG++ + +G  Y+G W NG
Sbjct:   30 FRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWING 201          

HSP 2 Score: 62.003 bits (149), Expect = 1.084e-10
Identity = 52/177 (29.38%), Postives = 74/177 (41.81%), Query Frame = 1
Query:  280 NGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGK-------------------DTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNV 753
            N   Y G     +++G G     +    YEG WK  KK+G G L  K G                     +    YSG ++    HG G   Y     YEGE+  G + G G + + +G  Y G + N++  G G ++  NG+ YEG W    R G G     D G + +G W N+V
Sbjct:    4 NSRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTD-GSIYEGQWRNDV 179          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Mouse
Match: Morn3 (MORN repeat containing 3 [Source:MGI Symbol;Acc:MGI:1922140])

HSP 1 Score: 224.942 bits (572), Expect = 1.966e-72
Identity = 106/229 (46.29%), Postives = 157/229 (68.56%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFL 879
              R  +P W   D+KA K GL H ++ VNGD YVG+W  N+K+G+GT      G +YEGDWK  K++G+G LS    +     ++YSG WK + + G+G  ++   E+YEGEW   +R+GWGRMY  +G++YEG+W+ND+  G+GMLR KNGNRYEG W+ GM+NG G+++++D GQ+ +G WV+NV+KCG + D+ R+ AP PT+FP+  +E+  P  V+KEA +  +
Sbjct:    6 CPRKVEPPWKGWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEGIWERGMKNGHGRFFHLDHGQLFEGYWVDNVAKCGTMIDFGRDEAPEPTQFPIPKVEILDPDGVLKEALDKLM 234          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Mouse
Match: Morn3 (MORN repeat containing 3 [Source:MGI Symbol;Acc:MGI:1922140])

HSP 1 Score: 134.806 bits (338), Expect = 2.978e-38
Identity = 68/154 (44.16%), Postives = 99/154 (64.29%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNR 654
              R  +P W   D+KA K GL H ++ VNGD YVG+W  N+K+G+GT      G +YEGDWK  K++G+G LS    +     ++YSG WK + + G+G  ++   E+YEGEW   +R+GWGRMY  +G++YEG+W+ND+  G+GMLR    +R
Sbjct:    6 CPRKVEPPWKGWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLSGDSR 159          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Mouse
Match: Morn3 (MORN repeat containing 3 [Source:MGI Symbol;Acc:MGI:1922140])

HSP 1 Score: 134.806 bits (338), Expect = 2.978e-38
Identity = 68/154 (44.16%), Postives = 99/154 (64.29%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNR 654
              R  +P W   D+KA K GL H ++ VNGD YVG+W  N+K+G+GT      G +YEGDWK  K++G+G LS    +     ++YSG WK + + G+G  ++   E+YEGEW   +R+GWGRMY  +G++YEG+W+ND+  G+GMLR    +R
Sbjct:    6 CPRKVEPPWKGWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLSGDSR 159          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Mouse
Match: Morn3 (MORN repeat containing 3 [Source:MGI Symbol;Acc:MGI:1922140])

HSP 1 Score: 78.1814 bits (191), Expect = 1.728e-17
Identity = 42/103 (40.78%), Postives = 60/103 (58.25%), Query Frame = 1
Query:  202 RSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSS 507
            R  +P W   D+KA K GL H ++ VNGD YVG+W  N+K+G+GT      G +YEGDWK  K++G+G LS    +     ++YSG WK + +   G    +S
Sbjct:    8 RKVEPPWKGWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSRTGTGMRAS 110          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Mouse
Match: Rsph10b (radial spoke head 10 homolog B (Chlamydomonas) [Source:MGI Symbol;Acc:MGI:1922386])

HSP 1 Score: 78.5666 bits (192), Expect = 1.394e-15
Identity = 54/163 (33.13%), Postives = 81/163 (49.69%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLM-YEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWG---------------------------------RMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKN 675
            Y+G W +  ++G+G++Y   +G   YEGDW  + K G+G+   K G      IY G W+NN+RHG G   W ++NE Y G W +G +NG+G                                 + Y A G +YEGEW +++  G+G +  KNG+ YEG + N
Sbjct:  179 YIGHWCHGKRHGKGSIYYNQEGTSWYEGDWVYNIKKGWGIRCYKSGN-----IYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYYASGAMYEGEWASNKKQGRGRMTFKNGHVYEGLFSN 336          

HSP 2 Score: 76.6406 bits (187), Expect = 6.640e-15
Identity = 62/187 (33.16%), Postives = 96/187 (51.34%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEF-YEGEWYEGKRNGWGRMY--EADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRN 825
            F  G+ Y G ++  + +G+GT Y+ + GL YEGD+  +     GV +   G       Y G   N +R+GFG     +    Y G W  GKR+G G +Y  +   + YEG+W  +   G G+   K+GN YEGQW+N MR+GEG+  ++   +   G W   +      H W  +  P+ +++PLRN
Sbjct:  103 FQGGNTYHGMFSEGLMHGQGT-YIWADGLKYEGDFVKNIPMNHGVYTWPDGS-----TYEGEVTNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYYNQEGTSWYEGDWVYNIKKGWGIRCYKSGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPN-SQYPLRN 282          

HSP 3 Score: 73.1738 bits (178), Expect = 8.008e-14
Identity = 44/118 (37.29%), Postives = 66/118 (55.93%), Query Frame = 1
Query:  280 NGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLS--VKKGKDTYEKI---YSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMC 618
            +G+ Y G W NNM++G G M   +    Y G W+   +NGFG  +  +K+  ++   +   Y G + N  RHG G+ +Y+S   YEGEW   K+ G GRM   +G+VYEG + ND + 
Sbjct:  223 SGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYYASGAMYEGEWASNKKQGRGRMTFKNGHVYEGLFSNDHIA 340          

HSP 4 Score: 69.707 bits (169), Expect = 1.256e-12
Identity = 60/187 (32.09%), Postives = 87/187 (46.52%), Query Frame = 1
Query:  223 YDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRM-YEADGNVYEGEWENDQMCGQG-----MLRNKNG-----NRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNN 750
            Y+ D   N    H    + +G  Y G+  N M+NG G     +Q + Y G W   K++G G +   +   ++   Y G W  N++ G+G   Y S   YEG+W    R+G GRM +      Y G WE     G G     + R  N      N Y G++ NG R+G+GK+YY   G M +G W +N
Sbjct:  132 YEGDFVKNIPMNHGVYTWPDGSTYEGEVTNGMRNGFGMFKCGTQPVSYIGHWCHGKRHGKGSIYYNQEGTSW---YEGDWVYNIKKGWGIRCYKSGNIYEGQWENNMRHGEGRMRWLTTNEEYTGHWEKGIQNGFGTHTWFLKRIPNSQYPLRNEYIGEFVNGFRHGQGKFYYAS-GAMYEGEWASN 314          
BLAST of MORN repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q5PPV3|MORN3_XENLA (MORN repeat-containing protein 3 OS=Xenopus laevis OX=8355 GN=morn3 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 7.777e-75
Identity = 109/231 (47.19%), Postives = 161/231 (69.70%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQ 885
              +  +P W + D KA K GL H++Y VNGD+Y G+W NN+++G+GT     +  +YEGDWK  +++GFG  SV+      Y K+YSG W N+ +HG+G ++YS+ E+YEGEW  GKR GWGRMY A+G++YEGEW  D+  GQGML   N NRYEG WK+G ++G GK+YY++KGQ+ +G+WV ++ KCG + D+ R  AP+PT++PL  +++  P  V+KEA++    +
Sbjct:    6 APKKAEPIWKEWDAKAQKAGLRHSVYSVNGDEYTGEWLNNLRHGKGTYMWKRRKSIYEGDWKCGERSGFGTYSVQDSNTGEYIKVYSGYWDNDKKHGYGTHFYSAKEYYEGEWKCGKRCGWGRMYFANGDIYEGEWLEDKHSGQGMLCLANENRYEGSWKDGKKHGPGKFYYLNKGQLYEGVWVEDIPKCGTMVDFGRTEAPYPTKYPLPEVKVADPEGVLKEAQQPLFGE 236          
BLAST of MORN repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q32KM6|MORN3_BOVIN (MORN repeat-containing protein 3 OS=Bos taurus OX=9913 GN=MORN3 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 5.899e-72
Identity = 102/226 (45.13%), Postives = 160/226 (70.80%), Query Frame = 1
Query:  202 RSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYF 876
            +  +P W + D+KA K GL H ++ VNGD YVG+W +N+K+G+GT      G +YEGDWK  K++G+G LS+   +   Y++ YSG WK + + G+G  ++   E+YEG+W   +R+GWGRMY ++G++YEG+W ND+  G+GMLR KNGNRYEG W+ G++NG G+++++D GQ+ +G WV++V+KCG + D+ R+ AP PT+FP+  +++  P  V++EA   F
Sbjct:    8 QKSEPLWKEWDQKAQKNGLRHQVFAVNGDHYVGEWKDNVKHGKGTQVWKKNGAIYEGDWKSGKRDGYGTLSLPDQETGKYKRAYSGWWKGDKKCGYGIQFFGPKEYYEGDWCGNQRSGWGRMYYSNGDIYEGQWRNDKPEGEGMLRLKNGNRYEGNWQRGVKNGSGRFFHLDHGQLFEGFWVDDVAKCGTMIDFGRDEAPQPTQFPIPEVKILDPDGVLEEALAMF 233          
BLAST of MORN repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q8C5T4|MORN3_MOUSE (MORN repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Morn3 PE=2 SV=2)

