Non-specific serine/threonine protein kinase

Overview
NameNon-specific serine/threonine protein kinase
Smed IDSMED30023085
Length (bp)2024
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Non-specific serine/threonine protein kinase (SMED30023085) t-SNE clustered cells

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30023085) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Non-specific serine/threonine protein kinase (SMED30023085) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30023085) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023085

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30023085h1SMcG0003858 SmedASXL_013292SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30023085h1SMcG0003858 Contig54032uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023085h1SMcG0003858 Contig54032newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30023085h1SMcG0003858 dd_Smed_v4_11674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023085h1SMcG0003858 dd_Smed_v4_11674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023085h1SMcG0003858 dd_Smed_v4_11674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023085h1SMcG0003858 dd_Smed_v4_11674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023085h1SMcG0003858 dd_Smed_v4_11674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 407.142 bits (1045), Expect = 2.979e-135
Identity = 202/357 (56.58%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K + G +  K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   17 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 369          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 405.601 bits (1041), Expect = 5.010e-135
Identity = 202/357 (56.58%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPG-VKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K + G +  K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 407.142 bits (1045), Expect = 1.672e-134
Identity = 202/357 (56.58%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K + G +  K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: RPS6KB2 (ribosomal protein S6 kinase B2 [Source:HGNC Symbol;Acc:HGNC:10437])

HSP 1 Score: 402.134 bits (1032), Expect = 2.678e-133
Identity = 193/357 (54.06%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERL-GCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E VE+ ++ VN G  +I    F++L V+G+GGYGKVF V+K   G +  K+YAMKVL+KA+I+RN KDTAHT++ERNILE ++HPF+V+L YAFQ    LY++L   SGGELFT+LEREG  +E+ ACFY+AEI+LA+GHLH  GIIYRDLKPEN++L  +GH+KLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++T+ KI+   +A P Y + +   L++  LKRNP +R+ G   D  D++ H FF+   +NW D+   R+DPPF+P L+SE DVS FD+ FT Q P+ +PDD   +      F GF+YVAP+V  S+
Sbjct:   46 EEVELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAE-NRKKTMDKIIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFR--HMNWDDLLAWRVDPPFRPCLQSEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSI 398          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 372.474 bits (955), Expect = 2.260e-121
Identity = 189/357 (52.94%), Postives = 244/357 (68.35%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGK                        A I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGK------------------------AMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 399          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: rsks-1 (Ribosomal protein S6 kinase beta [Source:UniProtKB/Swiss-Prot;Acc:Q9NAH6])

HSP 1 Score: 403.675 bits (1036), Expect = 2.642e-133
Identity = 199/358 (55.59%), Postives = 265/358 (74.02%), Query Frame = 2
Query:  200 EDDDIESVEICQSVVNP-GVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNV 1258
            ED  +ES+++C S +NP  V++  EDF++L V+G+GGYGKVF V+K++ G D  +++AMKVL+KA I+RN+KDTAHTK+ERNILE ++ PF+  L YAFQ    LY++L Y SGGELF +LEREG  MEN A FY++EI +++ HLH+ GIIYRDLKPEN+LLD  GHVKLTDFGL KE +     T+TFCGTIEYMAPEIL R GHGK VDWWSLG L+FDML+GGPPF+ E ++++TI KIL   +  P Y S+E   LI+ LLKR+   RLG   +D E+IK+H FFKT D  W+ VY R+++ PFKP ++++ D S FD+ FT   P+ +P + N +    + F GF+YVAP+V
Sbjct:   57 EDPMMESIQLCASAINPPNVRVGPEDFQLLKVLGKGGYGKVFQVRKTT-GSDNGQIFAMKVLQKATIVRNQKDTAHTKAERNILEAVKSPFICDLLYAFQTGGKLYLILEYLSGGELFMHLEREGMFMENVAKFYLSEIVVSLEHLHQQGIIYRDLKPENILLDAYGHVKLTDFGLCKEEIEGDQKTHTFCGTIEYMAPEILMRCGHGKAVDWWSLGALMFDMLTGGPPFTAE-NRRKTIDKILKGRLTLPAYLSNEARDLIKKLLKRHVDTRLGAGLSDAEEIKSHAFFKTTD--WNLVYARQLEAPFKPNIENDEDTSLFDARFTKMTPVDSPCETNFSLNGDNPFVGFTYVAPSV 410          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 315.849 bits (808), Expect = 1.734e-97
Identity = 172/375 (45.87%), Postives = 236/375 (62.93%), Query Frame = 2
Query:  161 IQQFIQNGPLKREEDDDIES-VEI-CQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKND-VEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPI---MTPDDCNGAHILPDLFQGFSYVAPNV 1258
            +++F +N   + EE  D  S  EI    V   G K     F++L V+G+G +GKVFLV+K   G D   +YAMKVLKKA +    +D   TK ERNIL  I HPF+VKLHYAFQ +  LY++L +  GG+LFT L +E    E+   FY+AE++LA+ HLH  GI+YRDLKPEN+LLD  GH+K+TDFGLSKE++     T +FCGT+EYMAPE++ R GH    D+WSLG L+F+ML+G  PF Q  D+ +T+T+IL + ++ P + + E   L++ L KRN + RLG   D VE+IK H FF    I++  + ++ +DPPFKP L +    S FD  FT + P      P   NG  I    F+GFS+V+  V
Sbjct:    7 VEEFAENEIEQGEEKTDSSSETEIDIGDVRKCGEKADPRQFELLKVLGQGSFGKVFLVRKVR-GRDSGHVYAMKVLKKATL--KVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPF-QGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAK--IDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASANGHEI----FRGFSFVSNAV 371          

HSP 2 Score: 109.768 bits (273), Expect = 1.090e-24
Identity = 75/270 (27.78%), Postives = 137/270 (50.74%), Query Frame = 2
Query:  269 EDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTL-MENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKK----GHVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHS------TIAYPKY--FSSEVVRLIQGLLKRNPKERLGCKNDVE 1030
            +D+++L  IG G +  V   Q  ++     + YA+K++KKA     E+          +L    H F+VKL   +++++ +Y++   C GGEL   L  + +L  E +    +A +  A+ +LH   + +RDL   N+L   K      +++ DFG +K+S +   +  T C T +++APE+L++ G+ +  D WSLG LL  ML+G  PF+      +T  +IL        ++ +P +   S E   L++ +L  +P  R+  K  ++
Sbjct:  395 DDYEILEKIGNGAHSVVHKCQMKAT----RRKYAVKIVKKAVFDATEEVDI-------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFA--MGPNDTPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQ 651          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 315.464 bits (807), Expect = 4.333e-97
Identity = 167/361 (46.26%), Postives = 228/361 (63.16%), Query Frame = 2
Query:  197 EEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKND-VEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPI---MTPDDCNGAHILPDLFQGFSYVAPNV 1258
            E + DI  V  C    +P        F++L V+G+G +GKVFLV+K   G D   +YAMKVLKKA +    +D   TK ERNIL  I HPF+VKLHYAFQ +  LY++L +  GG+LFT L +E    E+   FY+AE++LA+ HLH  GI+YRDLKPEN+LLD  GH+K+TDFGLSKE++     T +FCGT+EYMAPE++ R GH    D+WSLG L+F+ML+G  PF Q  D+ +T+T+IL + ++ P + + E   L++ L KRN + RLG   D VE+IK H FF    I++  + ++ +DPPFKP L +    S FD  FT + P      P   NG  I    F+GFS+V+  V
Sbjct:   45 ETEIDIGDVRKCGEKADP------RQFELLKVLGQGSFGKVFLVRKVR-GRDSGHVYAMKVLKKATL--KVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPF-QGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAK--IDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASANGHEI----FRGFSFVSNAV 389          

HSP 2 Score: 110.153 bits (274), Expect = 8.605e-25
Identity = 75/270 (27.78%), Postives = 137/270 (50.74%), Query Frame = 2
Query:  269 EDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTL-MENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKK----GHVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHS------TIAYPKY--FSSEVVRLIQGLLKRNPKERLGCKNDVE 1030
            +D+++L  IG G +  V   Q  ++     + YA+K++KKA     E+          +L    H F+VKL   +++++ +Y++   C GGEL   L  + +L  E +    +A +  A+ +LH   + +RDL   N+L   K      +++ DFG +K+S +   +  T C T +++APE+L++ G+ +  D WSLG LL  ML+G  PF+      +T  +IL        ++ +P +   S E   L++ +L  +P  R+  K  ++
Sbjct:  413 DDYEILEKIGNGAHSVVHKCQMKAT----RRKYAVKIVKKAVFDATEEVDI-------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFA--MGPNDTPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQ 669          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 313.923 bits (803), Expect = 1.025e-96
Identity = 167/361 (46.26%), Postives = 228/361 (63.16%), Query Frame = 2
Query:  197 EEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKND-VEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPI---MTPDDCNGAHILPDLFQGFSYVAPNV 1258
            E + DI  V  C    +P        F++L V+G+G +GKVFLV+K   G D   +YAMKVLKKA +    +D   TK ERNIL  I HPF+VKLHYAFQ +  LY++L +  GG+LFT L +E    E+   FY+AE++LA+ HLH  GI+YRDLKPEN+LLD  GH+K+TDFGLSKE++     T +FCGT+EYMAPE++ R GH    D+WSLG L+F+ML+G  PF Q  D+ +T+T+IL + ++ P + + E   L++ L KRN + RLG   D VE+IK H FF    I++  + ++ +DPPFKP L +    S FD  FT + P      P   NG  I    F+GFS+V+  V
Sbjct:   65 ETEIDIGDVRKCGEKADP------RQFELLKVLGQGSFGKVFLVRKVR-GRDSGHVYAMKVLKKATL--KVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPF-QGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAK--IDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASANGHEI----FRGFSFVSNAV 409          

HSP 2 Score: 106.686 bits (265), Expect = 1.063e-23
Identity = 64/212 (30.19%), Postives = 113/212 (53.30%), Query Frame = 2
Query:  269 EDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTL-MENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKK----GHVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFS 880
            +D+++L  IG G +  V   Q  ++     + YA+K++KKA     E+          +L    H F+VKL   +++++ +Y++   C GGEL   L  + +L  E +    +A +  A+ +LH   + +RDL   N+L   K      +++ DFG +K+S +   +  T C T +++APE+L++ G+ +  D WSLG LL  ML+G  PF+
Sbjct:  433 DDYEILEKIGNGAHSVVHKCQMKAT----RRKYAVKIVKKAVFDATEEVDI-------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFA 633          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 314.309 bits (804), Expect = 2.295e-96
Identity = 167/361 (46.26%), Postives = 228/361 (63.16%), Query Frame = 2
Query:  197 EEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKND-VEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPI---MTPDDCNGAHILPDLFQGFSYVAPNV 1258
            E + DI  V  C    +P        F++L V+G+G +GKVFLV+K   G D   +YAMKVLKKA +    +D   TK ERNIL  I HPF+VKLHYAFQ +  LY++L +  GG+LFT L +E    E+   FY+AE++LA+ HLH  GI+YRDLKPEN+LLD  GH+K+TDFGLSKE++     T +FCGT+EYMAPE++ R GH    D+WSLG L+F+ML+G  PF Q  D+ +T+T+IL + ++ P + + E   L++ L KRN + RLG   D VE+IK H FF    I++  + ++ +DPPFKP L +    S FD  FT + P      P   NG  I    F+GFS+V+  V
Sbjct:   84 ETEIDIGDVRKCGEKADP------RQFELLKVLGQGSFGKVFLVRKVR-GRDSGHVYAMKVLKKATL--KVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPF-QGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAK--IDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASANGHEI----FRGFSFVSNAV 428          

HSP 2 Score: 110.923 bits (276), Expect = 6.320e-25
Identity = 75/270 (27.78%), Postives = 137/270 (50.74%), Query Frame = 2
Query:  269 EDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTL-MENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKK----GHVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHS------TIAYPKY--FSSEVVRLIQGLLKRNPKERLGCKNDVE 1030
            +D+++L  IG G +  V   Q  ++     + YA+K++KKA     E+          +L    H F+VKL   +++++ +Y++   C GGEL   L  + +L  E +    +A +  A+ +LH   + +RDL   N+L   K      +++ DFG +K+S +   +  T C T +++APE+L++ G+ +  D WSLG LL  ML+G  PF+      +T  +IL        ++ +P +   S E   L++ +L  +P  R+  K  ++
Sbjct:  452 DDYEILEKIGNGAHSVVHKCQMKAT----RRKYAVKIVKKAVFDATEEVDI-------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFA--MGPNDTPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQ 708          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: S6k (gene:FBgn0283472 transcript:FBtr0077114)