HSP 1 Score: 224.942 bits (572), Expect = 1.375e-71
Identity = 106/229 (46.29%), Postives = 157/229 (68.56%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFL 879
              R  +P W   D+KA K GL H ++ VNGD YVG+W  N+K+G+GT      G +YEGDWK  K++G+G LS    +     ++YSG WK + + G+G  ++   E+YEGEW   +R+GWGRMY  +G++YEG+W+ND+  G+GMLR KNGNRYEG W+ GM+NG G+++++D GQ+ +G WV+NV+KCG + D+ R+ AP PT+FP+  +E+  P  V+KEA +  +
Sbjct:    6 CPRKVEPPWKGWDRKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEGIWERGMKNGHGRFFHLDHGQLFEGYWVDNVAKCGTMIDFGRDEAPEPTQFPIPKVEILDPDGVLKEALDKLM 234          
BLAST of MORN repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q6PF18|MORN3_HUMAN (MORN repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=MORN3 PE=1 SV=2)

HSP 1 Score: 220.705 bits (561), Expect = 7.210e-70
Identity = 101/228 (44.30%), Postives = 157/228 (68.86%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYF 876
              +  +  W   D+KA + GL   +Y VNGD YVG+W +N+K+G+GT     +G +YEGDWK  K++G+G LS+   +     ++YSG WK + + G+G  ++   E+YEG+W   +R+GWGRMY ++G++YEG+WEND+  G+GMLR KNGNRYEG W+ GM+NG G+++++D GQ+ +G WV+N++KCG + D+ R+ AP PT+FP+  +++  P  V+ EA   F
Sbjct:    6 CPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMF 233          
BLAST of MORN repeat-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q4R842|MORN3_MACFA (MORN repeat-containing protein 3 OS=Macaca fascicularis OX=9541 GN=MORN3 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.536e-69
Identity = 102/228 (44.74%), Postives = 155/228 (67.98%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKD-TYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYF 876
              +  +  W   D+KA K GL   +Y VNGD YVG+W +N+K+G+GT      G +YEGDWK  K++G+G LS+   +     ++YSG WK + + G+G  ++   E+YEGEW   +R+GWGRMY ++G++YEG+WEND+  G GMLR KNGNRYEG W+ GM+NG G+++++D GQ+ +G WV+N++KCG + D+ R+ AP PT+FP+  +++  P  V+ +A   F
Sbjct:    6 CPKKSESLWKGWDRKAQKNGLRRQVYAVNGDYYVGEWKDNVKHGKGTQVWKKNGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGDGMLRLKNGNRYEGCWERGMKNGLGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAQALAMF 233          
BLAST of MORN repeat-containing protein 3 vs. TrEMBL
Match: A0A2T7PCT4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06648 PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 4.232e-91
Identity = 130/231 (56.28%), Postives = 170/231 (73.59%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQI 888
            T +  +P W D D++A KKG+HHT+Y VNGDQY GDW +N K+G+GT      G +YEGDWK +K+NGFG LS   G+  Y+K YSGGWKN+LRHG+G  +Y+ +E+YEGEWY GKR+GWGRMY  DG +YEGEW +D+  GQGM+R  N NRYEG WKNG RNG GK+YY+D GQ+ +G+WV+N  KCG + D+ R+ AP PT +P+  IEL++P  V+ E EE FL  +
Sbjct:    6 TPKEAEPPWKDWDRRAQKKGIHHTVYSVNGDQYTGDWLDNKKDGKGTYKWKDTGCIYEGDWKKNKRNGFGTLSYPDGRGGYKKEYSGGWKNDLRHGYGTEFYTDDEYYEGEWYAGKRSGWGRMYYKDGTIYEGEWYDDECSGQGMMRLANENRYEGSWKNGKRNGPGKFYYLDTGQLFEGVWVDNTPKCGSMRDFGRDHAPDPTPYPIPAIELKNPNNVLAEVEEKFLQDL 236          
BLAST of MORN repeat-containing protein 3 vs. TrEMBL
Match: A0A1S3IAB9 (MORN repeat-containing protein 3 OS=Lingula unguis OX=7574 GN=LOC106162448 PE=4 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 9.890e-87
Identity = 126/228 (55.26%), Postives = 171/228 (75.00%), Query Frame = 1
Query:  202 RSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQ 885
            +  +P W D D KA KKG+ HT+Y VNGD+Y G+W +N K+G+GT    S G +Y+GDWK+ K+NGFG LS   GK  ++K YSGGWKN++RHG+G  +YS NE+YEGEWY  KR+GWGRMY A+GN+YEGEW +D   GQGMLR  N NRYEG+WK+G +NG GKY+Y+DKGQ+ +G+WV +++KCG + D+ R+ AP PT++P+  I+L  P  V++EAE  FL +
Sbjct:    8 KVTEPLWKDWDYKAQKKGIRHTVYSVNGDEYTGEWLDNKKHGKGTYKWKSTGAIYDGDWKNGKRNGFGTLSTPDGKGGFKKEYSGGWKNHMRHGYGTQYYSDNEYYEGEWYADKRSGWGRMYYANGNIYEGEWYDDMCNGQGMLRLANENRYEGEWKDGKKNGRGKYFYLDKGQLYEGVWVEDIAKCGAMKDFGRQHAPDPTKYPITAIKLAEPELVLEEAENMFLQE 235          
BLAST of MORN repeat-containing protein 3 vs. TrEMBL
Match: A0A2G8KJG3 (Putative MORN repeat-containing protein 3 OS=Stichopus japonicus OX=307972 GN=BSL78_15034 PE=4 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 1.601e-84
Identity = 122/230 (53.04%), Postives = 168/230 (73.04%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQ 885
            T +  +P W + D KA KKG+  T+Y VNGD+Y G+W +N K+G+GT      G +Y+GDWK  K+NGFG LS+   +  Y++IYSGGWKN+ RHG+G N+YS+ E+YEGEWY  KR+GWGRMY ADG++YEGEW ND+  GQGMLR    NRYEG WK+  +NG GK++Y+DKGQM +G+WV+N++KCG + D+ R+ AP PT++P+  I+L      ++EAEE FL +
Sbjct:    6 TPKQTQPLWKEWDYKAQKKGVRSTVYSVNGDEYTGEWLDNKKHGKGTQKWKKTGTLYDGDWKVGKRNGFGTLSIPHEEGGYKRIYSGGWKNDKRHGYGTNFYSAEEYYEGEWYADKRSGWGRMYFADGSIYEGEWYNDERNGQGMLRLATDNRYEGSWKDDQKNGPGKFFYLDKGQMYEGVWVDNIAKCGNITDFGRDGAPEPTQYPIPEIKLADSEAALREAEETFLPE 235          
BLAST of MORN repeat-containing protein 3 vs. TrEMBL
Match: A0A2G8LLP1 (Putative MORN repeat-containing protein 3 OS=Stichopus japonicus OX=307972 GN=BSL78_01890 PE=4 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 1.654e-84
Identity = 122/230 (53.04%), Postives = 168/230 (73.04%), Query Frame = 1
Query:  196 TNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQ 885
            T +  +P W + D KA KKG+  T+Y VNGD+Y G+W +N K+G+GT      G +Y+GDWK  K+NGFG LS+   +  Y++IYSGGWKN+ RHG+G N+YS+ E+YEGEWY  KR+GWGRMY ADG++YEGEW ND+  GQGMLR    NRYEG WK+  +NG GK++Y+DKGQM +G+WV+N++KCG + D+ R+ AP PT++P+  I+L      ++EAEE FL +
Sbjct:    6 TPKQTQPLWKEWDYKAQKKGVRSTVYSVNGDEYTGEWLDNKKHGKGTQKWKKTGTLYDGDWKVGKRNGFGTLSIPHEEGGYKRIYSGGWKNDKRHGYGTNFYSAEEYYEGEWYADKRSGWGRMYFADGSIYEGEWYNDERNGQGMLRLATDNRYEGSWKDDQKNGPGKFFYLDKGQMYEGVWVDNIAKCGNITDFGRDGAPEPTQYPIPEIKLADSEAALREAEETFLPE 235          
BLAST of MORN repeat-containing protein 3 vs. TrEMBL
Match: A7S530 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g236931 PE=4 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 2.368e-84
Identity = 123/228 (53.95%), Postives = 167/228 (73.25%), Query Frame = 1
Query:  202 RSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQ 885
            ++++P W + D KA KKG+HHT+Y VNGDQY G+WN N KNG+GTM       +Y+GDWKDD++ G+G  S+K+    Y KIYSGGWKN+ RHG+G N+YS  E+YEGEWY  KR+GWGRMY +DG VYEGEW +D+  G+GMLR  N NRYEG+WK+G+++G+G +Y++DKGQ   G+W  ++ KCG + D+ RE AP PT +P+    LE    V+KEAE+ FL +
Sbjct:    8 KTREPLWKEWDYKAQKKGVHHTVYSVNGDQYTGEWNGNKKNGKGTMQWKKSKAIYDGDWKDDRRCGYGTYSIKE-TSGYRKIYSGGWKNDKRHGYGTNFYSPTEYYEGEWYADKRSGWGRMYYSDGAVYEGEWYDDKQNGEGMLRLANENRYEGEWKDGLKHGKGIFYFLDKGQKYTGVWALDIPKCGTMEDFGREKAPEPTTYPIPECTLEDAKGVLKEAEDTFLDE 234          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Cavefish
Match: morn3 (MORN repeat-containing protein 3 [Source:NCBI gene;Acc:103031534])