HSP 1 Score: 414.846 bits (1065), Expect = 2.209e-138
Identity = 198/353 (56.09%), Postives = 263/353 (74.50%), Query Frame = 2
Query:  215 ESVEICQSVVNPG-VKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNV 1258
            E++++C+  VNPG +K+  +DF++  V+G+GGYGKVF V+K++ G D NK +AMKVLKKA I+ N+KDTAHT++ERNILE ++HPF+V+L YAFQ    LY++L Y SGGELF +LEREG  +E+  CFY++EI LA+GHLHK GIIYRDLKPEN+LLD +GHVKLTDFGL KE +    +T+TFCGTIEYMAPEIL R GHGK VDWWSLG L+FDML+G PPF+ E ++++TI  IL + +  P Y + E   L++ L+KR   +RLG    D   ++ H FFK   +NW DV  RR++PP KP L+SE DVS FD+ FT Q P+ +PDD   +     +FQGF+YVAP++
Sbjct:   56 ETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTA-GRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAE-NRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFK--HVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSI 404          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: S6k (gene:FBgn0283472 transcript:FBtr0333264)

HSP 1 Score: 414.846 bits (1065), Expect = 2.209e-138
Identity = 198/353 (56.09%), Postives = 263/353 (74.50%), Query Frame = 2
Query:  215 ESVEICQSVVNPG-VKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNV 1258
            E++++C+  VNPG +K+  +DF++  V+G+GGYGKVF V+K++ G D NK +AMKVLKKA I+ N+KDTAHT++ERNILE ++HPF+V+L YAFQ    LY++L Y SGGELF +LEREG  +E+  CFY++EI LA+GHLHK GIIYRDLKPEN+LLD +GHVKLTDFGL KE +    +T+TFCGTIEYMAPEIL R GHGK VDWWSLG L+FDML+G PPF+ E ++++TI  IL + +  P Y + E   L++ L+KR   +RLG    D   ++ H FFK   +NW DV  RR++PP KP L+SE DVS FD+ FT Q P+ +PDD   +     +FQGF+YVAP++
Sbjct:   56 ETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTA-GRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAE-NRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFK--HVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSI 404          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pkc98E (gene:FBgn0003093 transcript:FBtr0301516)

HSP 1 Score: 286.574 bits (732), Expect = 4.304e-88
Identity = 145/340 (42.65%), Postives = 215/340 (63.24%), Query Frame = 2
Query:  248 PGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMI-RHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHIL-PDLFQGFSYVAP 1252
            PG K S+ DF  + V+G+G +GKV L +K   G DE  +YA+KVLKK  II+++ D   T +E+ IL +   HPFL  LH  FQ    L+ V+ Y +GG+L   +++      ++A FY AE++LA+  LH  G+IYRDLK +N+LLD++GH KL DFG+ KE +    LT TFCGT +Y+APEILK   +G  VDWW+LG L+++M++G PPF  + ++ E    I+H  + YP + S E V +++G L +NP++RLGC  D  +I+ H FF   D  W ++  R + PPF+P++K+  D + FD+ FT + P++TP        +  D F GFS+V P
Sbjct:  215 PG-KCSLLDFNFIKVLGKGSFGKVMLAEKK--GTDE--IYAIKVLKKDAIIQDD-DVDCTMTEKRILALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQEYGASVDWWALGVLMYEMMAGQPPFEAD-NEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQRLGCTGDENEIRKHPFFAKLD--WKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTPIGNEVVRCINQDEFAGFSFVNP 545          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0333715)

HSP 1 Score: 295.434 bits (755), Expect = 4.338e-88
Identity = 157/331 (47.43%), Postives = 212/331 (64.05%), Query Frame = 2
Query:  275 FKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV--SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDD--CNGAHILPDLFQGFSYVAP 1252
            F++L V+G G +GKVFLV+K   G D   LYAMKVLKKA +    KD   + +ER IL  + H F+V+LHYAFQ    LY++L +  GG+LFT L +E    E    FY+AE++LA+ HLH  GIIYRDLKPEN+LLD+ GH+ LTDFGLSK+ +  S T +FCGT+EYMAPEI+ R GH    DWWS G L+++ML+G  PF  +  +QET+ +IL S +  P+  S E   L++ L KRNP+ RLG     + DIK H FF T  I+W  +  +++ PPF P + S  D   FD  +T + P  +P       AH   ++F+GFS+VAP
Sbjct:  199 FELLRVLGEGSFGKVFLVRKII-GKDAGTLYAMKVLKKATL--KVKDRVRSTNERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPEIVNRKGHDFAADWWSFGVLMYEMLTGNLPFHGQT-RQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFAT--IDWVRLERKQVRPPFIPAV-SRDDAFYFDVEYTSKSPRDSPGGPISASAH---EIFRGFSFVAP 519          

HSP 2 Score: 108.612 bits (270), Expect = 5.044e-24
Identity = 70/213 (32.86%), Postives = 116/213 (54.46%), Query Frame = 2
Query:  272 DFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIR---HPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGH----VKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFS 880
            ++ +L  +GRG +    L +  +S     K YA+KV++KA +      T+    E  +  M+R   HP +V L+  +++  + Y+V+    GGEL   +   G + E++A   +  I+ A+ +LH+ G+++RDLKP N++          +KL D G +K+  +   L  T C T  ++APE+LKR G+    D WSLG LL+ MLSG  PF+
Sbjct:  567 EYNLLQELGRGTFSVCRLCEHRAS----KKHYAVKVIEKAAVAAASTSTSADCWE-EVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDLACDIWSLGVLLYIMLSGRTPFA 774          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0077360)

HSP 1 Score: 295.434 bits (755), Expect = 4.338e-88
Identity = 157/331 (47.43%), Postives = 212/331 (64.05%), Query Frame = 2
Query:  275 FKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV--SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDD--CNGAHILPDLFQGFSYVAP 1252
            F++L V+G G +GKVFLV+K   G D   LYAMKVLKKA +    KD   + +ER IL  + H F+V+LHYAFQ    LY++L +  GG+LFT L +E    E    FY+AE++LA+ HLH  GIIYRDLKPEN+LLD+ GH+ LTDFGLSK+ +  S T +FCGT+EYMAPEI+ R GH    DWWS G L+++ML+G  PF  +  +QET+ +IL S +  P+  S E   L++ L KRNP+ RLG     + DIK H FF T  I+W  +  +++ PPF P + S  D   FD  +T + P  +P       AH   ++F+GFS+VAP
Sbjct:  199 FELLRVLGEGSFGKVFLVRKII-GKDAGTLYAMKVLKKATL--KVKDRVRSTNERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPEIVNRKGHDFAADWWSFGVLMYEMLTGNLPFHGQT-RQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFAT--IDWVRLERKQVRPPFIPAV-SRDDAFYFDVEYTSKSPRDSPGGPISASAH---EIFRGFSFVAP 519          

HSP 2 Score: 108.612 bits (270), Expect = 5.044e-24
Identity = 70/213 (32.86%), Postives = 116/213 (54.46%), Query Frame = 2
Query:  272 DFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIR---HPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGH----VKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFS 880
            ++ +L  +GRG +    L +  +S     K YA+KV++KA +      T+    E  +  M+R   HP +V L+  +++  + Y+V+    GGEL   +   G + E++A   +  I+ A+ +LH+ G+++RDLKP N++          +KL D G +K+  +   L  T C T  ++APE+LKR G+    D WSLG LL+ MLSG  PF+
Sbjct:  567 EYNLLQELGRGTFSVCRLCEHRAS----KKHYAVKVIEKAAVAAASTSTSADCWE-EVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDLACDIWSLGVLLYIMLSGRTPFA 774          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: rps6kb1b (ribosomal protein S6 kinase b, polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2038])

HSP 1 Score: 408.683 bits (1049), Expect = 1.218e-135
Identity = 200/360 (55.56%), Postives = 262/360 (72.78%), Query Frame = 2
Query:  206 DDIESVEICQSVVNPGVK-ISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            DD E +EI +  VN G + I  E F++L V+G+GGYGKVF V+K S G    K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKR+   RLG    D  +++ H FF+   +NW D+  R+++PPFKP L+S  DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  ++
Sbjct:   41 DDCEKIEISEDNVNQGTENIRPECFELLRVLGKGGYGKVFQVRKVS-GAATGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFR--HVNWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENI 396          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: rps6kb1a (ribosomal protein S6 kinase b, polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-091113-52])

HSP 1 Score: 404.06 bits (1037), Expect = 8.323e-134
Identity = 201/360 (55.83%), Postives = 260/360 (72.22%), Query Frame = 2
Query:  206 DDIESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            +D E  EI +  VN G  KI  E F++L V+G+GGYGKVF V+K + G    K++AMKVLKKA I+RN KDTAHTK+ER+ILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  +E+ ACFY+AEISLA+GHLH+ GIIYRDLKPEN++L+  GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   R+G    DV DI+ H FF+   INW D+   ++DPPFKP L+S  DVS FDS FT Q P+ +PDD   +     +F GF+Y+AP+V  ++
Sbjct:   41 EDCEKFEISEDSVNQGTEKIRPECFELLRVLGKGGYGKVFQVRKVA-GAASGKIFAMKVLKKAMIVRNAKDTAHTKAERSILEEVKHPFIVDLIYAFQTGEKLYLILEYLSGGELFMQLEREGIFLEDTACFYLAEISLALGHLHQKGIIYRDLKPENIMLNYNGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMLTGAPPFTAE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNASVRIGASPRDVLDIQRHSFFR--HINWDDLLAFKIDPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDTKLSESDNQVFLGFTYIAPSVLENI 396          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: BX000486.1 (ribosomal protein S6 kinase b, polypeptide 1a [Source:NCBI gene;Acc:562242])

HSP 1 Score: 403.675 bits (1036), Expect = 9.885e-134
Identity = 201/360 (55.83%), Postives = 260/360 (72.22%), Query Frame = 2
Query:  206 DDIESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            +D E  EI +  VN G  KI  E F++L V+G+GGYGKVF V+K + G    K++AMKVLKKA I+RN KDTAHTK+ER+ILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  +E+ ACFY+AEISLA+GHLH+ GIIYRDLKPEN++L+  GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   R+G    DV DI+ H FF+   INW D+   ++DPPFKP L+S  DVS FDS FT Q P+ +PDD   +     +F GF+Y+AP+V  ++
Sbjct:   42 EDCEKFEISEDSVNQGTEKIRPECFELLRVLGKGGYGKVFQVRKVA-GAASGKIFAMKVLKKAMIVRNAKDTAHTKAERSILEEVKHPFIVDLIYAFQTGEKLYLILEYLSGGELFMQLEREGIFLEDTACFYLAEISLALGHLHQKGIIYRDLKPENIMLNYNGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMLTGAPPFTAE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNASVRIGASPRDVLDIQRHSFFR--HINWDDLLAFKIDPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDTKLSESDNQVFLGFTYIAPSVLENI 397          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: rps6kb1b (ribosomal protein S6 kinase b, polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2038])

HSP 1 Score: 367.081 bits (941), Expect = 3.145e-119
Identity = 191/382 (50.00%), Postives = 257/382 (67.28%), Query Frame = 2
Query:  206 DDIESVEICQSVVNPGVK-ISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGEL-------FTYLER--------EGTLMENQAC-------FYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            DD E +EI +  VN G + I  E F++L V+G+GGYGKVF V+K S G    K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SG  L       F++           +G +   + C       FY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKR+   RLG    D  +++ H FF+   +NW D+  R+++PPFKP L+S  DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  ++
Sbjct:   41 DDCEKIEISEDNVNQGTENIRPECFELLRVLGKGGYGKVFQVRKVS-GAATGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGLNLCFLEIDNFSFFPHSFCCCGVAKGLIQPLKCCSGLLTCSFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFR--HVNWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENI 418          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: rps6ka2 (ribosomal protein S6 kinase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-090827-1])

HSP 1 Score: 333.954 bits (855), Expect = 4.728e-104
Identity = 177/387 (45.74%), Postives = 244/387 (63.05%), Query Frame = 2
Query:  191 KREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKND-VEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTGVSRHTRRRNNSGLSGN 1339
            K E+D  ++  +I   V     K     F++L V+G+G YGKVFLV+K   G D  +LYAMKVLKKA +    +D   +K ER+IL  + HPF+VKLHYAFQ +  LY++L +  GG+LFT L +E    E    FY+AE++LA+ HLH  GIIYRDLKPEN+LLD++GH+K+TDFGLSKE++       +FCGTIEYMAPE++ R GH +  DWWS G L+F+ML+G  PF Q  D++ET+  IL + +  P++ S EV  L++ L KRNP  RLG   D VE+IK H FF T  I+W+ +Y R + PPFKP +    D   FD  FT + P  +P     A+    LF+GFS+VA N+      +P+T + +++       L GN
Sbjct:   31 KLEDDSILKEFDISHHVKEGFEKADPSQFELLKVLGQGSYGKVFLVRKIK-GSDTGQLYAMKVLKKATL--KVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPF-QGKDRKETMALILKAKLGMPQFLSPEVQSLLRALFKRNPSNRLGAGPDGVEEIKRHIFFAT--IDWNKLYRREIKPPFKPAVGRPEDTFHFDPEFTSRTPTDSPGVPASANA-HQLFRGFSFVATNLGQ---EQPLTEIKQNSVNPIVQQLHGN 407          