HSP 1 Score: 200.29 bits (508), Expect = 1.531e-62
Identity = 101/221 (45.70%), Postives = 143/221 (64.71%), Query Frame = 1
Query:  232 DKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGK-DTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQIP 891
            DKKA K G+  T++ V GDQY G+W  N K+G+GT      G++Y+G+W+  K++GFG LS +    + YE IYSG WKN+ + GFG   YS +  YEG+W E +R+G GRM+  +G+VYEGEW  D+  GQG+L   NGNRYEG WK+G +NG G ++Y+DKGQ+ +G WV++V+KCG + D+ RE A  PT  P     L    +++K      L  +P
Sbjct:    8 DKKAEKNGVLRTVFSVTGDQYTGEWLQNRKHGKGTQVWKRAGVVYDGEWRFGKRDGFGTLSKQSPPSNNYEVIYSGEWKNDKKEGFGMEVYSPSSLYEGQWVEHERSGSGRMFYPNGDVYEGEWLKDKPHGQGVLTLANGNRYEGSWKDGRKNGPGCFFYLDKGQLYEGFWVDDVAKCGTMCDFGREHAATPTVIP----SLRCSCRMLKVCYWRELPTVP 224          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Cavefish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 83.5741 bits (205), Expect = 2.951e-17
Identity = 46/144 (31.94%), Postives = 76/144 (52.78%), Query Frame = 1
Query:  358 LMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-----NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNR-----YEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSK 759
            +MYEG W   K NG GVL    G+     +Y+G +KN L  G+G+        + ++ Y+G W +GK +G+G    A G +YEG ++++   G GMLR+   N      + GQW +  + G G +  I +G+   G+W  ++ +
Sbjct: 1088 VMYEGRWLAGKPNGRGVLKWPDGR-----MYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQ 1226          

HSP 2 Score: 78.5666 bits (192), Expect = 1.184e-15
Identity = 45/141 (31.91%), Postives = 67/141 (47.52%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGN-----VYEGEWENDQMCGQGMLRN-KNGNRYEGQWKNGMRNGEG 696
            Y G W     NGRG +     G MY G +K+  ++G+G   V          Y G WK+   HGFG   Y++ E YEG + +  R+G G +     N     V+ G+W +D+  G G+  +   G +Y G W+  +R G G
Sbjct: 1090 YEGRWLAGKPNGRGVLKW-PDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNG 1229          

HSP 3 Score: 72.7886 bits (177), Expect = 9.571e-14
Identity = 47/163 (28.83%), Postives = 79/163 (48.47%), Query Frame = 1
Query:  238 KANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGL----MYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGF-----GENWYSSNEFYEGEWYEGKRNGWGRMYE-ADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEG 696
            K N +G+   + + +G  Y G + N +++G G   + ++ L     Y+G WKD K +GFG      G     ++Y G +++N+RHG      G+   +S   + G+W   K+ G+G   +   G  Y G W+ D   G G++  + G  YEG + N    G G
Sbjct: 1098 KPNGRGV---LKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATG-----ELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTG 1252          

HSP 4 Score: 70.4774 bits (171), Expect = 6.244e-13
Identity = 39/131 (29.77%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  286 DQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKN 675
            D Y G W +   +G G  +  + G +YEG ++D+ ++G G+L   K   T   ++ G W ++ + G+G  +  +  E Y G W E  R G G +    G  YEG + N++M G G+L +++   +EG + +
Sbjct: 1139 DHYQGHWKDGKMHGFGN-FRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSD 1268          

HSP 5 Score: 69.3218 bits (168), Expect = 1.480e-12
Identity = 45/154 (29.22%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYL----TSQGLMYEGDWKDDKKNGFGVLS-VKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWEND-QMCGQGMLRNKNGNRYEGQ----WKNGMRNGEGKYY 705
            +  G+ Y G + +NM++G G +      ++   ++ G W  DKK G+GV   + +G+      Y G W+ +LR G G        +YEG +   K  G G +   D   +EG++ +D  + G+G L   NG+  EG     W  G++   G YY
Sbjct: 1158 YATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEK-----YMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLSGKGTLTMPNGDYIEGSFSGVWGTGLKI-SGSYY 1305          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Cavefish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 83.1889 bits (204), Expect = 3.547e-17
Identity = 46/144 (31.94%), Postives = 76/144 (52.78%), Query Frame = 1
Query:  358 LMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-----NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNR-----YEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSK 759
            +MYEG W   K NG GVL    G+     +Y+G +KN L  G+G+        + ++ Y+G W +GK +G+G    A G +YEG ++++   G GMLR+   N      + GQW +  + G G +  I +G+   G+W  ++ +
Sbjct: 1079 VMYEGRWLAGKPNGRGVLKWPDGR-----MYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQ 1217          

HSP 2 Score: 78.5666 bits (192), Expect = 1.421e-15
Identity = 45/141 (31.91%), Postives = 67/141 (47.52%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGN-----VYEGEWENDQMCGQGMLRN-KNGNRYEGQWKNGMRNGEG 696
            Y G W     NGRG +     G MY G +K+  ++G+G   V          Y G WK+   HGFG   Y++ E YEG + +  R+G G +     N     V+ G+W +D+  G G+  +   G +Y G W+  +R G G
Sbjct: 1081 YEGRWLAGKPNGRGVLKW-PDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNG 1220          

HSP 3 Score: 72.7886 bits (177), Expect = 1.158e-13
Identity = 47/163 (28.83%), Postives = 79/163 (48.47%), Query Frame = 1
Query:  238 KANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGL----MYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGF-----GENWYSSNEFYEGEWYEGKRNGWGRMYE-ADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEG 696
            K N +G+   + + +G  Y G + N +++G G   + ++ L     Y+G WKD K +GFG      G     ++Y G +++N+RHG      G+   +S   + G+W   K+ G+G   +   G  Y G W+ D   G G++  + G  YEG + N    G G
Sbjct: 1089 KPNGRGV---LKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATG-----ELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTG 1243          

HSP 4 Score: 70.0922 bits (170), Expect = 7.349e-13
Identity = 39/131 (29.77%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  286 DQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKN 675
            D Y G W +   +G G  +  + G +YEG ++D+ ++G G+L   K   T   ++ G W ++ + G+G  +  +  E Y G W E  R G G +    G  YEG + N++M G G+L +++   +EG + +
Sbjct: 1130 DHYQGHWKDGKMHGFGN-FRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSD 1259          

HSP 5 Score: 68.9366 bits (167), Expect = 1.789e-12
Identity = 45/154 (29.22%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYL----TSQGLMYEGDWKDDKKNGFGVLS-VKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWEND-QMCGQGMLRNKNGNRYEGQ----WKNGMRNGEGKYY 705
            +  G+ Y G + +NM++G G +      ++   ++ G W  DKK G+GV   + +G+      Y G W+ +LR G G        +YEG +   K  G G +   D   +EG++ +D  + G+G L   NG+  EG     W  G++   G YY
Sbjct: 1149 YATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEK-----YMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLSGKGTLTMPNGDYIEGSFSGVWGTGLKI-SGSYY 1296          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Cavefish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 83.1889 bits (204), Expect = 4.461e-17
Identity = 46/144 (31.94%), Postives = 76/144 (52.78%), Query Frame = 1
Query:  358 LMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-----NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNR-----YEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSK 759
            +MYEG W   K NG GVL    G+     +Y+G +KN L  G+G+        + ++ Y+G W +GK +G+G    A G +YEG ++++   G GMLR+   N      + GQW +  + G G +  I +G+   G+W  ++ +
Sbjct:  990 VMYEGRWLAGKPNGRGVLKWPDGR-----MYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQ 1128          

HSP 2 Score: 78.1814 bits (191), Expect = 1.706e-15
Identity = 45/141 (31.91%), Postives = 67/141 (47.52%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGN-----VYEGEWENDQMCGQGMLRN-KNGNRYEGQWKNGMRNGEG 696
            Y G W     NGRG +     G MY G +K+  ++G+G   V          Y G WK+   HGFG   Y++ E YEG + +  R+G G +     N     V+ G+W +D+  G G+  +   G +Y G W+  +R G G
Sbjct:  992 YEGRWLAGKPNGRGVLKW-PDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNG 1131          

HSP 3 Score: 72.4034 bits (176), Expect = 1.364e-13
Identity = 47/163 (28.83%), Postives = 79/163 (48.47%), Query Frame = 1
Query:  238 KANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGL----MYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGF-----GENWYSSNEFYEGEWYEGKRNGWGRMYE-ADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEG 696
            K N +G+   + + +G  Y G + N +++G G   + ++ L     Y+G WKD K +GFG      G     ++Y G +++N+RHG      G+   +S   + G+W   K+ G+G   +   G  Y G W+ D   G G++  + G  YEG + N    G G
Sbjct: 1000 KPNGRGV---LKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATG-----ELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTG 1154          

HSP 4 Score: 70.0922 bits (170), Expect = 9.302e-13
Identity = 39/131 (29.77%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  286 DQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKN 675
            D Y G W +   +G G  +  + G +YEG ++D+ ++G G+L   K   T   ++ G W ++ + G+G  +  +  E Y G W E  R G G +    G  YEG + N++M G G+L +++   +EG + +
Sbjct: 1041 DHYQGHWKDGKMHGFGN-FRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSD 1170          

HSP 5 Score: 68.9366 bits (167), Expect = 2.144e-12
Identity = 45/154 (29.22%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYL----TSQGLMYEGDWKDDKKNGFGVLS-VKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWEND-QMCGQGMLRNKNGNRYEGQ----WKNGMRNGEGKYY 705
            +  G+ Y G + +NM++G G +      ++   ++ G W  DKK G+GV   + +G+      Y G W+ +LR G G        +YEG +   K  G G +   D   +EG++ +D  + G+G L   NG+  EG     W  G++   G YY
Sbjct: 1060 YATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEK-----YMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLSGKGTLTMPNGDYIEGSFSGVWGTGLKI-SGSYY 1207          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Cavefish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:103028242])

HSP 1 Score: 76.6406 bits (187), Expect = 4.963e-15
Identity = 59/172 (34.30%), Postives = 88/172 (51.16%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRM-YEADGNV-YEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDW 780
            F+ G  Y G + N + +G G  Y  + G+ YEG++  +   G G+ +   G      IY G     +RHGFG  +   ++  Y G+W++GKR+G G + Y  +    YEG+W+N+   G G+    +GN Y+GQWKN  R+GEG   +I   Q   G WV  V      H W
Sbjct:   86 FLGGHVYKGRFANGLMHGHGE-YTWADGVKYEGEFVLNAPVGHGIYTWLDGS-----IYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTW 251          

HSP 2 Score: 70.8626 bits (172), Expect = 3.962e-13
Identity = 66/207 (31.88%), Postives = 98/207 (47.34%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNN-------LRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYID--KGQMLKGIWVNNVSKCGQLHDWNRET----APHPTEFPLRNIELESPYKVIKEAEEY 873
            Y GDW NN + G G     S G +Y+G WK+D ++G G +   +    Y   +  G ++        LR G G  +  SNE Y+GE+ +G R+G G    A G  Y G W++++  GQG +  KNG  +EG++    R  E   + ID  K   L GI  N+      L    R++    A   T+  L    +E+  K I EA+ Y
Sbjct:  187 YEGDWKNNCREGWGVRCYPS-GNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNE-YKGEFVQGMRHGQGTFLYASGATYSGGWQHNKKHGQGKVTFKNGRIFEGEFIED-RMAEFPEFSIDGTKTPDLSGIRTNSPPPDEILPRRARKSGGTAAVLSTDIVLN---IETLLKRIPEAQRY 387          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 76.2554 bits (186), Expect = 9.112e-16
Identity = 58/215 (26.98%), Postives = 101/215 (46.98%), Query Frame = 1
Query:  259 HHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMY---------------EADG-------------------NVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSK-CGQLHDWNRETAP 798
            H T  + +G +Y G+  N +++G+GT+ ++   + Y G W   +++G G++   + ++++   Y G W +N+RHG+G   Y S   YEG+W   +R+G G M                + DG                   N Y GEW      GQG     +G +Y+G+W+   ++G G  +    GQ+ +G +V +V   C Q +  N  T+P
Sbjct:    4 HGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESW---YCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGT-FTCKSGQIYEGSFVEDVMVGCSQNNIENLATSP 214          

HSP 2 Score: 65.0846 bits (157), Expect = 4.799e-12
Identity = 51/168 (30.36%), Postives = 78/168 (46.43%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGV---LSVKKGKDTYEKI--YSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQM--CGQGMLRNKNGNRYEGQWKNGM---RNGEGKYYYIDKGQMLKGIWVN 747
            + +G+ Y G W NN ++G G M   +    Y G WK  K +G G    L  + G   Y     Y G W    RHG GE  Y+S   Y+GEW + +++G G      G +YEG +  D M  C Q  + N   + ++    + +   R+ E K    + G+ML+   V+
Sbjct:   81 YPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSFVEDVMVGCSQNNIENLATSPFKENISSDLTAKRHLEDKESTAEGGKMLQSSHVD 248          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 74.7146 bits (182), Expect = 3.507e-15
Identity = 52/172 (30.23%), Postives = 92/172 (53.49%), Query Frame = 1
Query:  259 HHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRM-YEADGNVYEGEWENDQMCGQGM---LRNKNG-------NRYEGQWKNGMRNGEGKYYYIDKGQMLKGIW 741
            H T  + +G +Y G+  N +++G+GT+ ++   + Y G W   +++G G++   + ++++   Y G W +N+RHG+G   Y S   YEG+W   +R+G G M +      Y G+W++ +  G+G    L  + G       N Y G+W  G R+G+G++ Y   G   KG W
Sbjct:   43 HGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESW---YCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYAS-GAQYKGEW 210          

HSP 2 Score: 69.707 bits (169), Expect = 1.553e-13
Identity = 57/161 (35.40%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  271 YFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEF--YEGEWYEGKRNGWGRMY--EADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIW 741
            ++  G+ Y G + NNM +G+G  Y+ + G+ +EGD+  +   G G      G       Y+G  +N +RHG G     S  F  Y G WY  +R+G G +Y  E   + Y GEW ++   G G+ R  +GN YEGQW N  R+GEG   +I   Q   G W
Sbjct:    1 FYEGGNVYSGSFCNNMMHGKGK-YVWADGVEFEGDFWLNAMVGHGTYQWPDGSK-----YTGNVENGVRHGQG-TLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQW 154          

HSP 3 Score: 63.1586 bits (152), Expect = 2.390e-11
Identity = 42/121 (34.71%), Postives = 58/121 (47.93%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGV---LSVKKGKDTYEKI--YSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCG 621
            + +G+ Y G W NN ++G G M   +    Y G WK  K +G G    L  + G   Y     Y G W    RHG GE  Y+S   Y+GEW + +++G G      G +YEG +  D M G
Sbjct:  120 YPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSFVEDVMVG 240          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001977.1 (pep scaffold:Pmarinus_7.0:GL478223:216506:238429:-1 gene:ENSPMAG00000001779.1 transcript:ENSPMAT00000001977.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 1.320e-13
Identity = 46/131 (35.11%), Postives = 62/131 (47.33%), Query Frame = 1
Query:  352 QGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSS-----NEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNR----YEGQWKNGMRNGEGKYYYIDK 717
            +G  Y G W D K +G+G ++   G+      Y G +K    HG+G+   ++      E Y GEW EGK NG+G    ADG VYEG        G GML +  G      Y G W +G R G G Y  + +
Sbjct: 1041 RGAHYYGQWCDGKPHGWGRMTWPDGR-----TYIGNFKFGSEHGYGKYTVANASTGKKEKYCGEWREGKINGYGLYKHADGEVYEGYLVGGVRHGHGMLLSSKGEHAGGVYVGHWASGKRAGYGVYENVSR 1166          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003398.1 (pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-1 gene:ENSPMAG00000003108.1 transcript:ENSPMAT00000003398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.352e-11
Identity = 42/138 (30.43%), Postives = 67/138 (48.55%), Query Frame = 1
Query:  409 LSVKKGKDTYE--KIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQML---KGIWVNN----VSKCGQLHDWNRETA 795
            +++ KG  TY   + Y G WK   RHG G+  ++    Y G++  G  +G G +   DG+ +EGE+   +  G G+    +G  +EG++KNG   G G   + D    L   +GI+ NN      KCG +    +  A
Sbjct:    1 MTLMKGSFTYATGEEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGLLTFPDGSHGLPRNEGIFENNKLSKREKCGAIVQRAQAAA 138          