HSP 2 Score: 104.375 bits (259), Expect = 9.692e-23
Identity = 83/282 (29.43%), Postives = 139/282 (49.29%), Query Frame = 2
Query:  224 EICQSVVNPGVK------ISMED-FKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVL-LDKKG---HVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDK--QETITKILHSTIAYP----KYFSSEVVRLIQGLLKRNPKERL 1009
            EI Q+ VNP V+      I   D +++   IG G Y     V K       +  YA+K+     I R++KD   ++    +L   +HP ++ L   + +   +Y+V+    GGEL   + R+    E +A   +  I+  + +LH  G+++RDLKP N+L +D+ G    +++ DFG +K+  +   L  T C T  ++APE+LK+ G+    D WSLG LL+ ML+G  PF+   D   +E + +I     A         S     ++  +L  +P +RL
Sbjct:  391 EIKQNSVNPIVQQLHGNNIHFTDGYELKEDIGIGAYS----VCKRCVHRITSVEYAVKI-----IDRSKKDP--SEEIEILLRYGQHPNIITLKDVYDDGKFVYLVMELMRGGELLDRILRQKCFSEREASAVLCTITKTVEYLHSQGVVHRDLKPSNILYVDETGDPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGILLYTMLAGFTPFANGPDDTPEEILARIGSGKFALSGGNWDTVSDAAKDIVTKMLHVDPHQRL 661          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 412.535 bits (1059), Expect = 9.899e-137
Identity = 208/380 (54.74%), Postives = 271/380 (71.32%), Query Frame = 2
Query:  149 DELSIQQFIQNGPLKREED-DDIESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            D  ++ +F+ +G L  E   +  E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K    H   K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  D++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   45 DGGTLTEFMDHGSLSYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHT-GKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 420          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 412.535 bits (1059), Expect = 1.162e-136
Identity = 208/380 (54.74%), Postives = 271/380 (71.32%), Query Frame = 2
Query:  149 DELSIQQFIQNGPLKREED-DDIESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            D  ++ +F+ +G L  E   +  E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K    H   K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  D++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   47 DGGTLTEFMDHGSLSYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHT-GKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 422          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 410.223 bits (1053), Expect = 1.636e-136
Identity = 203/357 (56.86%), Postives = 260/357 (72.83%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K    H   K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  D++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   23 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHT-GKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 375          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 409.453 bits (1051), Expect = 2.710e-136
Identity = 203/357 (56.86%), Postives = 260/357 (72.83%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K    H   K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  D++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   15 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHT-GKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 367          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 409.068 bits (1050), Expect = 8.719e-136
Identity = 203/357 (56.86%), Postives = 260/357 (72.83%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K    H   K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  D++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   37 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHT-GKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESV 389          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Rps6kb1 (ribosomal protein S6 kinase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1270849])

HSP 1 Score: 406.371 bits (1043), Expect = 1.864e-134
Identity = 202/357 (56.58%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K + G +  K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 399.823 bits (1026), Expect = 1.846e-132
Identity = 193/357 (54.06%), Postives = 261/357 (73.11%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E VE+ +S VN G  +I    F++L+V+G+GGYGKVF V+K   G +  K+YAMKVL+KA+I+ + KDTAHT++ERNILE ++HPF+V+L YAFQ    LY++L   SGGELFT+LEREG  +E+ ACFY+AEI+LA+GHLH  GIIYRDLKPEN++L  +GH+KLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++T+ KI+   +  P Y + +   L +  LKRNP +R+G    D  D++ H FF+   INW D+  RR+DPPF+P L+SE DVS FD+ FT Q P+ +PDD   +      F GF+YVAP+V  S+
Sbjct:   46 EEVELTESSVNLGPERIGPHCFELLSVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAE-NRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFR--HINWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSI 398          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 399.823 bits (1026), Expect = 1.846e-132
Identity = 193/357 (54.06%), Postives = 261/357 (73.11%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E VE+ +S VN G  +I    F++L+V+G+GGYGKVF V+K   G +  K+YAMKVL+KA+I+ + KDTAHT++ERNILE ++HPF+V+L YAFQ    LY++L   SGGELFT+LEREG  +E+ ACFY+AEI+LA+GHLH  GIIYRDLKPEN++L  +GH+KLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++T+ KI+   +  P Y + +   L +  LKRNP +R+G    D  D++ H FF+   INW D+  RR+DPPF+P L+SE DVS FD+ FT Q P+ +PDD   +      F GF+YVAP+V  S+
Sbjct:   46 EEVELTESSVNLGPERIGPHCFELLSVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAE-NRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFR--HINWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSI 398          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 383.645 bits (984), Expect = 1.767e-127
Identity = 184/332 (55.42%), Postives = 248/332 (74.70%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDD 1195
            E VE+ +S VN G  +I    F++L+V+G+GGYGKVF V+K   G +  K+YAMKVL+KA+I+ + KDTAHT++ERNILE ++HPF+V+L YAFQ    LY++L   SGGELFT+LEREG  +E+ ACFY+AEI+LA+GHLH  GIIYRDLKPEN++L  +GH+KLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++T+ KI+   +  P Y + +   L +  LKRNP +R+G    D  D++ H FF+   INW D+  RR+DPPF+P L+SE DVS FD+ FT Q P+ +PDD
Sbjct:   46 EEVELTESSVNLGPERIGPHCFELLSVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAE-NRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFR--HINWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDD 373          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 383.645 bits (984), Expect = 1.767e-127
Identity = 184/332 (55.42%), Postives = 248/332 (74.70%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDD 1195
            E VE+ +S VN G  +I    F++L+V+G+GGYGKVF V+K   G +  K+YAMKVL+KA+I+ + KDTAHT++ERNILE ++HPF+V+L YAFQ    LY++L   SGGELFT+LEREG  +E+ ACFY+AEI+LA+GHLH  GIIYRDLKPEN++L  +GH+KLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++T+ KI+   +  P Y + +   L +  LKRNP +R+G    D  D++ H FF+   INW D+  RR+DPPF+P L+SE DVS FD+ FT Q P+ +PDD
Sbjct:   46 EEVELTESSVNLGPERIGPHCFELLSVLGKGGYGKVFQVRKVQ-GTNLGKIYAMKVLRKAKIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAE-NRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFR--HINWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDD 373          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|P23443|KS6B1_HUMAN (Ribosomal protein S6 kinase beta-1 OS=Homo sapiens OX=9606 GN=RPS6KB1 PE=1 SV=2)

HSP 1 Score: 407.142 bits (1045), Expect = 8.030e-134
Identity = 202/357 (56.58%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K + G +  K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|P67998|KS6B1_RABIT (Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus OX=9986 GN=RPS6KB1 PE=2 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 9.237e-134
Identity = 202/357 (56.58%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K + G +  K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|P67999|KS6B1_RAT (Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus OX=10116 GN=Rps6kb1 PE=1 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 1.007e-133
Identity = 202/357 (56.58%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K + G +  K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q8BSK8|KS6B1_MOUSE (Ribosomal protein S6 kinase beta-1 OS=Mus musculus OX=10090 GN=Rps6kb1 PE=1 SV=2)

HSP 1 Score: 406.371 bits (1043), Expect = 1.304e-133
Identity = 202/357 (56.58%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K + G +  K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESV 422          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q6TJY3|KS6B1_BOVIN (Ribosomal protein S6 kinase beta-1 OS=Bos taurus OX=9913 GN=RPS6KB1 PE=2 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 1.330e-133
Identity = 202/357 (56.58%), Postives = 262/357 (73.39%), Query Frame = 2
Query:  215 ESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            E  EI ++ VN G  KI  E F++L V+G+GGYGKVF V+K + G +  K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKRN   RLG    D  +++ H FF+   INW ++  R+++PPFKP L+SE DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  SV
Sbjct:   70 EKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVT-GANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFR--HINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSALSESANQVFLGFTYVAPSVLESV 422          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A4S2MBY0 (Non-specific serine/threonine protein kinase OS=Opisthorchis felineus OX=147828 GN=CRM22_001136 PE=4 SV=1)

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 273/454 (60.13%), Postives = 326/454 (71.81%), Query Frame = 2
Query:  104 DIVSKDNDFIRLSERDELSIQQFIQNGPLKREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTGVSRHTRR---RNNSGLSGNAFNGLNANSPFLNENDFIEMSCNDAYVNQPVTNALTYFP 1456
            D  S+ +D    S+R E + QQ +QN P   EE+   E+VEICQ  VNP  ++  E+F +  VIG+GGYGKVFLVQK   G D+ KLYAMKVLKKAR++ NEKD AHT SERNIL+M+RHPFLV+LHYAFQN SNLYIVL YC GGELF YLEREG L+EN ACFY AEI LAIGHLH  GIIYRDLK ENVLLD++GHVKLTDFGLSKE V  TNTFCGTIEYMAPEI++  GHGK VDWWSLGTLL+DMLSG PPFSQE  K+ T  KIL + + +P  FS EVV LI+GLL+R+PKERLG K DVE++K H+FF+ H+INWSDV+HRR+ PPF+P+L ++ DVS FD TFT  QP+++P + N   I PD+FQGFSYV P+V   V+ EP       TRR   RN + LS      +       NE    +    D    QPV + LT  P
Sbjct:   19 DEESECSDAKSGSQRTERNCQQKLQNEPFS-EENGRKETVEICQQTVNPNNRVGSENFMIQRVIGKGGYGKVFLVQKVD-GKDKGKLYAMKVLKKARLVCNEKDKAHTVSERNILQMLRHPFLVRLHYAFQNHSNLYIVLEYCPGGELFNYLEREGALLENAACFYTAEIILAIGHLHSLGIIYRDLKSENVLLDRQGHVKLTDFGLSKEGVGTTNTFCGTIEYMAPEIIRCEGHGKAVDWWSLGTLLYDMLSGAPPFSQEESKEATTHKILTAPLKFPPAFSPEVVSLIRGLLRRDPKERLGSKEDVEEVKRHKFFRRHEINWSDVFHRRLRPPFRPKLAADNDVSMFDPTFTRLQPVVSPAE-NSRPIPPDMFQGFSYVGPSVCEEVVREPWVDADAGTRRRQYRNQAALSAGRLRRMELAPSHWNEKP--QNRLGDVRPAQPVHSELTSLP 467          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A419PD32 (Non-specific serine/threonine protein kinase OS=Clonorchis sinensis OX=79923 GN=Rps6kb2 PE=4 SV=1)