HSP 2 Score: 54.6842 bits (130), Expect = 1.280e-9
Identity = 35/108 (32.41%), Postives = 59/108 (54.63%), Query Frame = 1
Query:  364 YEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGN----RYEGQWKN 675
            Y+G+WK+ +++G G L    G       Y G ++N L  G G   +     +EGE+ +GK +G G    +DG ++EGE++N  + G G+L   +G+    R EG ++N
Sbjct:   16 YQGEWKEGRRHGLGQLRFTDGTH-----YLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGLLTFPDGSHGLPRNEGIFEN 118          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002910.1 (pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 gene:ENSPMAG00000002661.1 transcript:ENSPMAT00000002910.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 2.077e-11
Identity = 43/139 (30.94%), Postives = 72/139 (51.80%), Query Frame = 1
Query:  286 DQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMR-NGEG 696
            D Y G W     +G+G +   + G +YEG + +  ++G GVL       T   +Y G W N+ + G+G  +  +  E Y G W    R+G G +    G  YE  + +++M GQG+L +++  RYEG++   +  NG+G
Sbjct:   25 DVYCGQWKAARMHGQGAIRY-ANGDVYEGGFSNGARHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVFDDITRGEKYMGMWMNDCRHGNGVVVSQFGLYYECVFSSNRMVGQGVLLSEDDTRYEGEFTADLALNGKG 162          

HSP 2 Score: 59.6918 bits (143), Expect = 2.574e-10
Identity = 42/138 (30.43%), Postives = 67/138 (48.55%), Query Frame = 1
Query:  265 TIYFVNGDQYVGDWNNNMKNGRGTM----YLTSQGLMYEGDWKDDKKNGFGVL-SVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWEND-QMCGQGMLRNKNGNRYE 660
             I + NGD Y G ++N  ++G G +    + ++   +Y G W +D K G+GV   + +G+      Y G W N+ RHG G        +YE  +   +  G G +   D   YEGE+  D  + G+G+L   NG+  E
Sbjct:   41 AIRYANGDVYEGGFSNGARHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVFDDITRGEK-----YMGMWMNDCRHGNGVVVSQFGLYYECVFSSNRMVGQGVLLSEDDTRYEGEFTADLALNGKGVLTLPNGDAIE 173          

HSP 3 Score: 54.299 bits (129), Expect = 1.463e-8
Identity = 35/105 (33.33%), Postives = 50/105 (47.62%), Query Frame = 1
Query:  400 FGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRM-----YEADGNVYEGEWENDQMCGQGMLRN-KNGNRYEGQWKNGMRNGEG 696
            FG L V       + +Y G WK    HG G   Y++ + YEG +  G R+G G +          ++Y G+W ND  CG G+  +   G +Y G W N  R+G G
Sbjct:   11 FGELCVPNQLLGKDDVYCGQWKAARMHGQGAIRYANGDVYEGGFSNGARHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVFDDITRGEKYMGMWMNDCRHGNG 115          

HSP 4 Score: 47.7506 bits (112), Expect = 1.579e-6
Identity = 28/87 (32.18%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  508 NEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNR-----YEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNV 753
            ++ Y G+W   + +G G +  A+G+VYEG + N    G G+LR+ +        Y GQW N  + G G +  I +G+   G+W+N+ 
Sbjct:   24 DDVYCGQWKAARMHGQGAIRYANGDVYEGGFSNGARHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVFDDITRGEKYMGMWMNDC 110          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Nematostella
Match: EDO41170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S530])

HSP 1 Score: 263.848 bits (673), Expect = 3.274e-88
Identity = 123/228 (53.95%), Postives = 167/228 (73.25%), Query Frame = 1
Query:  202 RSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQ 885
            ++++P W + D KA KKG+HHT+Y VNGDQY G+WN N KNG+GTM       +Y+GDWKDD++ G+G  S+K+    Y KIYSGGWKN+ RHG+G N+YS  E+YEGEWY  KR+GWGRMY +DG VYEGEW +D+  G+GMLR  N NRYEG+WK+G+++G+G +Y++DKGQ   G+W  ++ KCG + D+ RE AP PT +P+    LE    V+KEAE+ FL +
Sbjct:    8 KTREPLWKEWDYKAQKKGVHHTVYSVNGDQYTGEWNGNKKNGKGTMQWKKSKAIYDGDWKDDRRCGYGTYSIKE-TSGYRKIYSGGWKNDKRHGYGTNFYSPTEYYEGEWYADKRSGWGRMYYSDGAVYEGEWYDDKQNGEGMLRLANENRYEGEWKDGLKHGKGIFYFLDKGQKYTGVWALDIPKCGTMEDFGREKAPEPTTYPIPECTLEDAKGVLKEAEDTFLDE 234          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Nematostella
Match: EDO27248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9S6])

HSP 1 Score: 85.5001 bits (210), Expect = 3.867e-20
Identity = 60/164 (36.59%), Postives = 88/164 (53.66%), Query Frame = 1
Query:  364 YEGDWKDD-KKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWV-NNVSKCGQLH--------DWNRETAPHPTEFPLRN 825
            YEG+  +D +++G+G   +  G DTY+ +Y+    N  RHG+G   + +   YEGE+   KR G G MY  DG++Y+GEW+N++  G G  +  NG+ YEG+WK G R+G+G Y Y D G   KG W        GQ+H         +  ET   P  F  + 
Sbjct:    3 YEGERNNDGERHGYGTALLTSG-DTYQGLYN----NGKRHGYGIYRFVNKARYEGEYVNNKREGTGTMYFPDGSMYKGEWKNNKRSGNGKYKYANGDTYEGEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFDGKGQVHTPYYVYNGTFYDETPRGPGRFSFKT 161          

HSP 2 Score: 58.9214 bits (141), Expect = 1.106e-10
Identity = 43/124 (34.68%), Postives = 67/124 (54.03%), Query Frame = 1
Query:  265 TIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGR-MYEADGNVYEGEWENDQMCGQGML 633
            T    +GD Y G +NN  ++G G +Y       YEG++ ++K+ G G +    G      +Y G WKNN R G G+  Y++ + YEGEW  G+R+G G  +Y+  G  Y+G W   +  G+G +
Sbjct:   18 TALLTSGDTYQGLYNNGKRHGYG-IYRFVNKARYEGEYVNNKREGTGTMYFPDG-----SMYKGEWKNNKRSGNGKYKYANGDTYEGEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFDGKGQV 135          

HSP 3 Score: 56.6102 bits (135), Expect = 7.363e-10
Identity = 50/133 (37.59%), Postives = 69/133 (51.88%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEF-YEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQW 669
            FVN  +Y G++ NN + G GTMY    G MY+G+WK++K++G G      G DTYE    G WK   RHG G   Y      Y+G W  GK +G G+++     VY G + ++   G G    K G    GQ+
Sbjct:   44 FVNKARYEGEYVNNKREGTGTMYF-PDGSMYKGEWKNNKRSGNGKYKYANG-DTYE----GEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFDGKGQVHTPY-YVYNGTFYDETPRGPGRFSFKTGCAQTGQY 169          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Nematostella
Match: EDO37043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGU9])

HSP 1 Score: 81.2629 bits (199), Expect = 2.036e-18
Identity = 45/105 (42.86%), Postives = 63/105 (60.00%), Query Frame = 1
Query:  445 IYSGGWKNNLRHGFGENWYSSNE--FYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNV 753
            ++ G ++N  RHG G+  +S+     YEG + +GKR+G G MY  DG++Y+G W      G+G  +  NG+ YEG WKNG RNG G Y Y +KG    G W+N V
Sbjct:   44 LFEGHYENGKRHGAGKYVFSAGNGVRYEGHYSKGKRHGQGVMYYPDGSIYDGTWSEGLRSGKGKYKYANGDVYEGNWKNGKRNGLGTYTYQEKGMTFTGNWINGV 148          

HSP 2 Score: 60.4622 bits (145), Expect = 4.767e-11
Identity = 41/120 (34.17%), Postives = 60/120 (50.00%), Query Frame = 1
Query:  343 LTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLR-NKNGNRYEGQWKNGMRNGEGK 699
                G ++EG +++ K++G G      G       Y G +    RHG G  +Y     Y+G W EG R+G G+   A+G+VYEG W+N +  G G     + G  + G W NG+  GEGK
Sbjct:   38 FLPNGDLFEGHYENGKRHGAGKYVFSAGNGVR---YEGHYSKGKRHGQGVMYYPDGSIYDGTWSEGLRSGKGKYKYANGDVYEGNWKNGKRNGLGTYTYQEKGMTFTGNWINGVFEGEGK 154          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Nematostella
Match: EDO39343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAB7])

HSP 1 Score: 80.4925 bits (197), Expect = 6.094e-18
Identity = 63/193 (32.64%), Postives = 103/193 (53.37%), Query Frame = 1
Query:  280 NGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNV-YEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPL-RNIELESPYKV 852
            NGD Y G + N  ++G+GT Y+  +G  Y G ++++KKNG G  +   G       Y G W ++ RHG G  +Y++ + YEGEW   +R+G G   +A  NV  EG WE  ++ G   + + + +R+EG +   +  G GKY + +KG +  G++ + V K    +D   E    PT  P+ + + LE+   V
Sbjct:   37 NGDLYTGSYWNGKRHGKGT-YIFRKGARYMGFYENNKKNGKGTFTYPDGSR-----YEGTWSDDERHGVGTYFYTNGDTYEGEWRSNRRHGKGTYTDAHTNVKLEGTWEKGKLNGHCKIIHSD-HRFEGVFAENLPTGPGKYVF-EKGFIQYGLY-HIVEKKQSKYDEEEE----PTRTPIWKCVALEATIPV 216          

HSP 2 Score: 60.4622 bits (145), Expect = 7.943e-11
Identity = 48/158 (30.38%), Postives = 81/158 (51.27%), Query Frame = 1
Query:  289 QYVGDWNN-NMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGN-RYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVS 756
            +Y GD N    ++G+G   L   G +Y G + + K++G G    +KG       Y G ++NN ++G G   Y     YEG W + +R+G G  +  +G+ YEGEW +++  G+G   + + N + EG W+ G  NG  K  + D     +G++  N+ 
Sbjct:   16 EYEGDRNELGERHGQGKA-LHGNGDLYTGSYWNGKRHGKGTYIFRKGAR-----YMGFYENNKKNGKGTFTYPDGSRYEGTWSDDERHGVGTYFYTNGDTYEGEWRSNRRHGKGTYTDAHTNVKLEGTWEKGKLNGHCKIIHSD--HRFEGVFAENLP 165          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Nematostella
Match: EDO46888 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN9])

HSP 1 Score: 77.0258 bits (188), Expect = 2.884e-17
Identity = 49/131 (37.40%), Postives = 68/131 (51.91%), Query Frame = 1
Query:  460 WKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWV-NNVSKCGQLH--------DWNRETAPHPTEFPLRN 825
            + N  RHG+G   + +   YEGE+   KR G G MY  DG++Y+GEW+N++  G G  +  NG+ YEG+WK G R+G+G Y Y D G   KG W        GQ+H         +  ET   P  F  + 
Sbjct:    2 YNNGKRHGYGIYRFVNKARYEGEYVNNKREGTGTMYFPDGSLYKGEWKNNKRSGNGKYKYVNGDTYEGEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFGGKGQVHTPYYVYNGTFYDETPRGPGRFSFKT 132          

HSP 2 Score: 55.8398 bits (133), Expect = 1.070e-9
Identity = 49/133 (36.84%), Postives = 68/133 (51.13%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEF-YEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQW 669
            FVN  +Y G++ NN + G GTMY    G +Y+G+WK++K++G G      G DTYE    G WK   RHG G   Y      Y+G W  GK  G G+++     VY G + ++   G G    K G    GQ+
Sbjct:   15 FVNKARYEGEYVNNKREGTGTMYF-PDGSLYKGEWKNNKRSGNGKYKYVNG-DTYE----GEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFGGKGQVHTPY-YVYNGTFYDETPRGPGRFSFKTGCAQTGQY 140          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000010654.2 (MORN repeat containing 3 [Source:NCBI gene;Acc:101168558])

HSP 1 Score: 162.155 bits (409), Expect = 3.817e-48
Identity = 84/214 (39.25%), Postives = 131/214 (61.21%), Query Frame = 1
Query:  247 KKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDT-YEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQ 885
            K G  HT++ +NGD+Y G+W +N K+G G     + G +Y G+W+  K +G+G   V   +   Y   Y G WKN  +HG+G  +Y++   YEGEW EG+R+G G+M+  + ++YEGEW  D+  G+G L   NG+ YEG WK+G RNG GK Y  +KG +  G W++  +KCG L ++ ++ AP P++     + L  P +V+KEA+  + S+
Sbjct:   17 KSGFRHTVFSLNGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDGEAKCGTLCEYEKDKAPEPSKCKFPKLHLVDPEQVLKEAQHCYHSK 230          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000030376.1 (MORN repeat containing 3 [Source:NCBI gene;Acc:101168558])

HSP 1 Score: 157.147 bits (396), Expect = 4.460e-46
Identity = 81/212 (38.21%), Postives = 128/212 (60.38%), Query Frame = 1
Query:  247 KKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDT-YEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFL 879
            K G  HT++ +NGD+Y G+W +N K+G G     + G +Y G+W+  K +G+G   V   +   Y   Y G WKN  +HG+G  +Y++   YEGEW EG+R+G G+M+  + ++YEGEW  D+  G+G L   NG+ YEG WK+G RNG GK Y  +KG +  G W++  +KCG L ++ ++ AP P++     ++     +V+KEA+   +
Sbjct:   23 KSGFRHTVFSLNGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDGEAKCGTLCEYEKDKAPEPSKCKFPKVKHRKKDQVLKEAQSVLI 234          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Medaka
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 [Source:NCBI gene;Acc:101169837])

HSP 1 Score: 82.4185 bits (202), Expect = 6.305e-17
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query:  364 YEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-----NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNR-----YEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSK 759
            YEG W   K +G GVL    G+     IY+G +KN L  GFGE        + N+ Y+G W +GK +G G    A G VY+G +++    G GMLR+   N      + GQW    + G G +  I KG+   G+W +++ +
Sbjct:  915 YEGGWVSGKPHGSGVLKWPDGR-----IYTGTFKNGLEDGFGEFLAPNKPLNKNDCYQGHWKDGKMHGPGTYRYASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFDDITKGEKFMGMWQDHLRQ 1051          

HSP 2 Score: 70.8626 bits (172), Expect = 4.162e-13
Identity = 44/150 (29.33%), Postives = 77/150 (51.33%), Query Frame = 1
Query:  265 TIYFVNGDQYVGDWNNNMKNGRGTMYL----TSQGLMYEGDWKDDKKNGFGVLS-VKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWEND-QMCGQGMLRNKNGNRYE----GQWKNGMR 684
            T  + +G+ Y G + + +++G G +      TS   ++ G W  DKK G+GV   + KG+      + G W+++LR G G        +YEG + + K  G G +   D   YEG++ +D  + G+G+L   NG+  E    G+W +G++
Sbjct:  980 TYRYASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFDDITKGEK-----FMGMWQDHLRQGTGVVVTQFGLYYEGAFKDNKMAGTGVLVSEDDTTYEGDFSDDWTLSGKGVLTLANGDYLEGSFSGEWGSGLK 1124          

HSP 3 Score: 65.855 bits (159), Expect = 2.147e-11
Identity = 37/131 (28.24%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  286 DQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKN 675
            D Y G W +   +G GT Y  + G +Y+G ++D  ++G G+L   K   +   ++ G W  + + G+G  +  +  E + G W +  R G G +    G  YEG +++++M G G+L +++   YEG + +
Sbjct:  964 DCYQGHWKDGKMHGPGT-YRYASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFDDITKGEKFMGMWQDHLRQGTGVVVTQFGLYYEGAFKDNKMAGTGVLVSEDDTTYEGDFSD 1093          

HSP 4 Score: 62.7734 bits (151), Expect = 1.989e-10
Identity = 41/149 (27.52%), Postives = 71/149 (47.65%), Query Frame = 1
Query:  280 NGDQYVGDWNNNMKNGRGTMYLTSQGL----MYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFG-----ENWYSSNEFYEGEWYEGKRNGWGRMYE-ADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEG 696
            +G  Y G + N +++G G     ++ L     Y+G WKD K +G G      G+     +Y G +++ +RHG G     +   SS   + G+W + K+ G+G   +   G  + G W++    G G++  + G  YEG +K+    G G
Sbjct:  934 DGRIYTGTFKNGLEDGFGEFLAPNKPLNKNDCYQGHWKDGKMHGPGTYRYASGE-----VYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFDDITKGEKFMGMWQDHLRQGTGVVVTQFGLYYEGAFKDNKMAGTG 1077          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000019355.2 (alsin-like [Source:NCBI gene;Acc:101160203])

HSP 1 Score: 82.4185 bits (202), Expect = 6.733e-17
Identity = 45/154 (29.22%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  289 QYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNN 750
            QY G W     +G GT+     G +Y+G++K+  ++G+G  ++   +      Y G WK    HGFG+  Y+S E YEG ++EG+R+G+G                  M   G L   + + + G W +G + G G +  I +GQ   G+W+++
Sbjct: 1025 QYTGGWLAGRLHGSGTLKW-PDGRLYKGNFKNGLEDGYGECTIPNKESNKPDSYQGQWKEGRIHGFGKYKYASGEVYEGCFWEGQRHGYG------------------MLSSGKLTRTSSSMFIGHWVHGRKTGYGVFDDITRGQKYMGLWLDD 1159          

HSP 2 Score: 60.4622 bits (145), Expect = 1.124e-9
Identity = 37/153 (24.18%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  286 DQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIW 741
            D Y G W     +G G  Y  + G +YEG + + +++G+G+LS  K   T   ++ G W +  + G+G  +  +  + Y G W + +R+G   +    G  +EG +  ++M G G+L +++   + G++ +          ++  G  L G++
Sbjct: 1075 DSYQGQWKEGRIHGFGK-YKYASGEVYEGCFWEGQRHGYGMLSSGKLTRTSSSMFIGHWVHGRKTGYGVFDDITRGQKYMGLWLDDQRHGNAIVISQHGVYFEGTFRENKMSGPGLLVSEDETTFHGEFSDDWTVSGKGVLFLANGDSLDGMF 1226          
BLAST of MORN repeat-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000036843.1 (alsin-like [Source:NCBI gene;Acc:101160203])