HSP 1 Score: 531.561 bits (1368), Expect = 1.918e-177
Identity = 261/418 (62.44%), Postives = 308/418 (73.68%), Query Frame = 2
Query:  215 ESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIR-HPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTGVSRHTRR---RNNSGLSGNAFNGLNANSPFLNENDFIEMSCNDAYVNQPVTNALTYFP 1456
            E+VEICQ  VNP  ++  E+F +  VIG+GGYGKVFLVQK   G D+ KLYAMKVLKKAR++ NEKD AHT SERNIL+M+R HPFLV+LHYAFQN SNLYIVL YC GGELF YLEREG L+EN ACFY AEI LAIGHLH  GIIYRDLK ENVLLD++GHVKLTDFGLSKE V  TNTFCGTIEYMAPEI++  GHGK VDWWSLGTLL+DMLSG PPFSQE  K+ T  KIL + + +P  FS EVV LI+GLL+R+PKERLG K DVE++K H+FF+ H+INWSDV+HRR+ PPF+P+L ++ DVS FD TFT  QP+++P + N   I PD+FQGFSYV P+V   V+ EP       TRR   RN + LS      +       NE    +    DA   QPV + LT  P
Sbjct:   33 ETVEICQQTVNPNNRVGSENFMIQRVIGKGGYGKVFLVQKVD-GKDKGKLYAMKVLKKARLVCNEKDKAHTVSERNILQMLRQHPFLVRLHYAFQNHSNLYIVLEYCPGGELFNYLEREGALLENAACFYTAEIILAIGHLHSLGIIYRDLKSENVLLDRQGHVKLTDFGLSKEGVGTTNTFCGTIEYMAPEIIRCEGHGKAVDWWSLGTLLYDMLSGAPPFSQEESKEATTHKILTAPLKFPPAFSPEVVSLIRGLLRRDPKERLGSKEDVEEVKRHKFFRRHEINWSDVFHRRLRPPFRPKLAADNDVSMFDPTFTRLQPVVSPAE-NSRPIPPDMFQGFSYVGPSVCEEVMREPWVDGDAGTRRRQYRNQAALSAGRLRRMELAPSHWNERP--QSRLGDARPAQPVHSELTSLP 446          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: C1LJV7 (Non-specific serine/threonine protein kinase OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 6.139e-173
Identity = 257/404 (63.61%), Postives = 307/404 (75.99%), Query Frame = 2
Query:  179 NGPLKREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTG---VSRHTRRRNNSGLSGN-----AFNGLNANS 1366
            N  +K+ E  + E+VEICQ  VNP  +++ E+F +  VIG+GGYGKVFLVQK   G D+ KLYAMKVLKKAR++ +EKD AHT SERNILEM++HPFLVKLHYAFQN SNLYIVL YC GGELF YLEREG+L+EN ACFY +EI LAIGHLH  GIIYRDLK ENVLLD++GHVKLTDFGLSKE V  TNTFCGTIEYMAPEI++  GHGKEVDWWSLGTLLFDMLSG PPFSQE  ++ T  KIL + + +P  FSSEV+ LI+GLLKR+P ERLG + D+E+IK H+FFK H+INWSDVY+RR+ PPF+P+L +E DVS FD TFT  +P+++P D   A I PD+FQGFSYVAP+V    L +        SRH R      +S        F  LNA+S
Sbjct:   46 NSSVKKNEIKNQETVEICQKTVNPNNRVNAENFNIQRVIGKGGYGKVFLVQKVD-GVDQGKLYAMKVLKKARLVCSEKDKAHTVSERNILEMLQHPFLVKLHYAFQNHSNLYIVLEYCHGGELFNYLEREGSLLENAACFYASEIVLAIGHLHSLGIIYRDLKSENVLLDRQGHVKLTDFGLSKEGVCTTNTFCGTIEYMAPEIIRCEGHGKEVDWWSLGTLLFDMLSGAPPFSQEESREATTLKILTAPLKFPPSFSSEVISLIRGLLKRDPNERLGSREDMEEIKRHKFFKRHEINWSDVYNRRLKPPFRPKLTAENDVSMFDPTFTRLRPVVSPVD-GVASIPPDMFQGFSYVAPSVCEDSLRDNTWTDNLPSRHKRHGLRGAMSAGRLRRIGFGHLNASS 447          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: C1LJV8 (Non-specific serine/threonine protein kinase OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 519.62 bits (1337), Expect = 9.528e-173
Identity = 257/404 (63.61%), Postives = 307/404 (75.99%), Query Frame = 2
Query:  179 NGPLKREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTG---VSRHTRRRNNSGLSGN-----AFNGLNANS 1366
            N  +K+ E  + E+VEICQ  VNP  +++ E+F +  VIG+GGYGKVFLVQK   G D+ KLYAMKVLKKAR++ +EKD AHT SERNILEM++HPFLVKLHYAFQN SNLYIVL YC GGELF YLEREG+L+EN ACFY +EI LAIGHLH  GIIYRDLK ENVLLD++GHVKLTDFGLSKE V  TNTFCGTIEYMAPEI++  GHGKEVDWWSLGTLLFDMLSG PPFSQE  ++ T  KIL + + +P  FSSEV+ LI+GLLKR+P ERLG + D+E+IK H+FFK H+INWSDVY+RR+ PPF+P+L +E DVS FD TFT  +P+++P D   A I PD+FQGFSYVAP+V    L +        SRH R      +S        F  LNA+S
Sbjct:   46 NSSVKKNEIKNQETVEICQKTVNPNNRVNAENFNIQRVIGKGGYGKVFLVQKVD-GVDQGKLYAMKVLKKARLVCSEKDKAHTVSERNILEMLQHPFLVKLHYAFQNHSNLYIVLEYCHGGELFNYLEREGSLLENAACFYASEIVLAIGHLHSLGIIYRDLKSENVLLDRQGHVKLTDFGLSKEGVCTTNTFCGTIEYMAPEIIRCEGHGKEVDWWSLGTLLFDMLSGAPPFSQEESREATTLKILTAPLKFPPSFSSEVISLIRGLLKRDPNERLGSREDMEEIKRHKFFKRHEINWSDVYNRRLKPPFRPKLTAENDVSMFDPTFTRLRPVVSPVD-GVASIPPDMFQGFSYVAPSVCEDSLRDNTWTDNLPSRHKRHGLRGAMSAGRLRRIGFGHLNASS 447          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: C1LJV6 (Non-specific serine/threonine protein kinase OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 519.62 bits (1337), Expect = 9.736e-173
Identity = 257/404 (63.61%), Postives = 307/404 (75.99%), Query Frame = 2
Query:  179 NGPLKREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTG---VSRHTRRRNNSGLSGN-----AFNGLNANS 1366
            N  +K+ E  + E+VEICQ  VNP  +++ E+F +  VIG+GGYGKVFLVQK   G D+ KLYAMKVLKKAR++ +EKD AHT SERNILEM++HPFLVKLHYAFQN SNLYIVL YC GGELF YLEREG+L+EN ACFY +EI LAIGHLH  GIIYRDLK ENVLLD++GHVKLTDFGLSKE V  TNTFCGTIEYMAPEI++  GHGKEVDWWSLGTLLFDMLSG PPFSQE  ++ T  KIL + + +P  FSSEV+ LI+GLLKR+P ERLG + D+E+IK H+FFK H+INWSDVY+RR+ PPF+P+L +E DVS FD TFT  +P+++P D   A I PD+FQGFSYVAP+V    L +        SRH R      +S        F  LNA+S
Sbjct:   46 NSSVKKNEIKNQETVEICQKTVNPNNRVNAENFNIQRVIGKGGYGKVFLVQKVD-GVDQGKLYAMKVLKKARLVCSEKDKAHTVSERNILEMLQHPFLVKLHYAFQNHSNLYIVLEYCHGGELFNYLEREGSLLENAACFYASEIVLAIGHLHSLGIIYRDLKSENVLLDRQGHVKLTDFGLSKEGVCTTNTFCGTIEYMAPEIIRCEGHGKEVDWWSLGTLLFDMLSGAPPFSQEESREATTLKILTAPLKFPPSFSSEVISLIRGLLKRDPNERLGSREDMEEIKRHKFFKRHEINWSDVYNRRLKPPFRPKLTAENDVSMFDPTFTRLRPVVSPVD-GVASIPPDMFQGFSYVAPSVCEDSLRDNTWTDNLPSRHKRHGLRGAMSAGRLRRIGFGHLNASS 447          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: rps6kb1b (ribosomal protein S6 kinase B1 [Source:NCBI gene;Acc:103035647])

HSP 1 Score: 409.838 bits (1052), Expect = 2.895e-136
Identity = 200/360 (55.56%), Postives = 262/360 (72.78%), Query Frame = 2
Query:  206 DDIESVEICQSVVNPGVK-ISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            DD E +EI +  VN G + I  E F++L V+G+GGYGKVF V+K + G    K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKR+   RLG    D  +++ H FF+   INW D+  R+++PPFKP L+S  DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  ++
Sbjct:   38 DDCEKIEISEDSVNQGTESIRPECFELLRVLGKGGYGKVFQVRKVTGG-GSGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFR--HINWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENI 393          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: rps6kb1b (ribosomal protein S6 kinase B1 [Source:NCBI gene;Acc:103035647])

HSP 1 Score: 408.683 bits (1049), Expect = 8.505e-136
Identity = 200/360 (55.56%), Postives = 262/360 (72.78%), Query Frame = 2
Query:  206 DDIESVEICQSVVNPGVK-ISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            DD E +EI +  VN G + I  E F++L V+G+GGYGKVF V+K + G    K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKR+   RLG    D  +++ H FF+   INW D+  R+++PPFKP L+S  DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  ++
Sbjct:   41 DDCEKIEISEDSVNQGTESIRPECFELLRVLGKGGYGKVFQVRKVTGG-GSGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFR--HINWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENI 396          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000004157.2 (ribosomal protein S6 kinase B2 [Source:NCBI gene;Acc:103031203])

HSP 1 Score: 405.986 bits (1042), Expect = 3.373e-135
Identity = 208/407 (51.11%), Postives = 277/407 (68.06%), Query Frame = 2
Query:  131 IRLSERDELSIQQFIQNGPLKREEDDDIESVEICQSVVN-PGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLN----EPMTGVSRHTRRRNNS 1324
            I L   D    +  + N  +   E  + E VE+   VVN    ++  + F++L V+G+GGYGKVF V+K   G    K++AMKVL+KA+I+RN KDTAHT++ER ILE +RHPF+V L YAFQ    LY++L   SGGELF  LE+EG  ME+ ACFY+AEI+LA+GHLH  GIIYRDLKPEN++L+ +GH+KLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L+FDM++G PPF+ E ++++TI KIL   I  P Y + +   LI+ LLK+NP +RLG  K D  DI+ H FF+   INW D+ H+R++PP++P L+S+ DVS FDS FT Q P+ +PDD   +      F GF+YVAP+V  S+      EP     R  RR N+S
Sbjct:    7 IDLESEDVSDPEDEVYNFTVAESEPLETEEVELTSEVVNRDSERVGPDCFELLTVLGKGGYGKVFQVRKVQ-GSQMGKIFAMKVLRKAKIVRNAKDTAHTRAEREILETVRHPFIVDLWYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLAEITLALGHLHSNGIIYRDLKPENIMLNHEGHIKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILNRSGHNRAVDWWSLGALMFDMMTGSPPFTGE-NRKKTIDKILKCKICLPPYLTPDARDLIKKLLKKNPSQRLGSGKGDCADIQKHPFFR--HINWDDLLHKRVEPPYRPSLQSDEDVSQFDSRFTRQTPVDSPDDTTLSGSADHAFAGFTYVAPSVLESLKEGFSVEPR---PRPVRRLNSS 406          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: rps6ka4 (ribosomal protein S6 kinase alpha-4-like [Source:NCBI gene;Acc:103040978])

HSP 1 Score: 340.887 bits (873), Expect = 3.802e-106
Identity = 174/344 (50.58%), Postives = 235/344 (68.31%), Query Frame = 2
Query:  257 KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRH-PFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV----SLTNTFCGTIEYMAPEILK-RGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDK---QETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNV 1258
            K+ ME+F++L V+G G YGKVFLV+K S GHDE KLYAMKVLKKA I++  K   HT++ER +LE IR  PFLV LHYAFQ Q+ L+++L Y SGGE+FT+L +     E++   YV EI LA+ HLHK GI+YRD+K EN+LLD +GHV LTDFGLSKE +      T +FCGTIEYMAPEI++ + GHGK VDWWSLG L+F++L+G  PF+ E ++    E   +IL     +P         LI+ LL ++P +RLG      EDIK+H FFK   +NW+D+  +++  PFKPEL++E+DV  F   FTG +P+ +P     +     LFQG+S+VAP++
Sbjct:   43 KVGMENFELLKVLGTGAYGKVFLVRKIS-GHDEGKLYAMKVLKKAAIVQKAKTAEHTRTERQVLEHIRQSPFLVTLHYAFQTQTKLHLILDYVSGGEMFTHLYQRDHFSEDEVRIYVGEIILALEHLHKLGIVYRDIKLENILLDSEGHVVLTDFGLSKEFLEEEKERTYSFCGTIEYMAPEIIRGKAGHGKSVDWWSLGILMFELLTGASPFTLEGERNSQSEVSKRILRCEPPFPSLIGPLAQDLIKKLLVKDPHKRLGSGPRGAEDIKSHPFFK--GLNWADLAEKKVASPFKPELRNELDVGNFAEEFTGMEPVYSPASTPPS--TDRLFQGYSFVAPSI 381          

HSP 2 Score: 101.679 bits (252), Expect = 5.933e-22
Identity = 72/257 (28.02%), Postives = 123/257 (47.86%), Query Frame = 2
Query:  293 IGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGH---VKLTDFGLSK-----ESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQE------CDKQETITKILHSTIAYP----KYFSSEVVRLIQGLLKRNPKERL 1009
            +G G +      +   SG +    YA+K++ +      +++ A  +      +   HP +V LH  + +Q + Y+V+    GGEL   L+++    E +A   +  +  A+  +H+ G+++RDLKPENVL   +     +K+ DFG ++        +   T C T++Y APE+    G+ +  D WSLG +L+ MLSG  PF  E          + + KI     +      K  S E   L++GLL  +P+ RL
Sbjct:  431 LGEGSFSICRRCRHKQSGQE----YAVKIISRRMEAMTQREIAALR------QCGSHPNIVTLHEVYTDQYHTYLVMELLRGGELLERLKKKKLFAEGEASQLMKSLVSAVSFMHEAGVVHRDLKPENVLFAGEAEDSALKVIDFGFARLFPAGSGSAPLQTPCFTLQYAAPELFHSSGYDQACDLWSLGVILYTMLSGQVPFQSEKKGMTSTHAADIMHKIKEGDFSLDGDAWKGVSEEAKDLVRGLLTVDPERRL 677          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: rps6ka2 (ribosomal protein S6 kinase A2 [Source:NCBI gene;Acc:103036630])

HSP 1 Score: 333.569 bits (854), Expect = 5.795e-104
Identity = 173/362 (47.79%), Postives = 234/362 (64.64%), Query Frame = 2
Query:  191 KREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKND-VEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPD--DCNGAHILPDLFQGFSYVAPNV 1258
            K E+D  ++ ++I   V     K     F++L V+G+G YGKVFLV+K   G D  +LYAMKVLKKA +    +D   +K ER+IL  + HPF+VKLHYAFQ +  LY++L +  GG+LFT L +E    E    FY+AE++LA+ HLH  GIIYRDLKPEN+LLD+ GH+K+TDFGLSKE++       +FCGTIEYMAPE++ R GH +  DWWS G L+F+ML+G  PF Q  D++ET+  IL + +  P++ SSEV  L++ L KRNP  RLG   D VE+IK H FF T  I+W+ +Y + + PPFKP +    D   FD  FT + P  +P       AH    LF+GFS+VA N+
Sbjct:   31 KLEDDSILKEIDISNHVKEGFEKADPSQFELLKVLGQGSYGKVFLVRKIK-GSDTGQLYAMKVLKKATL--KVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEDGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPF-QGKDRKETMALILKAKLGMPQFLSSEVQSLLRALFKRNPSNRLGAGPDGVEEIKRHHFFAT--IDWNKLYRKEIKPPFKPAVGRPEDTFHFDPEFTSRTPTDSPGVPPSANAH---QLFRGFSFVATNL 383          

HSP 2 Score: 102.834 bits (255), Expect = 2.820e-22
Identity = 70/231 (30.30%), Postives = 122/231 (52.81%), Query Frame = 2
Query:  365 YAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVL-LDKKG---HVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYF---------SSEVVRLIQGLLKRNPKERL 1009
            YA+K+++K++     KD   ++    +L   +HP ++ L   + +   +Y+V+    GGEL   + R+    E +A   +  I+  + +LH  G+++RDLKP N+L +D+ G    +++ DFG +K+  +   L  T C T  ++APE+LK+ G+    D WSLG LL+ ML+G  PF+   D  +T  +IL + I   KY          S     ++  +L  +P +RL
Sbjct:  441 YAVKIIEKSK-----KDP--SEEIEILLRYGQHPNIITLKDVYDDGKFVYLVMELMRGGELLDRILRQKGFSEREASAVLCTITKTVEYLHSQGVVHRDLKPSNILYVDETGDPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGILLYTMLAGFTPFANGPD--DTPEEIL-ARIGSGKYILSGGNWDTVSDAAKDIVTKMLHVDPHQRL 661          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 285.419 bits (729), Expect = 7.465e-90
Identity = 150/336 (44.64%), Postives = 211/336 (62.80%), Query Frame = 2
Query:  272 DFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNIL-EMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIM-------TPDDCNGAHILPDLFQGFSYV 1246
            DF  L V+G+G +GKV L +  S G      YA+KV+KK+ II  +K+  H  +ERN+L + +RHPFLV LHY+FQ+   LY V+ Y +GGELF +L+R+G+  E++A FY AEI  AIG+LH   I+YRDLKPEN+LLD +GH+ LTDFGL KE +   S T TFCGT EY+APE+LK+  + + VDWW LG +L++ML G PPF  +  KQ     ILH  +      ++  + +++GLL ++P +RLG  +D+ +IKNH FF T  INW+D+  +R+  P+ P +    D+  FD  FT +   M       T   C       D F GF+Y+
Sbjct:   91 DFDFLTVLGKGSFGKVLLAKHKSDG----IFYAVKVMKKS-IILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQ-MYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGATSDILEIKNHVFFST--INWNDLDAKRIPSPYNPGVSGPCDLHNFDPAFTAEPLSMSMAQSSDTSSVCANVDEAADAFVGFTYM 418          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.944 bits (707), Expect = 6.345e-86
Identity = 142/336 (42.26%), Postives = 212/336 (63.10%), Query Frame = 2
Query:  206 DDIESVEICQSVVN-PGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLH-KTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCK-NDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDD 1195
            +D  S E   ++++ P  K++M +F  L ++G+G +GKV LV++ ++G    + YAMK+LKK  I+  + + AHT +E  +L+  +HPFL  L Y+FQ    L  V+ Y +GGELF +L RE    E++  FY AEI  A+ +LH +  ++YRDLK EN++LDK GH+K+ DFGL KE +   +   TFCGT EY+APE+L+   +G+ VDWW LG ++++M+ G  PF  + D ++    IL   I +P+  S++   L+ GLLK++PK+RLG   +D ++I  H FF    I W DVY R+M PPFKP++ SE D   FD  FT Q   +TP D
Sbjct:  126 EDGSSTEQMDTILSKPKSKVTMNNFDYLKLLGKGTFGKVILVREKATG----QYYAMKILKKEVIVAKD-EVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQ-DHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFA--GIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPD 453          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.958 bits (598), Expect = 1.632e-72
Identity = 117/278 (42.09%), Postives = 178/278 (64.03%), Query Frame = 2
Query:  368 AMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLG-CKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDC 1198
            ++K  K+ ++++  K   HT +E+ IL+ I  PFLV+L Y+F++ SNLY+VL Y  GGE+F++L R G   E  + FY A+I LA  +LH   +IYRDLKPEN+L+D++G++++TDFG +K     T T CGT EY+APEI+   G+ K VDWW+LG L+++M +G PPF  +   Q    KI+   + +P +FSS++  L++ LL+ +  +R G  KN V DIKNH++F T D  W  +Y R+++ PF P+ K   D S FD     +  I + + C
Sbjct:    8 SLKATKRTKVVK-LKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQ-IYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTD--WIAIYQRKVEAPFIPKCKGPGDASNFDDYEEEEIRISSTEKC 281          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004683.1 (pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene:ENSPMAG00000004265.1 transcript:ENSPMAT00000004683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 4.791e-62
Identity = 93/178 (52.25%), Postives = 123/178 (69.10%), Query Frame = 2
Query:  488 AFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTN---TFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLG 1012
            AFQ +  LY++L +  GG+LFT L +E    E    FY+AE++LA+ HLH  GIIYRDLKPEN+LLD+ GH+ LTDFGLSKES+       +FCGT+EYMAPE++ R GH    DWWS G L+F+ML+G  PF Q  D++ET+T IL + +  P++ S E   L++ L KRNP  RLG
Sbjct:    1 AFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDESGHIGLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRKGHTHSADWWSFGVLMFEMLTGTLPF-QGKDRKETMTMILKAKLGMPQFLSGEAQSLLRMLFKRNPGNRLG 177          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 208.764 bits (530), Expect = 6.521e-60
Identity = 114/294 (38.78%), Postives = 170/294 (57.82%), Query Frame = 2
Query:  257 KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGT--LMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPEL 1123
            K+S++ F +L V+G+G +GKV L +    G    K +A+K LKK  ++  +        +R +L    HPFL  L   FQ + +L+ V+ + +GG+L  +++ +G   L      FY AE+   +  LH   IIYRDLK +NVLLD++GHVK+ DFG+ KE V    L  TFCGT +Y+APEIL    +G  VDWWS+G L+++ML G  PF    D+ E    I   T  YP++ S     ++  L +R+  +RLG    V DI+ H FFK  +I+W  +  R++ PPFKP++
Sbjct:  246 KLSLDHFHLLKVLGKGSFGKVMLAELKEQG----KFFAIKALKKEVVLMGDDVECTMVEKRVLLMACEHPFLTHLCGTFQTKEHLFFVMEFLTGGDLMFHIQDKGKFDLPTGTNRFYAAEVICGLQFLHSHNIIYRDLKLDNVLLDREGHVKIADFGMCKEHVGAGNLATTFCGTPDYIAPEILLGRAYGTSVDWWSMGVLIYEMLIGQSPFYGS-DEDELFEAIKGHTPHYPRWLSDSSRNILSCLFERDHTKRLGA---VGDIRLHPFFK--NIDWPSLEARKITPPFKPKV 529          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 273.863 bits (699), Expect = 6.575e-83
Identity = 143/333 (42.94%), Postives = 212/333 (63.66%), Query Frame = 2
Query:  260 ISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVA 1249
            +S++DF +L VIG+G +GKV  V+K     D  K+YA+K L+KA I+ ++ +  HT +ER +L  +  PF+V L ++FQ+   LY+VL + +GGELF +L+ EG     ++ FY+AE+  A+  LHK  +IYRDLKPEN+LLD +GH+ L DFGL K ++     T+TFCGT EY+APEIL   G+ K VDWW+LG LL++M++G PP+  E +      KIL   + +P  F      L+ GLL R+P  RLG  N  ++I+NH FFK  DI+W  +  +   PP+KP +KSE+D + FD  FT ++PI +  D   +  +   F G++Y+ 
Sbjct:  339 LSIDDFDLLKVIGKGSFGKVMQVRKK----DTQKIYALKALRKAYIV-SKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE-NVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGV-NGTDEIRNHPFFK--DISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASIQKQFGGWTYIG 662          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 276.174 bits (705), Expect = 1.699e-82
Identity = 151/340 (44.41%), Postives = 212/340 (62.35%), Query Frame = 2
Query:  269 EDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMI---RHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV-SLTNTFCGTIEYMAPE-ILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPK-YFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFT--------GQQPIMTPDDCNGAHILPDLFQGFSYV 1246
            +DF+VL ++G+G +G+V+ V+K     D  ++YAMKVL K ++I  + + AHT  ERNIL        PF+V L ++FQ  ++LY+V  Y SGGELF +L++EG   E++A FY+AE+ LA+ HLH   I+YRDLKPEN+LLD  G++ L DFGLSK  +   TNTFCGT EY+APE +L   G+ K VD+WSLG L+F+M  G  PF  E + Q+   KI    + +P+   S E    ++GLL RNPK RLG  +D  +++ H FF   DI+W  +  +++ PPFKP L SE D S FD  FT          QP+MT    + A  +   F GF++V
Sbjct:  410 QDFEVLRLLGKGTFGQVYQVKKK----DTQRIYAMKVLSK-KVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAE-NNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFA--DIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMMTATPLSPA--MQAKFAGFTFV 739          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 270.396 bits (690), Expect = 1.495e-81
Identity = 139/333 (41.74%), Postives = 211/333 (63.36%), Query Frame = 2
Query:  260 ISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVA 1249
            +S++DF +L VIG+G +GKV  V+K     D  K+YA+K ++K+ I+ ++ +  HT +ER +L  +  PF+V L ++FQ+   LY VL + +GGELF +L++EG    ++A FY AE+  A+ +LHK  ++YRDLKPEN+LLD +GH+ L DFGL K ++     T+TFCGT EY+APE+L   G+ K VDWW+LG LL++ML+G PP+  E D  +   KIL   + +P  F  +   L+ GLL R+P  RLG  N  ++I+NH FF    ++W  +  +   PP+KP + + MD S FD  FT ++PI +  D   +  +   F G++YV 
Sbjct:  342 LSIDDFDLLKVIGKGSFGKVMQVRK----KDTQKVYALKAIRKSYIV-SKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDE-DVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLGY-NGADEIRNHPFFS--QLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVDEYLSESVQKQFGGWTYVG 665          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 248.44 bits (633), Expect = 2.285e-76
Identity = 123/311 (39.55%), Postives = 197/311 (63.34%), Query Frame = 2
Query:  227 ICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLG-CKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPEL-KSEMDVSCFD 1153
            I Q+ V  G K S++DF++L  +G G +G+V L++   +G    + YAMKVLKK  ++R  K   HT  ER +L ++ HPF++++   FQ+   +++++ Y  GGELF+ L +        A FY AE+ LA+ +LH   IIYRDLKPEN+LLDK GH+K+TDFG +K    +T T CGT +Y+APE++    + K +DWWS G L+++ML+G  PF  + +  +T  KIL++ + +P +F+ +V  L+  L+ R+  +RLG  +N  ED+KNH +FK  ++ W  +  R ++ P++P + + + D S FD
Sbjct:   72 IAQARVTSG-KYSLQDFQILRTLGTGSFGRVHLIRSRHNG----RYYAMKVLKKEIVVRL-KQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFY-DSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFK--EVVWEKLLSRNIETPYEPPIQQGQGDTSQFD 373          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 244.973 bits (624), Expect = 3.446e-75
Identity = 122/310 (39.35%), Postives = 195/310 (62.90%), Query Frame = 2
Query:  233 QSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLG-CKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEM-DVSCFDS 1156
            +S+V+ G K ++ DF+++  +G G +G+V LV+   +G    + YA+KVLKK ++++  K   HT  ER +L+++ HPFL+++   FQ+  N+++V+ Y  GGELF+ L +        A FY AE+ LA+ +LH   IIYRDLKPEN+LLD+ GH+K+TDFG +KE  ++T T CGT +Y+APE++    + K VDWWSLG L+++ML+G  PF  +    +T  KIL   + YP YF  +VV L+  L+  +   R+G  ++   DIK H +F   ++ W  +  + ++ P++P + S + D S FD 
Sbjct:   57 KSLVSKG-KYTLHDFQIMRTLGTGSFGRVHLVRSVHNG----RYYAIKVLKKQQVVKM-KQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFY-DTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFS--EVVWERLLAKDIETPYEPPITSGIGDTSLFDQ 357          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 417.927 bits (1073), Expect = 5.191e-141
Identity = 213/410 (51.95%), Postives = 281/410 (68.54%), Query Frame = 2
Query:  122 NDFIRLSERDELSIQQFIQNGPLKREE---DDDIESVEICQSVVNP-GVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERL-GCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTGVSRHTRRRNNSG 1327
            ND    +  DELS       G +  E    D+ +E++++ +  VNP   K+  E F++L V+G+GGYGKVFLV+K+  GH + K++AMKVLKKA IIR++KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  +E+ ACFY++EIS+A+ HLHK GI+YRDLKPEN+LLD  GHVKLTDFGL KES+   SLT+TFCGTIEYMAPEIL R GHGK VDWWSLG L++DML+G PPF  + ++++TI KIL   +  P Y + E    I+ LLKR+P+ RL G   D   IK H FF+   I W D+  ++++PPF+P +  E DVS FDS FT Q P+ +PDD   +    ++FQGF+YVAP+V  S+         +    R N+G
Sbjct:   10 NDVALAAGEDELSSDDEFDEGQVYDEPMDGDERMETLQLSEETVNPKDEKVGPESFELLKVLGKGGYGKVFLVKKNH-GHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCAD-NRKKTIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFR--HICWEDLLAKKVEPPFRPSISGEEDVSQFDSKFTRQTPVDSPDDSMLSESASNIFQGFTYVAPSVLESLCRSDNFSPWKVRSPRKNTG 415          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO39163 (Ribosomal protein S6 kinase [Source:UniProtKB/TrEMBL;Acc:A7SAZ2])