HSP 1 Score: 82.4185 bits (202), Expect = 6.738e-17
Identity = 45/154 (29.22%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  289 QYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNN 750
            QY G W     +G GT+     G +Y+G++K+  ++G+G  ++   +      Y G WK    HGFG+  Y+S E YEG ++EG+R+G+G                  M   G L   + + + G W +G + G G +  I +GQ   G+W+++
Sbjct: 1033 QYTGGWLAGRLHGSGTLKW-PDGRLYKGNFKNGLEDGYGECTIPNKESNKPDSYQGQWKEGRIHGFGKYKYASGEVYEGCFWEGQRHGYG------------------MLSSGKLTRTSSSMFIGHWVHGRKTGYGVFDDITRGQKYMGLWLDD 1167          

HSP 2 Score: 60.4622 bits (145), Expect = 1.125e-9
Identity = 37/153 (24.18%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  286 DQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGE-NWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIW 741
            D Y G W     +G G  Y  + G +YEG + + +++G+G+LS  K   T   ++ G W +  + G+G  +  +  + Y G W + +R+G   +    G  +EG +  ++M G G+L +++   + G++ +          ++  G  L G++
Sbjct: 1083 DSYQGQWKEGRIHGFGK-YKYASGEVYEGCFWEGQRHGYGMLSSGKLTRTSSSMFIGHWVHGRKTGYGVFDDITRGQKYMGLWLDDQRHGNAIVISQHGVYFEGTFRENKMSGPGLLVSEDETTFHGEFSDDWTVSGKGVLFLANGDSLDGMF 1234          
BLAST of MORN repeat-containing protein 3 vs. Planmine SMEST
Match: SMESG000011788.1 (SMESG000011788.1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.674e-173
Identity = 235/236 (99.58%), Postives = 236/236 (100.00%), Query Frame = 1
Query:  184 KEKSTNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQIP 891
            KEKSTNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAE+YFLSQIP
Sbjct:    7 KEKSTNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEDYFLSQIP 242          
BLAST of MORN repeat-containing protein 3 vs. Planmine SMEST
Match: SMESG000014300.1 (SMESG000014300.1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.862e-17
Identity = 59/168 (35.12%), Postives = 90/168 (53.57%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGR-MYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLH 774
              NGD Y G + N  ++G GT Y    G  Y G++ ++KK+G G+     G       Y G W ++ R+G G+ +Y + +++EGEW    R+G G   Y+A G+ Y G W+  +M G G L + N ++Y GQWKNG+ NG+GKY +      L G +   +   G  H
Sbjct:   38 LPNGDTYEGLYENGKRHGHGT-YRFKNGARYIGEYSENKKHGHGIFFYPDGSK-----YEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVFDHVKCQLTGEYA-PIPTTGDEH 197          

HSP 2 Score: 74.3294 bits (181), Expect = 6.931e-15
Identity = 46/119 (38.66%), Postives = 68/119 (57.14%), Query Frame = 1
Query:  385 DKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIW 741
            D+++G G  ++  G DTYE +Y  G     RHG G   + +   Y GE+ E K++G G  +  DG+ YEG W +DQ  G G     NG+ +EG+WKN +R+G+G Y+Y   G    G+W
Sbjct:   28 DERHGSGKATLPNG-DTYEGLYENG----KRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVW 141          

HSP 3 Score: 50.447 bits (119), Expect = 6.839e-7
Identity = 32/90 (35.56%), Postives = 48/90 (53.33%), Query Frame = 1
Query:  220 WYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFG 489
            W D  +  N K      Y++NGD + G+W N++++G+GT +  + G  Y G WK+ K NG+G L     K      Y G WKN + +G G
Sbjct:   94 WIDDQRNGNGK-----YYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSNHK------YVGQWKNGVMNGKG 172          
BLAST of MORN repeat-containing protein 3 vs. Planmine SMEST
Match: SMESG000047536.1 (SMESG000047536.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.438e-15
Identity = 41/120 (34.17%), Postives = 69/120 (57.50%), Query Frame = 1
Query:  388 KKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVN 747
            +++GFG   +  G      +Y G ++N  RHG+G   + +   Y G++ E  ++G G  Y  DG+ YEGEW ND+  G+G+    NG+ Y+G+W++  R+G+G Y+Y       +G+W N
Sbjct:   29 ERHGFGKARLPNGD-----VYEGFYQNGKRHGYGTYIFKNGARYIGDYVENIKSGKGLFYYLDGSKYEGEWANDERNGKGVYSYINGDYYDGEWRDAKRHGQGTYFYAVNASKYEGVWNN 143          

HSP 2 Score: 66.2402 bits (160), Expect = 1.493e-12
Identity = 45/124 (36.29%), Postives = 69/124 (55.65%), Query Frame = 1
Query:  265 TIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEF-YEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGML 633
            T  F NG +Y+GD+  N+K+G+G  Y    G  YEG+W +D++NG GV S   G       Y G W++  RHG G  +Y+ N   YEG W  G   G+G++  A+ + Y G W+++++   G  
Sbjct:   58 TYIFKNGARYIGDYVENIKSGKGLFYYLD-GSKYEGEWANDERNGKGVYSYING-----DYYDGEWRDAKRHGQGTYFYAVNASKYEGVWNNGSMEGYGQIIHAN-HKYVGYWKDNKIIRNGKF 174          

HSP 3 Score: 63.5438 bits (153), Expect = 1.364e-11
Identity = 54/161 (33.54%), Postives = 80/161 (49.69%), Query Frame = 1
Query:  274 FVNGDQYVGDWNNNM-KNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGM-LRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNN 750
            F+N   YVG+ N    ++G G   L + G +YEG +++ K++G+G    K G       Y G +  N++ G G  +Y     YEGEW   +RNG G     +G+ Y+GEW + +  GQG      N ++YEG W NG   G G+   I       G W +N
Sbjct:   14 FINLGTYVGERNEKKERHGFGKARLPN-GDVYEGFYQNGKRHGYGTYIFKNGAR-----YIGDYVENIKSGKGLFYYLDGSKYEGEWANDERNGKGVYSYINGDYYDGEWRDAKRHGQGTYFYAVNASKYEGVWNNGSMEGYGQ--IIHANHKYVGYWKDN 166          
BLAST of MORN repeat-containing protein 3 vs. Planmine SMEST
Match: SMESG000012434.1 (SMESG000012434.1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.479e-15
Identity = 56/181 (30.94%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  211 KPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNV 753
            K F Y+ + +  KK  H      +G  Y G++ N    G+G  Y    G MY G++ + +  G G +    G +     Y G W +N R G G+  Y++ + YEGE+Y+ K +G G M   +G++Y G W      G G +   +G+ YEGQ+   + +GEG  ++I  G +  G+W  N+
Sbjct:   14 KFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDE-----YHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLWEQNL 188          

HSP 2 Score: 62.7734 bits (151), Expect = 1.009e-10
Identity = 48/162 (29.63%), Postives = 77/162 (47.53%), Query Frame = 1
Query:  316 MKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGEN-WYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAP 798
            ++ G G     ++   YEG+W+  KK+G G   +  G       Y G ++N    G GE  W  +   Y GE++ G+  G G M+  +G+ Y G+W ++   G G L   NG+ YEG++     +GEG    ++ G +  G W+     CG  H   + T P
Sbjct:    2 LREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADG-----SFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWI-----CGNKHGHGKMTMP 152          

HSP 3 Score: 61.6178 bits (148), Expect = 2.449e-10
Identity = 38/117 (32.48%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  268 IYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMC 618
            +++ NGD+Y GDWN+N + G G +   + G +YEG++   K +G G++ +  G      IYSG W    +HG G+        YEG++     +G G ++   G +Y G WE +  C
Sbjct:   80 MFYGNGDEYHGDWNSNSREGNGQLTY-ANGDVYEGEFYKHKIHGEGIMRLMNGS-----IYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPC 190          
BLAST of MORN repeat-containing protein 3 vs. Planmine SMEST
Match: SMESG000012434.1 (SMESG000012434.1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.906e-15
Identity = 56/181 (30.94%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  211 KPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNV 753
            K F Y+ + +  KK  H      +G  Y G++ N    G+G  Y    G MY G++ + +  G G +    G +     Y G W +N R G G+  Y++ + YEGE+Y+ K +G G M   +G++Y G W      G G +   +G+ YEGQ+   + +GEG  ++I  G +  G+W  N+
Sbjct:   30 KFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDE-----YHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLWEQNL 204          

HSP 2 Score: 69.3218 bits (168), Expect = 7.333e-13
Identity = 51/170 (30.00%), Postives = 82/170 (48.24%), Query Frame = 1
Query:  292 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGEN-WYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCGQLHDWNRETAP 798
            Y+G+ N  ++ G G     ++   YEG+W+  KK+G G   +  G       Y G ++N    G GE  W  +   Y GE++ G+  G G M+  +G+ Y G+W ++   G G L   NG+ YEG++     +GEG    ++ G +  G W+     CG  H   + T P
Sbjct:   10 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADG-----SFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWI-----CGNKHGHGKMTMP 168          