HSP 1 Score: 320.472 bits (820), Expect = 2.532e-99
Identity = 161/345 (46.67%), Postives = 231/345 (66.96%), Query Frame = 2
Query:  257 KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRH-PFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKE-----SVSLTNTFCGTIEYMAPEILKRG--GHGKEVDWWSLGTLLFDMLSGGPPFSQECDK--QETITK-ILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNV 1258
            K+ +E+F++L V+G G YGKVFL +K   GH + +L+AMKVLKKA I++  K   HT++ER +LE +R  PFLV LH+AFQ ++ L++++ Y +GGELFT+L +     E++   Y+ EI +A+ HLH+ GIIYRD+K EN+LLDK GHV LTDFGLSKE     S     +FCGTIEYMAPE++K G  GH K VDWWSLG L++++L+G  PF+ + +K  Q  I+K ILH+    P   S+E + L+  LL+++PK+RLG K    ++K H FFK  D  W+D+  +R+  PFKP ++ E+DVS F   FT   P  +P           +F+G+S+VAP++
Sbjct:   10 KVGIENFELLRVLGTGAYGKVFLARKRG-GHHDGRLFAMKVLKKATIVQKAKTAEHTRTERQVLEAVRRCPFLVTLHWAFQTEAKLHLIMDYVNGGELFTHLYQREKFTEDEVRLYIGEIVVALDHLHQLGIIYRDIKLENILLDKDGHVVLTDFGLSKEFAAPNSGERAYSFCGTIEYMAPEVVKGGSRGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQSEISKRILHNNPPMPHDLSAEAIDLLHKLLQKDPKKRLGAKG-AHELKAHPFFKAFD--WADLAEKRIPAPFKPRIRDELDVSNFSEEFTDMAPTYSPAAV--PKTADRVFRGYSFVAPSI 348          

HSP 2 Score: 112.079 bits (279), Expect = 1.099e-25
Identity = 75/276 (27.17%), Postives = 132/276 (47.83%), Query Frame = 2
Query:  287 NVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLL---DKKGHVKLTDFGLS--KESVSLTNTFCGTIEYMAPEILKR----GGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYP---------KYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKT 1060
             V+G G +          SG +    YA+K++ +           HT+  +++     HP +V L+  +Q++ + Y+V+   +GGEL   + ++    E+ A   + +I  A+  +H+ G+++RDLKPEN+L     +   +K+ DFG +  K       T C T+ Y APE+L +     G+ +  D WSLG +L+ MLSG  PF       ++ T  +   I            +  S +   LIQGLL  +P +RL     V+++  H++ + 
Sbjct:  400 QVLGDGSFSTCRRCVHLRSGQE----YAVKIISRR--------CDHTREVQSLKMCHGHPNIVTLYDVYQDEFHTYLVMELLAGGELLERIRKKKMFTESAASVIMRKIVSAVEFMHQRGVVHRDLKPENLLFVDNSEDAEIKIVDFGFACVKPEAQQLQTPCFTLSYAAPEVLDQTVSNSGYDESCDLWSLGVILYTMLSGQVPFQSSGSWYKSSTGFVMQRITQGDVRFDGQQWQSISPQAKDLIQGLLTVDPSQRL----TVQEVLRHDWLRV 659          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 313.153 bits (801), Expect = 3.731e-98
Identity = 162/331 (48.94%), Postives = 216/331 (65.26%), Query Frame = 2
Query:  275 FKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV--SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKN-DVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNV 1258
            F++L V+G+G +GKVFLV+K   G D   LYAMKVLKKA +    +D   T  ER+IL  ++HPF+V+L+YAFQ +  +Y++L +  GG+LFT L +E    E    FY+AE++LA+ HLH  GIIYRDLKPEN+LLD  GHV LTDFGLSKES     T +FCGT+EYMAPE++ R GH +  DWWS G L+F+ML+G  PF Q  D+++T+  IL + +  P++ + E   L++ L KRNP  RLG  +  +EDIK H FF T  INW  +Y R + PPFKP      D   FD  FT + P  +P     A     LF+GFSYVAP++
Sbjct:    9 FELLKVLGQGSFGKVFLVRKVI-GADAGTLYAMKVLKKATL--KVRDRMRTMKERDILVDVQHPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDASGHVALTDFGLSKESEHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSYGVLMFEMLTGSLPF-QGKDRKDTMNMILKAKLGMPQFLTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFFST--INWELLYKREIKPPFKPAAGRADDAFYFDPEFTSKTPQDSPAVPPSA-TCHQLFRGFSYVAPDI 332          

HSP 2 Score: 106.301 bits (264), Expect = 5.515e-24
Identity = 67/212 (31.60%), Postives = 112/212 (52.83%), Query Frame = 2
Query:  266 MEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLL-DKKG---HVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFS 880
            ++++++   IG+G Y         + G    K YA+K+ +K +     KD   ++    +L    HP +V L  A++    +YIV+    GGEL   + +   L E +A   +  ++  I  LH+ G+++RDLKP N++  D  G    +++ DFG +K+  +   L  T C T  ++APE+LK+ G+    D WSLG LL+ MLSG  PF+
Sbjct:  353 LDEYEIKEEIGKGAYSSCRRCVNKADG----KEYAVKIFEKPK-----KDP--SEEMEILLRFGHHPNIVHLRDAYEAGKQVYIVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQMRATNGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGVLLYTMLSGLTPFA 553          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 290.041 bits (741), Expect = 1.506e-91
Identity = 161/371 (43.40%), Postives = 226/371 (60.92%), Query Frame = 2
Query:  200 EDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNIL-EMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPI--------------MTPDDCNGAHILPDLFQGFSYVAPN 1255
            +D D+E +++ +S  NP  K S  DF  L VIG+G +GKVFL    S    E+K YA+KVL K+  IR   +  H  +ERN+L + + HPFLV LHY+FQ +  LY VL Y +GGELF +L+RE    E++A FY AEI+ AIG+LH   IIYRDLKPEN+LLD KGH+ LTDFGL KE +     T+TFCGT EY+APE+L++  + K VDWW LG +L++M+ G PPF    D  E    ILH  +      S     +++GLL+++  +RLG  + D EDI+ H FF++  INW  +  R ++PP+ P +  ++D+  FD  F  ++P+               + DD +      D F GF+YVAP+
Sbjct:   52 DDADVEKIDLGESN-NPKAKPS--DFLFLKVIGKGSFGKVFL----SKNKQEDKFYAIKVLNKS-AIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSR-DTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRS--INWQQLVARGIEPPYNPNVSGQLDLKHFDPEFV-REPVPGSVGKSADSNFVSASVDDPD------DAFVGFTYVAPS 404          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 274.633 bits (701), Expect = 2.336e-82
Identity = 140/340 (41.18%), Postives = 221/340 (65.00%), Query Frame = 2
Query:  257 KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEM-IRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC--KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNG-AHILPDLFQGFSYVAPN 1255
            K++++DF  + V+G+G +GKV L ++   G DE  +YA+K+LKK  +++++ D   T  ER +L +   HPFL  LH +FQ    L+ V+ Y +GG+L   +++     EN++ FY AE+ LA+  LH+ G+IYRDLK +NVLLD  GH+KL DFG+ KE+++    T TFCGT +Y+APEIL+   +G  VDWW+LG L+++M++G PPF  E ++++    ILH  + YP + S E V +++G + +N  +RLGC   +    I+ H FF+   IN+  +  R+++PPFKP+++S  DV  FD+ FT ++P +TP D N   +I    F+GFS+V P+
Sbjct:  377 KMTLKDFTFIKVLGKGSFGKVLLAERK--GTDE--VYAIKILKKESVLQDD-DVECTMIERRVLALSAGHPFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPFEAE-NEEDLFESILHDDVLYPVWLSREAVSILKGFMTKNYLKRLGCTPTSTESSIREHAFFRL--INFEKLEARQINPPFKPKIRSRTDVGNFDTDFTKEEPKLTPTDRNVIVNIDQREFRGFSFVNPH 708          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: RPS6KB2 (ribosomal protein S6 kinase beta-2 [Source:NCBI gene;Acc:101163545])

HSP 1 Score: 413.305 bits (1061), Expect = 4.395e-138
Identity = 207/388 (53.35%), Postives = 273/388 (70.36%), Query Frame = 2
Query:  188 LKREEDDDIESVEICQSVVN-PGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLN----EPMTGVSRHTRRRNNS 1324
            LK+   D  E VE+   +VN    ++  + F++L V+G+G YGKVF V+K   G    K++AMKVLKKA+I+RN KDTAHT++ER ILE +RHPF+V L YAFQ    LY++L   SGGELF  LE+EG  ME+ ACFY+ EI+LA+GHLH  GIIYRDLKPEN++L+ +GH+KLTDFGL KES+   S+T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DM++G PPF+ E ++++TI KIL   +  P Y + +   LI+ LLK+NP +RLG  K D  DI+ H FFK   INW D+ ++R++PP+KP+L SE DVS FD+ FT Q P+ +PDD   +H     F GF+YVAP+V  S+      EP    SRH RR N+S
Sbjct:   25 LKKPAADHTEEVELTSEIVNRDSERVGPDCFELLTVLGKGAYGKVFQVRKVQ-GLQIGKIFAMKVLKKAKIVRNAKDTAHTRAEREILETVRHPFIVDLLYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLGEITLALGHLHSNGIIYRDLKPENIMLNHQGHIKLTDFGLCKESIHDGSVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMMTGSPPFTAE-NRKKTIDKILKCKLNLPPYLTIDARELIKKLLKKNPAQRLGSGKADAADIQKHSFFK--QINWDDLLNKRVEPPYKPQLHSEEDVSQFDTRFTRQTPVDSPDDSRLSHSAELAFAGFTYVAPSVLESLKEGFSFEPK---SRHMRRHNSS 405          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: RPS6KB2 (ribosomal protein S6 kinase beta-2 [Source:NCBI gene;Acc:101163545])

HSP 1 Score: 409.838 bits (1052), Expect = 1.006e-136
Identity = 205/384 (53.39%), Postives = 271/384 (70.57%), Query Frame = 2
Query:  200 EDDDIESVEICQSVVN-PGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLN----EPMTGVSRHTRRRNNS 1324
            E+   E VE+   +VN    ++  + F++L V+G+G YGKVF V+K   G    K++AMKVLKKA+I+RN KDTAHT++ER ILE +RHPF+V L YAFQ    LY++L   SGGELF  LE+EG  ME+ ACFY+ EI+LA+GHLH  GIIYRDLKPEN++L+ +GH+KLTDFGL KES+   S+T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DM++G PPF+ E ++++TI KIL   +  P Y + +   LI+ LLK+NP +RLG  K D  DI+ H FFK   INW D+ ++R++PP+KP+L SE DVS FD+ FT Q P+ +PDD   +H     F GF+YVAP+V  S+      EP    SRH RR N+S
Sbjct:   30 ENVQTEEVELTSEIVNRDSERVGPDCFELLTVLGKGAYGKVFQVRKVQ-GLQIGKIFAMKVLKKAKIVRNAKDTAHTRAEREILETVRHPFIVDLLYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLGEITLALGHLHSNGIIYRDLKPENIMLNHQGHIKLTDFGLCKESIHDGSVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMMTGSPPFTAE-NRKKTIDKILKCKLNLPPYLTIDARELIKKLLKKNPAQRLGSGKADAADIQKHSFFK--QINWDDLLNKRVEPPYKPQLHSEEDVSQFDTRFTRQTPVDSPDDSRLSHSAELAFAGFTYVAPSVLESLKEGFSFEPK---SRHMRRHNSS 406          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 407.527 bits (1046), Expect = 1.360e-135
Identity = 202/360 (56.11%), Postives = 262/360 (72.78%), Query Frame = 2
Query:  206 DDIESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERL-GCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            DD E  E+ ++ VN G  +I  E F++L V+G+GGYGKVF V+K S G    K+YAMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+  GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   ++ P Y + E   L++ LLKR+   RL G   D  +++ H FF+   INW D+  R+++PPFKP L+S  DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  +V
Sbjct:   15 DDCEKFELSENNVNKGTEQIRPECFELLKVLGKGGYGKVFQVRKVS-GASSGKIYAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFR--HINWDDLLARKVEPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENV 370          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 407.527 bits (1046), Expect = 2.094e-135
Identity = 202/360 (56.11%), Postives = 262/360 (72.78%), Query Frame = 2
Query:  206 DDIESVEICQSVVNPGV-KISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERL-GCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSV 1270
            DD E  E+ ++ VN G  +I  E F++L V+G+GGYGKVF V+K S G    K+YAMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+  GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   ++ P Y + E   L++ LLKR+   RL G   D  +++ H FF+   INW D+  R+++PPFKP L+S  DVS FDS FT Q P+ +PDD   +     +F GF+YVAP+V  +V
Sbjct:   25 DDCEKFELSENNVNKGTEQIRPECFELLKVLGKGGYGKVFQVRKVS-GASSGKIYAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFR--HINWDDLLARKVEPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENV 380          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: rps6kb1b (ribosomal protein S6 kinase beta-1-like [Source:NCBI gene;Acc:101174764])

HSP 1 Score: 405.986 bits (1042), Expect = 3.081e-135
Identity = 201/363 (55.37%), Postives = 260/363 (71.63%), Query Frame = 2
Query:  185 PLKREEDDDIESVEICQSVVNPGVK-ISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV---SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGC-KNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNV 1258
            P +   DD+ E +EI +  VN G + I  E F++L V+G+GGYGKVF V+K   G    K++AMKVLKKA I+RN KDTAHTK+ERNILE ++HPF+V L YAFQ    LY++L Y SGGELF  LEREG  ME+ ACFY+AEIS+A+GHLH+ GIIYRDLKPEN++L+ +GHVKLTDFGL KES+   ++T+TFCGTIEYMAPEIL R GH + VDWWSLG L++DML+G PPF+ E ++++TI KIL   +  P Y + E   L++ LLKR    RLG    D  +++ H FF+   INW D+  R+++PPFKP L+S  DVS FDS FT Q P+ +PDD   +      F GF+YVAP+V
Sbjct:   12 PEENVSDDENEEIEISEDNVNQGTESIRPECFELLRVLGKGGYGKVFQVRKVV-GAAAGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNSQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGE-NRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRTASSRLGAGPGDATEVQAHPFFR--HINWEDLLARKVEPPFKPVLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQAFLGFTYVAPSV 370          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000004478.1 (SMESG000004478.1)

HSP 1 Score: 1113.21 bits (2878), Expect = 0.000e+0
Identity = 547/547 (100.00%), Postives = 547/547 (100.00%), Query Frame = 2
Query:   68 MESSLDYIVTEDDIVSKDNDFIRLSERDELSIQQFIQNGPLKREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTGVSRHTRRRNNSGLSGNAFNGLNANSPFLNENDFIEMSCNDAYVNQPVTNALTYFPCTVNNTHFFASQSPYIPSQPSNFQPANISFIQNMYNPMGQFFKWNHNPIISTAPVFXXXXXXXXXXXXXCPIPIPQNESRKIPQ 1708
            MESSLDYIVTEDDIVSKDNDFIRLSERDELSIQQFIQNGPLKREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTGVSRHTRRRNNSGLSGNAFNGLNANSPFLNENDFIEMSCNDAYVNQPVTNALTYFPCTVNNTHFFASQSPYIPSQPSNFQPANISFIQNMYNPMGQFFKWNHNPIISTAPVFTSTPSSTQPNNSTCPIPIPQNESRKIPQ
Sbjct:    1 MESSLDYIVTEDDIVSKDNDFIRLSERDELSIQQFIQNGPLKREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTGVSRHTRRRNNSGLSGNAFNGLNANSPFLNENDFIEMSCNDAYVNQPVTNALTYFPCTVNNTHFFASQSPYIPSQPSNFQPANISFIQNMYNPMGQFFKWNHNPIISTAPVFTSTPSSTQPNNSTCPIPIPQNESRKIPQ 547          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000046977.1 (SMESG000046977.1)

HSP 1 Score: 382.104 bits (980), Expect = 2.851e-127
Identity = 179/235 (76.17%), Postives = 201/235 (85.53%), Query Frame = 2
Query:  578 MENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEP 1282
            MENQACFY+AEISLAIGHLH  GIIYRDLKPENVLLDK GHVKLTDFGLSKES + TNTFCGTIEYMAPEIL+R GH   VDWWSLGTLLFDMLSGGPPFSQE  KQ TI KIL + + +P YFS +V+ LI+GLLKRNPKERLG KNDVE+IK+H FF+ +DINW D+  R+++PPFKP+LKSE DVSCFDSTFT QQPI++PDD  G HI  D+F GFSYVAPNVA SVL+EP
Sbjct:    1 MENQACFYIAEISLAIGHLHSKGIIYRDLKPENVLLDKCGHVKLTDFGLSKESATSTNTFCGTIEYMAPEILRREGHTFVVDWWSLGTLLFDMLSGGPPFSQESSKQLTIEKILRAPLKFPMYFSLDVMGLIKGLLKRNPKERLGYKNDVEEIKSHIFFQKNDINWDDILSRKVEPPFKPDLKSEADVSCFDSTFTNQQPILSPDDSTGTHISEDIFTGFSYVAPNVAESVLSEP 235          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000068122.1 (SMESG000068122.1)

HSP 1 Score: 360.147 bits (923), Expect = 6.447e-118
Identity = 192/408 (47.06%), Postives = 269/408 (65.93%), Query Frame = 2
Query:  191 KREEDDDIESVEICQSVVNP-GVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEK-DTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKE--SVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERL-GCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTGVSRHTRRRNNSGLSGNAFNGLNANSPFLNENDFIEM 1399
            K E D   +SV+IC+  VNP GVK++  DF +L  +G+GGYG+VFL +K + G    + +AMKV+KKAR+I N+K DT +  +ERNILE + HPFLVKL++AFQ   +L++VL Y +GGELF  LER+ TL E++A FY+AE +LA+GHLH  G+IYRDLK ENV+LD+ GHVKLTDFGLSKE     LT++FCGT+EYMAPEIL+R GHG  VDWWS+G LL+DML G  PF    ++ + I K+ ++ +  P++ +     L++ LL +NPK RL G + DVE+IK H FF++  INW     R + PPF PEL S  DVS FD     +  +++P   + ++     F+ FSYV+P V    L+E  +   + TR   +   S    +  +  + FL E DF+++
Sbjct:   40 KDEYDSTSKSVDICEETVNPPGVKVTSHDFDLLKKLGKGGYGQVFLAKKVN-GAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVG-GNRSQVIQKVTNAKLKIPRFLTDSGKHLLKNLLNKNPKARLGGGEKDVEEIKRHFFFRS--INWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY--WFENFSYVSPQVYLE-LSENGSFSRQRTRSGVSHSSSSPGDSHHHQTTQFLFEEDFVDL 440          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000059433.1 (SMESG000059433.1)

HSP 1 Score: 342.428 bits (877), Expect = 1.940e-107
Identity = 178/393 (45.29%), Postives = 254/393 (64.63%), Query Frame = 2
Query:  122 NDFIRLSERDELSI-QQFIQNGPLKREEDDDIESVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESV-----SLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLG-CKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILP-DLFQGFSYVAPNVASSVLN 1276
             D   +S  +E+ + ++F  N   + EE  ++ +V++         K+    F++L V+G+G +GKVFLV+K S    +  LYAMKVLKKA +    +D   TK ER+IL  IRHPF+V LHYAFQN+  +Y++L +  GG+LF+ L +E    E+   FY+AE++LA+ HLH  GI+YRDLKPEN+LLD+ GH+KLTDFGLSKES+     + T +FCGT+EYMAPE++ R GHG   DWWS G L+F+ML+G  PF Q   ++ET+T IL + ++ P++ SSE   L++ L KRNP  R+G     +E+IK+  FF+   INW D+ +R++ PPFKP+     D SCFDS FT + P  +P  C  A     ++F+GFSYVAP+V     N
Sbjct:    7 TDSFHISNLNEVEVDEEFSDNAFSQEEEATEVNAVDLVDE------KLDSSHFELLRVLGQGSFGKVFLVRKVSEPQ-QGILYAMKVLKKASL--KVQDRKRTKMERDILAAIRHPFIVTLHYAFQNEGKVYLILEFLKGGDLFSRLSKEFMFTEDDVKFYLAELALALDHLHSLGIVYRDLKPENILLDEDGHIKLTDFGLSKESIYNDDANRTFSFCGTVEYMAPEVVNRKGHGTAADWWSFGVLMFEMLTGQLPF-QGSSRKETMTMILKAKLSMPQFLSSEAQTLLRVLFKRNPSNRIGFGPKGIEEIKSQPFFQL--INWKDLLNRKVTPPFKPKATCLDDTSCFDSQFTSKTPKESP--CQPASATANEIFRGFSYVAPDVLQHAQN 385          

HSP 2 Score: 116.316 bits (290), Expect = 9.488e-27
Identity = 88/298 (29.53%), Postives = 150/298 (50.34%), Query Frame = 2
Query:  188 LKREEDDDIESVEIC--QSVVNPGVKISMED--FKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNILEMIR-------HPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKG----HVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQ-ECDKQETITKILHS-----TIAYPKYFSSEVVRLIQGLLKRNPKERL 1009
            L+  ++ +IE ++I   Q++V  GVK    D  + +   IG+G +   +     ++G +    YA+KV+   +              R+++E +        HP +VKL   +  Q+ + +++ Y  GGEL T +  +    E +A   +  ++  + +LH   +++RDLKP N+L  KK     ++ + DFG +K+  +   L  T C T  ++APE+LK+ G+ K  D WSLG LLF MLSG  PF+Q E D  E I K +       T    ++ SSE   L+  +L  +P +R+
Sbjct:  380 LQHAQNTNIEDMKISGWQNIV--GVKFQKVDHYYTLKEEIGKGSFSVCYRAVHKTTGVN----YAIKVIDGTK--------------RDVIEEVEILFRFGAHPHIVKLKEVYVQQNTVSLIMEYLEGGELLTNILSQKYFSEKEASKILYVLTETVHYLHTNLVVHRDLKPSNILYSKKDTNPENLVICDFGFAKQQRAENGLLMTPCYTANFVAPEVLKKQGYDKASDVWSLGVLLFIMLSGKTPFTQNEHDPPEEILKRIEKKSFQLTGGQWEHISSEAKDLLLKMLHCDPAQRI 657          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000022857.1 (SMESG000022857.1)