HSP 3 Score: 61.2326 bits (147), Expect = 2.839e-10
Identity = 38/117 (32.48%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  268 IYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMC 618
            +++ NGD+Y GDWN+N + G G +   + G +YEG++   K +G G++ +  G      IYSG W    +HG G+        YEG++     +G G ++   G +Y G WE +  C
Sbjct:   96 MFYGNGDEYHGDWNSNSREGNGQLTY-ANGDVYEGEFYKHKIHGEGIMRLMNGS-----IYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPC 206          
The following BLAST results are available for this feature:
BLAST of MORN repeat-containing protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC084018.31.501e-7044.30MORN repeat-containing protein 3 [Source:UniProtK... [more]
AC084018.31.501e-7044.30MORN repeat-containing protein 3 [Source:UniProtK... [more]
MORN31.501e-7044.30MORN repeat containing 3 [Source:HGNC Symbol;Acc:H... [more]
MORN32.809e-3745.39MORN repeat containing 3 [Source:HGNC Symbol;Acc:H... [more]
MORN32.809e-3745.39MORN repeat containing 3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
jph-17.452e-743.33JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667][more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG304298.217e-3133.33gene:FBgn0050429 transcript:FBtr0072450[more]
CG144904.318e-2937.20gene:FBgn0034281 transcript:FBtr0086801[more]
jp8.226e-1129.47gene:FBgn0032129 transcript:FBtr0079861[more]
jp8.226e-1129.47gene:FBgn0032129 transcript:FBtr0079860[more]
jp8.226e-1129.47gene:FBgn0032129 transcript:FBtr0304056[more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
morn35.901e-6744.44MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
morn39.296e-6744.44MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
rsph10b3.629e-1935.11radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
rsph10b3.837e-1935.11radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
als2b1.133e-1632.37alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000041404.11.720e-1838.18radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
igf29.679e-1831.25insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
igf21.195e-1731.40insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
igf22.268e-1731.40insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
igf22.483e-1731.40insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Morn31.966e-7246.29MORN repeat containing 3 [Source:MGI Symbol;Acc:MG... [more]
Morn32.978e-3844.16MORN repeat containing 3 [Source:MGI Symbol;Acc:MG... [more]
Morn32.978e-3844.16MORN repeat containing 3 [Source:MGI Symbol;Acc:MG... [more]
Morn31.728e-1740.78MORN repeat containing 3 [Source:MGI Symbol;Acc:MG... [more]
Rsph10b1.394e-1533.13radial spoke head 10 homolog B (Chlamydomonas) [So... [more]
back to top
BLAST of MORN repeat-containing protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5PPV3|MORN3_XENLA7.777e-7547.19MORN repeat-containing protein 3 OS=Xenopus laevis... [more]
sp|Q32KM6|MORN3_BOVIN5.899e-7245.13MORN repeat-containing protein 3 OS=Bos taurus OX=... [more]
sp|Q8C5T4|MORN3_MOUSE1.375e-7146.29MORN repeat-containing protein 3 OS=Mus musculus O... [more]
sp|Q6PF18|MORN3_HUMAN7.210e-7044.30MORN repeat-containing protein 3 OS=Homo sapiens O... [more]
sp|Q4R842|MORN3_MACFA2.536e-6944.74MORN repeat-containing protein 3 OS=Macaca fascicu... [more]
back to top
BLAST of MORN repeat-containing protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PCT44.232e-9156.28Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3IAB99.890e-8755.26MORN repeat-containing protein 3 OS=Lingula unguis... [more]
A0A2G8KJG31.601e-8453.04Putative MORN repeat-containing protein 3 OS=Stich... [more]
A0A2G8LLP11.654e-8453.04Putative MORN repeat-containing protein 3 OS=Stich... [more]
A7S5302.368e-8453.95Predicted protein OS=Nematostella vectensis OX=453... [more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
morn31.531e-6245.70MORN repeat-containing protein 3 [Source:NCBI gene... [more]
als2b2.951e-1731.94alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
als2b3.547e-1731.94alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
als2b4.461e-1731.94alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
rsph10b4.963e-1534.30radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH10B29.112e-1626.98radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B23.507e-1530.23radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
ENSPMAT00000001977.11.320e-1335.11pep scaffold:Pmarinus_7.0:GL478223:216506:238429:-... [more]
ENSPMAT00000003398.11.352e-1130.43pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-... [more]
ENSPMAT00000002910.12.077e-1130.94pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 g... [more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411703.274e-8853.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272483.867e-2036.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370432.036e-1842.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393436.094e-1832.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468882.884e-1737.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000010654.23.817e-4839.25MORN repeat containing 3 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000030376.14.460e-4638.21MORN repeat containing 3 [Source:NCBI gene;Acc:101... [more]
als2b6.305e-1734.51alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
ENSORLT00000019355.26.733e-1729.22alsin-like [Source:NCBI gene;Acc:101160203][more]
ENSORLT00000036843.16.738e-1729.22alsin-like [Source:NCBI gene;Acc:101160203][more]
back to top
BLAST of MORN repeat-containing protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011788.11.674e-17399.58SMESG000011788.1[more]
SMESG000014300.17.862e-1735.12SMESG000014300.1[more]
SMESG000047536.11.438e-1534.17SMESG000047536.1[more]
SMESG000012434.12.479e-1530.94SMESG000012434.1[more]
SMESG000012434.12.906e-1530.94SMESG000012434.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023091 ID=SMED30023091|Name=MORN repeat-containing protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=972bp
ACTACAACGCGGATTTTTAATAGATTTGTATTATTTACAATCCTTTTTCC
ATTATTAATTATAATTTTACCAACAATTTACAACAGTTAAGTCATTCCCC
AATAATAAAGATATATAAATATATTATTTAAAAAGTATTATTTAATTTTA
AATATCATAATTTAAATGTCCAGCTGTCTTTTAAAAGAAAAATCTACTAA
TAGAAGTAAAAAGCCATTTTGGTATGATGCCGATAAAAAAGCGAATAAGA
AAGGTTTACATCATACAATTTATTTTGTTAATGGAGATCAATATGTTGGA
GATTGGAATAATAATATGAAAAATGGAAGGGGAACTATGTATCTCACTTC
ACAAGGGTTGATGTATGAAGGAGATTGGAAAGATGACAAAAAAAATGGAT
TTGGTGTATTAAGTGTAAAAAAAGGCAAAGACACATATGAAAAAATATAT
TCTGGGGGCTGGAAGAATAATTTGCGCCATGGATTCGGTGAGAATTGGTA
TTCTTCAAATGAGTTTTATGAAGGAGAATGGTATGAAGGCAAACGGAATG
GATGGGGCAGAATGTATGAGGCAGATGGTAATGTCTATGAAGGCGAATGG
GAAAATGATCAAATGTGTGGCCAAGGAATGTTGAGAAATAAAAATGGCAA
CAGATATGAAGGTCAATGGAAAAATGGAATGAGAAATGGAGAAGGGAAAT
ATTATTATATTGACAAAGGACAAATGTTGAAGGGTATTTGGGTGAATAAT
GTATCAAAATGCGGTCAACTGCACGACTGGAATCGGGAAACTGCTCCCCA
TCCGACAGAGTTTCCTTTGAGAAATATTGAGCTCGAATCTCCATATAAAG
TTATTAAAGAAGCGGAAGAATATTTCCTATCGCAAATTCCGTGATTTTTC
AACTGAAAAATTCCTCTGTAACAAATTGTGATTTAATTGTGTTTCTCGAT
ATTTGTAAGGATTACAATTAAG
back to top

protein sequence of SMED30023091-orf-1

>SMED30023091-orf-1 ID=SMED30023091-orf-1|Name=SMED30023091-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=243bp
MSSCLLKEKSTNRSKKPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNN
MKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWK
NNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQM
CGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNVSKCG
QLHDWNRETAPHPTEFPLRNIELESPYKVIKEAEEYFLSQIP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003409MORN
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003409MORN motifSMARTSM00698morncoord: 162..183
e-value: 1.9E-6
score: 37.4
coord: 41..62
e-value: 0.0063
score: 25.7
coord: 93..114
e-value: 0.37
score: 17.3
coord: 139..160
e-value: 3.6E-5
score: 33.2
coord: 65..86
e-value: 0.2
score: 19.3
coord: 116..137
e-value: 0.23
score: 18.8
IPR003409MORN motifPFAMPF02493MORNcoord: 164..184
e-value: 4.0E-6
score: 26.4
coord: 67..82
e-value: 2.7E-4
score: 20.6
coord: 95..108
e-value: 0.0056
score: 16.5
coord: 43..60
e-value: 0.0028
score: 17.4
coord: 141..163
e-value: 1.0E-5
score: 25.1
coord: 118..139
e-value: 0.075
score: 13.0
NoneNo IPR availableGENE3DG3DSA:2.20.110.10coord: 22..97
e-value: 7.9E-10
score: 40.7
coord: 98..165
e-value: 1.4E-13
score: 52.8
NoneNo IPR availablePANTHERPTHR46511FAMILY NOT NAMEDcoord: 10..237
NoneNo IPR availableSUPERFAMILYSSF82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 94..195
NoneNo IPR availableSUPERFAMILYSSF82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 33..88