HSP 1 Score: 267.314 bits (682), Expect = 9.918e-82
Identity = 141/339 (41.59%), Postives = 210/339 (61.95%), Query Frame = 2
Query:  272 DFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEKDTAHTKSERNIL-EMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKESVS---LTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPI--------MTPDDCNGAHILPDLFQGFSYVAP 1252
            DF  +  IG+G +GKVFL ++ S G     ++A+KVL K  I +   +  H  SERNIL + +RHPFL +L+++FQ +  LY  L Y +GGELF +L++E +  + +A FY AEI  ++G+LH   IIYRDLKPEN+LLD +GH+ LTDFGL KE +     T+TFCGT EY+APE++K+  + + VDWWS G+++++ML G PPF  + D  +   +IL+S +       S +  ++  L+++NPKERLG KND ++IK H FF    I+W  + ++++ PPF P++ S  D+   D  F  ++PI        +          + D F GFSYV P
Sbjct:  142 DFDFIKTIGKGSFGKVFLARRKSDG----AVFAVKVLYKENI-KKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQGHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQ-DTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQ--IDWVALVNKQVKPPFVPQVSSNADIRNIDPEFH-KEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 471          
The following BLAST results are available for this feature:
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS6KB12.979e-13556.58ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB15.010e-13556.58ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB11.672e-13456.58ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB22.678e-13354.06ribosomal protein S6 kinase B2 [Source:HGNC Symbol... [more]
RPS6KB12.260e-12152.94ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsks-12.642e-13355.59Ribosomal protein S6 kinase beta [Source:UniProtK... [more]
rskn-11.734e-9745.87Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-14.333e-9746.26Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-11.025e-9646.26Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-12.295e-9646.26Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
S6k2.209e-13856.09gene:FBgn0283472 transcript:FBtr0077114[more]
S6k2.209e-13856.09gene:FBgn0283472 transcript:FBtr0333264[more]
Pkc98E4.304e-8842.65gene:FBgn0003093 transcript:FBtr0301516[more]
S6kII4.338e-8847.43gene:FBgn0262866 transcript:FBtr0333715[more]
S6kII4.338e-8847.43gene:FBgn0262866 transcript:FBtr0077360[more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b1.218e-13555.56ribosomal protein S6 kinase b, polypeptide 1b [Sou... [more]
rps6kb1a8.323e-13455.83ribosomal protein S6 kinase b, polypeptide 1a [Sou... [more]
BX000486.19.885e-13455.83ribosomal protein S6 kinase b, polypeptide 1a [Sou... [more]
rps6kb1b3.145e-11950.00ribosomal protein S6 kinase b, polypeptide 1b [Sou... [more]
rps6ka24.728e-10445.74ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l3hypdh9.899e-13754.74L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh1.162e-13654.74L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh1.636e-13656.86L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh2.710e-13656.86L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh8.719e-13656.86L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rps6kb11.864e-13456.58ribosomal protein S6 kinase, polypeptide 1 [Source... [more]
Rps6kb21.846e-13254.06ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb21.846e-13254.06ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb21.767e-12755.42ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb21.767e-12755.42ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23443|KS6B1_HUMAN8.030e-13456.58Ribosomal protein S6 kinase beta-1 OS=Homo sapiens... [more]
sp|P67998|KS6B1_RABIT9.237e-13456.58Ribosomal protein S6 kinase beta-1 OS=Oryctolagus ... [more]
sp|P67999|KS6B1_RAT1.007e-13356.58Ribosomal protein S6 kinase beta-1 OS=Rattus norve... [more]
sp|Q8BSK8|KS6B1_MOUSE1.304e-13356.58Ribosomal protein S6 kinase beta-1 OS=Mus musculus... [more]
sp|Q6TJY3|KS6B1_BOVIN1.330e-13356.58Ribosomal protein S6 kinase beta-1 OS=Bos taurus O... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MBY00.000e+060.13Non-specific serine/threonine protein kinase OS=Op... [more]
A0A419PD321.918e-17762.44Non-specific serine/threonine protein kinase OS=Cl... [more]
C1LJV76.139e-17363.61Non-specific serine/threonine protein kinase OS=Sc... [more]
C1LJV89.528e-17363.61Non-specific serine/threonine protein kinase OS=Sc... [more]
C1LJV69.736e-17363.61Non-specific serine/threonine protein kinase OS=Sc... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b2.895e-13655.56ribosomal protein S6 kinase B1 [Source:NCBI gene;A... [more]
rps6kb1b8.505e-13655.56ribosomal protein S6 kinase B1 [Source:NCBI gene;A... [more]
ENSAMXT00000004157.23.373e-13551.11ribosomal protein S6 kinase B2 [Source:NCBI gene;A... [more]
rps6ka43.802e-10650.58ribosomal protein S6 kinase alpha-4-like [Source:N... [more]
rps6ka25.795e-10447.79ribosomal protein S6 kinase A2 [Source:NCBI gene;A... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006766.17.465e-9044.64pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000008480.16.345e-8642.26pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000001814.11.632e-7242.09pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
ENSPMAT00000004683.14.791e-6252.25pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene... [more]
PRKCD6.521e-6038.78protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPK26.575e-8342.94Protein kinase similar to S/T protein kinase Ypk1p... [more]
SCH91.699e-8244.41AGC family protein kinase; functional ortholog of ... [more]
YPK11.495e-8141.74S/T protein kinase; phosphorylates, downregulates ... [more]
TPK12.285e-7639.55cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK23.446e-7539.35cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411665.191e-14151.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391632.532e-9946.67Ribosomal protein S6 kinase [Source:UniProtKB/TrE... [more]
EDO318953.731e-9848.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378001.506e-9143.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355852.336e-8241.18Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS6KB24.395e-13853.35ribosomal protein S6 kinase beta-2 [Source:NCBI ge... [more]
RPS6KB21.006e-13653.39ribosomal protein S6 kinase beta-2 [Source:NCBI ge... [more]
rps6kb1a1.360e-13556.11ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
rps6kb1a2.094e-13556.11ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
rps6kb1b3.081e-13555.37ribosomal protein S6 kinase beta-1-like [Source:NC... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004478.10.000e+0100.00SMESG000004478.1[more]
SMESG000046977.12.851e-12776.17SMESG000046977.1[more]
SMESG000068122.16.447e-11847.06SMESG000068122.1[more]
SMESG000059433.11.940e-10745.29SMESG000059433.1[more]
SMESG000022857.19.918e-8241.59SMESG000022857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023085 ID=SMED30023085|Name=Non-specific serine/threonine protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2024bp
TTTTATAATTTTTAAATTTATATTTTATATAGACTATTAATAGATTTAAA
ATTTGATATAGATATAAATGGAATCAAGTTTAGATTACATAGTTACAGAA
GATGATATAGTCTCAAAAGATAATGATTTTATAAGATTATCAGAACGAGA
TGAATTATCAATACAGCAATTTATTCAAAATGGTCCTTTAAAAAGAGAAG
AAGATGATGATATTGAAAGCGTGGAAATTTGTCAATCAGTAGTCAATCCT
GGTGTGAAAATTAGTATGGAAGATTTTAAAGTTTTAAATGTAATTGGTAG
AGGAGGTTATGGAAAAGTTTTTTTGGTACAAAAGTCATCGAGTGGTCACG
ATGAAAATAAGTTATATGCTATGAAAGTTTTAAAGAAAGCGCGTATAATT
CGCAACGAAAAAGACACAGCACATACTAAATCAGAGAGAAATATATTAGA
GATGATTCGGCATCCTTTTTTGGTTAAATTACATTATGCTTTTCAAAACC
AATCAAATCTGTATATTGTTTTAACGTATTGTTCCGGTGGGGAATTATTT
ACTTACCTTGAAAGAGAAGGAACATTGATGGAAAATCAAGCTTGTTTTTA
TGTTGCAGAAATAAGTTTAGCAATAGGTCATTTGCATAAAACGGGTATAA
TTTACAGAGACTTAAAACCCGAAAATGTGTTACTTGATAAAAAAGGTCAT
GTTAAACTGACAGATTTTGGTTTATCAAAAGAAAGCGTTTCATTAACGAA
TACATTTTGCGGAACTATTGAATATATGGCTCCTGAAATATTAAAACGAG
GTGGCCATGGTAAAGAAGTTGATTGGTGGAGTTTAGGAACACTTTTGTTT
GATATGTTATCAGGAGGACCACCTTTCAGTCAAGAATGTGACAAACAAGA
AACAATAACAAAGATATTACATTCAACTATAGCATATCCAAAATATTTTT
CGTCAGAAGTTGTTCGCCTAATTCAAGGATTACTAAAAAGAAATCCTAAA
GAACGATTAGGTTGTAAAAACGACGTTGAAGATATTAAAAATCATGAATT
TTTCAAAACACATGATATAAATTGGTCTGATGTTTATCACAGGAGAATGG
ATCCACCTTTTAAGCCAGAACTGAAATCAGAAATGGATGTTAGTTGTTTC
GATTCAACATTTACTGGTCAACAGCCTATAATGACACCAGATGATTGCAA
TGGTGCGCATATTTTACCTGATTTGTTTCAAGGTTTTTCATATGTTGCCC
CTAATGTCGCATCCAGCGTGCTCAATGAACCCATGACTGGTGTTAGTAGG
CATACTAGGCGCAGAAATAATTCAGGACTGTCAGGCAATGCATTCAATGG
TCTCAATGCGAATTCTCCGTTTCTTAATGAAAATGATTTTATTGAAATGA
GTTGCAATGACGCTTATGTTAACCAGCCTGTGACAAATGCATTGACATAT
TTCCCATGTACTGTTAACAATACCCATTTTTTTGCTTCACAATCACCTTA
CATACCTTCACAGCCGTCGAATTTCCAACCGGCAAATATCAGTTTTATTC
AGAATATGTACAACCCAATGGGCCAGTTTTTCAAATGGAATCACAATCCA
ATTATCAGTACAGCTCCAGTTTTCACTTCAACCCCCTCAAGTACTCAGCC
AAACAACTCAACCTGTCCTATACCGATTCCACAAAATGAATCCAGAAAAA
TTCCACAATAATAATAATTGACAAACAGTTTTTATTATTTATTAAATGTC
GAATTTGTTTTGTACAAAATAATCTATTTGCAATATGCAATTTGTGTTTG
TTGTCAACTTGTGATTGAGTGCCCCCTTTGTAAATCATTTGTGAATAGGA
TTTGTATTTTTCTTTTATTCTAGTGTAACGATTTGATTTCTGGTTTAATA
TGTGCTGCGGAAATTACTGTTTTTATGGAGGTTGATGATGGATATTTTGT
TAAAGAAATTATCAAATCTTTCAATACAGGGTTTTTGAAATAAATTTACT
AAAATAAAACAAATTTATTAACTA
back to top

protein sequence of SMED30023085-orf-1

>SMED30023085-orf-1 ID=SMED30023085-orf-1|Name=SMED30023085-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MESSLDYIVTEDDIVSKDNDFIRLSERDELSIQQFIQNGPLKREEDDDIE
SVEICQSVVNPGVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLY
AMKVLKKARIIRNEKDTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYI
VLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLK
PENVLLDKKGHVKLTDFGLSKESVSLTNTFCGTIEYMAPEILKRGGHGKE
VDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVR
LIQGLLKRNPKERLGCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKP
ELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASS
VLNEPMTGVSRHTRRRNNSGLSGNAFNGLNANSPFLNENDFIEMSCNDAY
VNQPVTNALTYFPCTVNNTHFFASQSPYIPSQPSNFQPANISFIQNMYNP
MGQFFKWNHNPIISTAPVFTSTPSSTQPNNSTCPIPIPQNESRKIPQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR000961AGC-kinase_C
IPR017892Pkinase_C
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 332..394
e-value: 3.6E-15
score: 66.4
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 332..402
score: 15.3
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 70..329
e-value: 4.4E-103
score: 358.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 71..329
e-value: 5.2E-70
score: 235.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 70..329
score: 52.004
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 70..366
e-value: 6.7E-124
score: 414.7
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 159..353
e-value: 6.7E-124
score: 414.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 521..538
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 521..547
NoneNo IPR availablePANTHERPTHR24351:SF166RIBOSOMAL PROTEIN S6 KINASEcoord: 32..397
NoneNo IPR availablePANTHERPTHR24351RIBOSOMAL PROTEIN S6 KINASEcoord: 32..397
IPR017892Protein kinase, C-terminalPFAMPF00433Pkinase_Ccoord: 352..392
e-value: 2.7E-6
score: 28.0
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 76..103
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 194..206
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 67..404